MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F39.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F39.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63.0	null	567-UNIMOD:35	0.09	63.0	3	2	1
PRT	sp|P38398|BRCA1_HUMAN	Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	61.0	null	226-UNIMOD:4	0.02	61.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	58.0	null	198-UNIMOD:35	0.09	58.0	3	2	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.13	57.0	2	2	2
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.06	57.0	1	1	1
PRT	sp|Q13595-4|TRA2A_HUMAN	Isoform 4 of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57.0	null		0.13	57.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56.0	null		0.07	56.0	2	1	0
PRT	sp|Q15910|EZH2_HUMAN	Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54.0	null	320-UNIMOD:4,324-UNIMOD:4	0.03	54.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.06	52.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	246-UNIMOD:4,140-UNIMOD:4	0.11	51.0	3	3	3
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51.0	null		0.01	51.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	83-UNIMOD:4	0.25	50.0	2	2	2
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	975-UNIMOD:4,989-UNIMOD:35	0.04	50.0	3	3	3
PRT	sp|P10321|HLAC_HUMAN	HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null	345-UNIMOD:4,350-UNIMOD:4,364-UNIMOD:4	0.09	50.0	1	1	1
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.10	49.0	3	2	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null	73-UNIMOD:4,79-UNIMOD:35	0.20	48.0	4	2	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	74-UNIMOD:4,77-UNIMOD:35	0.01	47.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.10	47.0	2	2	2
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	1	1	1
PRT	sp|Q9BWJ5|SF3B5_HUMAN	Splicing factor 3B subunit 5 OS=Homo sapiens OX=9606 GN=SF3B5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.24	47.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null		0.03	47.0	2	1	0
PRT	sp|Q9BWH6-2|RPAP1_HUMAN	Isoform 2 of RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	5	2	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null		0.06	46.0	4	3	2
PRT	sp|O75487|GPC4_HUMAN	Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.03	46.0	1	1	1
PRT	sp|Q14997-2|PSME4_HUMAN	Isoform 2 of Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.01	46.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	204-UNIMOD:35	0.09	46.0	2	1	0
PRT	sp|P07099|HYEP_HUMAN	Epoxide hydrolase 1 OS=Homo sapiens OX=9606 GN=EPHX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.13	46.0	1	1	1
PRT	sp|Q4LE39|ARI4B_HUMAN	AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	217-UNIMOD:35	0.12	46.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	126-UNIMOD:35	0.10	45.0	2	1	0
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	46-UNIMOD:35	0.18	44.0	4	2	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	1212-UNIMOD:35	0.03	44.0	2	2	2
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	2	2	2
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	157-UNIMOD:35	0.11	44.0	2	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	708-UNIMOD:4	0.03	44.0	1	1	1
PRT	sp|Q9NSV4-7|DIAP3_HUMAN	Isoform 7 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	2	2	2
PRT	sp|Q6P9B9|INT5_HUMAN	Integrator complex subunit 5 OS=Homo sapiens OX=9606 GN=INTS5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.10	43.0	3	2	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.05	43.0	2	2	2
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	2	2
PRT	sp|Q9BPU6|DPYL5_HUMAN	Dihydropyrimidinase-related protein 5 OS=Homo sapiens OX=9606 GN=DPYSL5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q01804-5|OTUD4_HUMAN	Isoform 2 of OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	3	1	0
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|Q7Z6E9-4|RBBP6_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	912-UNIMOD:35	0.05	41.0	5	4	3
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	30-UNIMOD:35,179-UNIMOD:35	0.17	41.0	8	4	2
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q86WP2-4|GPBP1_HUMAN	Isoform 4 of Vasculin OS=Homo sapiens OX=9606 GN=GPBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|Q9P2B2|FPRP_HUMAN	Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	941-UNIMOD:35,931-UNIMOD:4	0.04	41.0	6	5	4
PRT	sp|Q9NT62-2|ATG3_HUMAN	Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|P13995|MTDC_HUMAN	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	207-UNIMOD:35,211-UNIMOD:35	0.09	41.0	6	2	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.04	41.0	4	3	2
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.11	41.0	3	3	3
PRT	sp|O14646|CHD1_HUMAN	Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P09622-3|DLDH_HUMAN	Isoform 3 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	100-UNIMOD:35,436-UNIMOD:4	0.07	40.0	2	2	2
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	332-UNIMOD:35	0.07	40.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.13	40.0	3	3	3
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.08	40.0	5	4	3
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.03	40.0	3	3	3
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	704-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	264-UNIMOD:35	0.07	40.0	2	2	2
PRT	sp|Q8NHH9-3|ATLA2_HUMAN	Isoform 3 of Atlastin-2 OS=Homo sapiens OX=9606 GN=ATL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	2	1	0
PRT	sp|P34949|MPI_HUMAN	Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	3	2	1
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.06	39.0	2	2	2
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	2	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	264-UNIMOD:35	0.02	39.0	2	2	2
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	2	2	2
PRT	sp|Q13620-1|CUL4B_HUMAN	Isoform 2 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	619-UNIMOD:4	0.04	39.0	2	2	2
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	2	2
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	363-UNIMOD:35	0.12	39.0	5	3	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	3317-UNIMOD:4	0.01	39.0	3	3	2
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.04	39.0	2	2	2
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.10	39.0	4	3	2
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	5	3	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	19-UNIMOD:4	0.15	39.0	3	2	1
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	999-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	2	1	0
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	1240-UNIMOD:35,2444-UNIMOD:35	0.03	38.0	5	4	3
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.09	38.0	3	3	3
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.17	38.0	10	5	3
PRT	sp|O43665|RGS10_HUMAN	Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.12	38.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	2	2	2
PRT	sp|Q9NQC3-3|RTN4_HUMAN	Isoform C of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O43324-2|MCA3_HUMAN	Isoform 2 of Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|Q8NBT2-2|SPC24_HUMAN	Isoform 2 of Kinetochore protein Spc24 OS=Homo sapiens OX=9606 GN=SPC24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	4	3	2
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P49750-3|YLPM1_HUMAN	Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.09	37.0	3	2	1
PRT	sp|Q9NZL4|HPBP1_HUMAN	Hsp70-binding protein 1 OS=Homo sapiens OX=9606 GN=HSPBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	18	2	1
PRT	sp|Q96L91-3|EP400_HUMAN	Isoform 3 of E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	386-UNIMOD:35	0.02	37.0	2	2	2
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.21	37.0	2	2	2
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	153-UNIMOD:35,217-UNIMOD:4,47-UNIMOD:35,305-UNIMOD:35,44-UNIMOD:35	0.38	37.0	11	7	6
PRT	sp|P09493|TPM1_HUMAN	Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	201-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null	69-UNIMOD:4	0.24	37.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	45-UNIMOD:4	0.22	36.0	2	1	0
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.13	36.0	2	1	0
PRT	sp|P23919-2|KTHY_HUMAN	Isoform 2 of Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.10	36.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.01	36.0	2	1	0
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	124-UNIMOD:35	0.13	36.0	2	1	0
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	87-UNIMOD:35,99-UNIMOD:4	0.05	36.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	781-UNIMOD:35,22-UNIMOD:35	0.06	36.0	4	3	2
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P35580-5|MYH10_HUMAN	Isoform 5 of Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	4	4	4
PRT	sp|Q9NQH7-3|XPP3_HUMAN	Isoform 3 of Xaa-Pro aminopeptidase 3 OS=Homo sapiens OX=9606 GN=XPNPEP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	219-UNIMOD:35	0.08	36.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|P28838|AMPL_HUMAN	Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9UBU6|FA8A1_HUMAN	Protein FAM8A1 OS=Homo sapiens OX=9606 GN=FAM8A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	93-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	101-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	363-UNIMOD:35	0.09	35.0	2	2	2
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	413-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	175-UNIMOD:4	0.15	35.0	4	3	2
PRT	sp|Q9BZV1-2|UBXN6_HUMAN	Isoform 2 of UBX domain-containing protein 6 OS=Homo sapiens OX=9606 GN=UBXN6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q14203-3|DCTN1_HUMAN	Isoform 3 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:4	0.02	35.0	2	2	2
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	594-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q9UJX4-3|APC5_HUMAN	Isoform 3 of Anaphase-promoting complex subunit 5 OS=Homo sapiens OX=9606 GN=ANAPC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9BW27-3|NUP85_HUMAN	Isoform 3 of Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q53HC9|EIPR1_HUMAN	EARP and GARP complex-interacting protein 1 OS=Homo sapiens OX=9606 GN=EIPR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	198-UNIMOD:4	0.10	35.0	2	2	2
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	916-UNIMOD:35,920-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q96D71|REPS1_HUMAN	RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	512-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	515-UNIMOD:35	0.10	34.0	5	5	5
PRT	sp|Q9BYJ9|YTHD1_HUMAN	YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|O75530-3|EED_HUMAN	Isoform 3 of Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q7L2E3-3|DHX30_HUMAN	Isoform 3 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	3	2	1
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	39-UNIMOD:4	0.03	34.0	2	1	0
PRT	sp|P16930-2|FAAA_HUMAN	Isoform 2 of Fumarylacetoacetase OS=Homo sapiens OX=9606 GN=FAH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	79-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	57-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|P15259|PGAM2_HUMAN	Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.12	34.0	2	2	2
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	171-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	903-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	171-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O75127|PTCD1_HUMAN	Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	695-UNIMOD:4	0.03	34.0	2	1	0
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	3	3	3
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	119-UNIMOD:35	0.26	34.0	4	4	4
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	2	2	2
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	4	3	2
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	58-UNIMOD:4	0.14	33.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	174-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q9Y2L5-2|TPPC8_HUMAN	Isoform 2 of Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q8TBX8-2|PI42C_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q969X5-2|ERGI1_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens OX=9606 GN=ERGIC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	54-UNIMOD:35	0.14	33.0	2	1	0
PRT	sp|O96028-2|NSD2_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:4,112-UNIMOD:4,115-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q8IX01-4|SUGP2_HUMAN	Isoform 4 of SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	3	3	3
PRT	sp|Q9H223|EHD4_HUMAN	EH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=EHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8IUE6|H2A2B_HUMAN	Histone H2A type 2-B OS=Homo sapiens OX=9606 GN=H2AC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	1	1	1
PRT	sp|O75879|GATB_HUMAN	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Homo sapiens OX=9606 GN=GATB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	432-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	4	4	4
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	652-UNIMOD:4	0.01	33.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	178-UNIMOD:4	0.08	33.0	1	1	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	499-UNIMOD:35	0.04	33.0	2	2	2
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	1197-UNIMOD:35	0.02	33.0	3	2	1
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q92599|SEPT8_HUMAN	Septin-8 OS=Homo sapiens OX=9606 GN=SEPTIN8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	540-UNIMOD:4	0.02	32.0	2	1	0
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P23378|GCSP_HUMAN	Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P57740-2|NU107_HUMAN	Isoform 2 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	3	3	3
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9Y6E2-2|BZW2_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	93-UNIMOD:35,97-UNIMOD:4	0.10	32.0	1	1	1
PRT	sp|Q8NFH3-2|NUP43_HUMAN	Isoform 2 of Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	78-UNIMOD:35	0.06	32.0	2	1	0
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	129-UNIMOD:4	0.16	32.0	1	1	1
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	2	2	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	23-UNIMOD:4	0.06	32.0	4	2	0
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	58-UNIMOD:35	0.18	32.0	3	2	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	2	2
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P11277-3|SPTB1_HUMAN	Isoform 3 of Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	133-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q9H8S9-2|MOB1A_HUMAN	Isoform 2 of MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P56211-2|ARP19_HUMAN	Isoform ARPP-16 of cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.17	32.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	211-UNIMOD:35	0.02	32.0	4	1	0
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	463-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	277-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	88-UNIMOD:35	0.29	31.0	8	3	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	373-UNIMOD:35,379-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	202-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	372-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	3	2	1
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	3	2	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9UL33-2|TPC2L_HUMAN	Isoform 2 of Trafficking protein particle complex subunit 2-like protein OS=Homo sapiens OX=9606 GN=TRAPPC2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	111-UNIMOD:35,112-UNIMOD:4	0.15	31.0	1	1	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	138-UNIMOD:35	0.08	31.0	2	1	0
PRT	sp|P00813|ADA_HUMAN	Adenosine deaminase OS=Homo sapiens OX=9606 GN=ADA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	72-UNIMOD:35	0.07	31.0	2	1	0
PRT	sp|Q9HAP2-3|MLXIP_HUMAN	Isoform 3 of MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	83-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q13418|ILK_HUMAN	Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q6ZRI6|CO039_HUMAN	Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	216-UNIMOD:35	0.06	31.0	3	2	1
PRT	sp|P35610|SOAT1_HUMAN	Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q99816|TS101_HUMAN	Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P23919|KTHY_HUMAN	Thymidylate kinase OS=Homo sapiens OX=9606 GN=DTYMK PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:35	0.16	31.0	7	3	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9Y6M1|IF2B2_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	255-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	347-UNIMOD:4,357-UNIMOD:4,360-UNIMOD:35,362-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	26-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	269-UNIMOD:35	0.05	30.0	3	2	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	140-UNIMOD:35	0.08	30.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	115-UNIMOD:4	0.38	30.0	4	4	4
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P43250-3|GRK6_HUMAN	Isoform GRK6C of G protein-coupled receptor kinase 6 OS=Homo sapiens OX=9606 GN=GRK6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	49-UNIMOD:4,57-UNIMOD:35	0.04	30.0	2	1	0
PRT	sp|O75521-2|ECI2_HUMAN	Isoform 2 of Enoyl-CoA delta isomerase 2 OS=Homo sapiens OX=9606 GN=ECI2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	333-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.12	30.0	2	2	2
PRT	sp|Q9NZN3-2|EHD3_HUMAN	Isoform 2 of EH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EHD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q8WYA6-3|CTBL1_HUMAN	Isoform 3 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q8IU60-2|DCP2_HUMAN	Isoform 2 of m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=DCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	676-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	499-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q04727-2|TLE4_HUMAN	Isoform 2 of Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	361-UNIMOD:35	0.02	30.0	1	1	0
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O95251|KAT7_HUMAN	Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	185-UNIMOD:4,190-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	3	3	3
PRT	sp|P84101|SERF2_HUMAN	Small EDRK-rich factor 2 OS=Homo sapiens OX=9606 GN=SERF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.20	30.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	204-UNIMOD:35	0.09	30.0	4	2	0
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	3	3	3
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	558-UNIMOD:35	0.10	30.0	6	5	4
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|O15397|IPO8_HUMAN	Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9NUL7|DDX28_HUMAN	Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens OX=9606 GN=DDX28 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q8IWC1|MA7D3_HUMAN	MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q92804|RBP56_HUMAN	TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	376-UNIMOD:4,379-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	23-UNIMOD:4,30-UNIMOD:35	0.18	30.0	2	1	0
PRT	sp|Q96GM5|SMRD1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q6P1X5|TAF2_HUMAN	Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1121-UNIMOD:35,1123-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q9BU76-4|MMTA2_HUMAN	Isoform 4 of Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	205-UNIMOD:4	0.10	29.0	2	2	2
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q96HV5|TM41A_HUMAN	Transmembrane protein 41A OS=Homo sapiens OX=9606 GN=TMEM41A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q13907|IDI1_HUMAN	Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	2	2	2
PRT	sp|P62995-3|TRA2B_HUMAN	Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|Q8IYS1|P20D2_HUMAN	Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	3	2	1
PRT	sp|Q15345-3|LRC41_HUMAN	Isoform 3 of Leucine-rich repeat-containing protein 41 OS=Homo sapiens OX=9606 GN=LRRC41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	518-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q8N6M0|OTU6B_HUMAN	Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	3	2	1
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q13542|4EBP2_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 2 OS=Homo sapiens OX=9606 GN=EIF4EBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	118-UNIMOD:35	0.13	29.0	1	1	1
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	80-UNIMOD:4	0.01	29.0	2	1	0
PRT	sp|P31040-2|SDHA_HUMAN	Isoform 2 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	124-UNIMOD:35	0.08	29.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	118-UNIMOD:4,121-UNIMOD:35	0.10	29.0	2	2	2
PRT	sp|Q8IWS0-4|PHF6_HUMAN	Isoform 4 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	211-UNIMOD:4,214-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9BT78-2|CSN4_HUMAN	Isoform 2 of COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	3	3	3
PRT	sp|Q9NZQ3-5|SPN90_HUMAN	Isoform 5 of NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	117-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|Q9UEG4|ZN629_HUMAN	Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	425-UNIMOD:35,434-UNIMOD:35,435-UNIMOD:35,428-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|P82930|RT34_HUMAN	28S ribosomal protein S34, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	135-UNIMOD:35	0.12	29.0	2	2	2
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	0
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.11	29.0	12	1	0
PRT	sp|Q969G3|SMCE1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	50-UNIMOD:4	0.18	29.0	1	1	1
PRT	sp|Q9P0I2|EMC3_HUMAN	ER membrane protein complex subunit 3 OS=Homo sapiens OX=9606 GN=EMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	2	2	2
PRT	sp|Q96S94|CCNL2_HUMAN	Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P60002|ELOF1_HUMAN	Transcription elongation factor 1 homolog OS=Homo sapiens OX=9606 GN=ELOF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	16-UNIMOD:35,26-UNIMOD:4,29-UNIMOD:4	0.25	29.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q8TBZ6|TM10A_HUMAN	tRNA methyltransferase 10 homolog A OS=Homo sapiens OX=9606 GN=TRMT10A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	523-UNIMOD:35,549-UNIMOD:35,557-UNIMOD:35	0.05	28.0	3	2	1
PRT	sp|Q9BTE3-3|MCMBP_HUMAN	Isoform 3 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NY27-2|PP4R2_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O14545-2|TRAD1_HUMAN	Isoform 2 of TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	109-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|Q9Y639-3|NPTN_HUMAN	Isoform 3 of Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	102-UNIMOD:4	0.08	28.0	1	1	0
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9Y3D8-2|KAD6_HUMAN	Isoform 2 of Adenylate kinase isoenzyme 6 OS=Homo sapiens OX=9606 GN=AK6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	64-UNIMOD:35	0.05	28.0	2	2	2
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	21-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9Y6K9-3|NEMO_HUMAN	Isoform 3 of NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	76-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|O75190-3|DNJB6_HUMAN	Isoform C of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	275-UNIMOD:4	0.08	28.0	2	2	2
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.13	28.0	1	1	1
PRT	sp|O60783|RT14_HUMAN	28S ribosomal protein S14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	2	1	0
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	94-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	141-UNIMOD:35	0.06	28.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q96GA3|LTV1_HUMAN	Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P20839-2|IMDH1_HUMAN	Isoform 2 of Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens OX=9606 GN=IMPDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	470-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	184-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q8IWR0|Z3H7A_HUMAN	Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P53675|CLH2_HUMAN	Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8NFH3|NUP43_HUMAN	Nucleoporin Nup43 OS=Homo sapiens OX=9606 GN=NUP43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	78-UNIMOD:35	0.04	28.0	1	1	0
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9GZZ1|NAA50_HUMAN	N-alpha-acetyltransferase 50 OS=Homo sapiens OX=9606 GN=NAA50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	2	2	2
PRT	sp|P51572|BAP31_HUMAN	B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	410-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	2	2	2
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q9BW61|DDA1_HUMAN	DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.19	28.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O43670-2|ZN207_HUMAN	Isoform 2 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	54-UNIMOD:4,55-UNIMOD:35	0.04	27.0	1	1	0
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	2	2	2
PRT	sp|Q96EL2|RT24_HUMAN	28S ribosomal protein S24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	2	1	0
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	58-UNIMOD:4	0.08	27.0	3	3	3
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	311-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O43852-9|CALU_HUMAN	Isoform 9 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.16	27.0	3	2	1
PRT	sp|Q8IZP0-2|ABI1_HUMAN	Isoform 2 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1173-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	237-UNIMOD:35	0.09	27.0	4	3	2
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NWX5-2|ASB6_HUMAN	Isoform 2 of Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens OX=9606 GN=ASB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q9Y371-3|SHLB1_HUMAN	Isoform 3 of Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q13085-2|ACACA_HUMAN	Isoform 2 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96ME7-2|ZN512_HUMAN	Isoform 2 of Zinc finger protein 512 OS=Homo sapiens OX=9606 GN=ZNF512	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q12907|LMAN2_HUMAN	Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	107-UNIMOD:4	0.07	27.0	2	2	2
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|A8CG34|P121C_HUMAN	Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q5EBL8|PDZ11_HUMAN	PDZ domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PDZD11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q5SQN1-2|SNP47_HUMAN	Isoform 2 of Synaptosomal-associated protein 47 OS=Homo sapiens OX=9606 GN=SNAP47	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	196-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	623-UNIMOD:35,622-UNIMOD:35	0.02	27.0	4	3	2
PRT	sp|O75643-2|U520_HUMAN	Isoform 2 of U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	3333-UNIMOD:4	0.00	27.0	1	1	0
PRT	sp|Q04727|TLE4_HUMAN	Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	430-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q6IA86|ELP2_HUMAN	Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=H3-4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	2	2	2
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	389-UNIMOD:4	0.03	27.0	2	2	2
PRT	sp|Q9NRL2|BAZ1A_HUMAN	Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	2	2	2
PRT	sp|Q9BQ52|RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	3	2	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P18077|RL35A_HUMAN	60S ribosomal protein L35a OS=Homo sapiens OX=9606 GN=RPL35A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	1241-UNIMOD:35	0.02	27.0	6	6	6
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	3	3	3
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	441-UNIMOD:35	0.04	27.0	3	2	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	3	3	3
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	363-UNIMOD:4,367-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q9H9A5|CNO10_HUMAN	CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	735-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	71-UNIMOD:4,86-UNIMOD:35	0.14	26.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	3	3	3
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q8TEU7|RPGF6_HUMAN	Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9BRJ6|CG050_HUMAN	Uncharacterized protein C7orf50 OS=Homo sapiens OX=9606 GN=C7orf50 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	130-UNIMOD:35	0.08	26.0	1	1	1
PRT	sp|Q9Y512|SAM50_HUMAN	Sorting and assembly machinery component 50 homolog OS=Homo sapiens OX=9606 GN=SAMM50 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.13	26.0	1	1	1
PRT	sp|Q6P1X6-2|CH082_HUMAN	Isoform 2 of UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	99-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|Q9Y3Z3-4|SAMH1_HUMAN	Isoform 4 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	320-UNIMOD:4	0.03	26.0	2	1	0
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	88-UNIMOD:35,464-UNIMOD:35	0.06	26.0	3	2	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q15750|TAB1_HUMAN	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q8NB37|GALD1_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GATD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	200-UNIMOD:35,208-UNIMOD:35	0.08	26.0	5	2	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	291-UNIMOD:35	0.02	26.0	2	2	2
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|P57678|GEMI4_HUMAN	Gem-associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9H8K7|PAAT_HUMAN	ATPase PAAT OS=Homo sapiens OX=9606 GN=PAAT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	73-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|P15586-2|GNS_HUMAN	Isoform 2 of N-acetylglucosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GNS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	4	4	4
PRT	sp|Q10570|CPSF1_HUMAN	Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|Q14493|SLBP_HUMAN	Histone RNA hairpin-binding protein OS=Homo sapiens OX=9606 GN=SLBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q969Z0|FAKD4_HUMAN	FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	3	1	0
PRT	sp|Q9HD45|TM9S3_HUMAN	Transmembrane 9 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM9SF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	3	3
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	2	2	2
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	3	3	3
PRT	sp|P82663|RT25_HUMAN	28S ribosomal protein S25, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.00	26.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q86WJ1|CHD1L_HUMAN	Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.12	26.0	1	1	1
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	208-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q8TCG1|CIP2A_HUMAN	Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	752-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	885-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	134-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q9Y639|NPTN_HUMAN	Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	379-UNIMOD:35,218-UNIMOD:4	0.10	26.0	2	2	1
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P08621-2|RU17_HUMAN	Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:4,134-UNIMOD:35	0.09	25.0	3	3	3
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	2
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	2	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	2	2	2
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	159-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	771-UNIMOD:35	0.03	25.0	2	2	2
PRT	sp|Q9NUW8-2|TYDP1_HUMAN	Isoform 2 of Tyrosyl-DNA phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=TDP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UK61-3|TASOR_HUMAN	Isoform 3 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	277-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9P015|RM15_HUMAN	39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q5JTZ9|SYAM_HUMAN	Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q2M1P5|KIF7_HUMAN	Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	3	2	1
PRT	sp|P30260|CDC27_HUMAN	Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	2	2
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	475-UNIMOD:4	0.00	25.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y3C8|UFC1_HUMAN	Ubiquitin-fold modifier-conjugating enzyme 1 OS=Homo sapiens OX=9606 GN=UFC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	221-UNIMOD:35,223-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	253-UNIMOD:4	0.08	25.0	3	3	3
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q9ULA0-2|DNPEP_HUMAN	Isoform 2 of Aspartyl aminopeptidase OS=Homo sapiens OX=9606 GN=DNPEP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P35241-4|RADI_HUMAN	Isoform 4 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q12849-5|GRSF1_HUMAN	Isoform 2 of G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	620-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P10253|LYAG_HUMAN	Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	3	3	3
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P17039|ZNF30_HUMAN	Zinc finger protein 30 OS=Homo sapiens OX=9606 GN=ZNF30 PE=2 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	402-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P48444-2|COPD_HUMAN	Isoform 2 of Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|A6NEC2-2|PSAL_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	232-UNIMOD:35	0.05	25.0	2	1	0
PRT	sp|Q8N4V1|MMGT1_HUMAN	Membrane magnesium transporter 1 OS=Homo sapiens OX=9606 GN=MMGT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q13586-2|STIM1_HUMAN	Isoform 2 of Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	2
PRT	sp|Q6RFH5-2|WDR74_HUMAN	Isoform 2 of WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q86WJ1-5|CHD1L_HUMAN	Isoform 5 of Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O95232-2|LC7L3_HUMAN	Isoform 2 of Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	35-UNIMOD:4	0.16	25.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	148-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q9Y2X9-2|ZN281_HUMAN	Isoform 2 of Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|Q5HYK7-3|SH319_HUMAN	Isoform 3 of SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	394-UNIMOD:4	0.04	25.0	3	3	3
PRT	sp|Q8TAT6|NPL4_HUMAN	Nuclear protein localization protein 4 homolog OS=Homo sapiens OX=9606 GN=NPLOC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UNY4|TTF2_HUMAN	Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P30519|HMOX2_HUMAN	Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	105-UNIMOD:4	0.08	25.0	2	1	0
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P84243|H33_HUMAN	Histone H3.3 OS=Homo sapiens OX=9606 GN=H3-3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q5T200|ZC3HD_HUMAN	Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	2
PRT	sp|P12081|HARS1_HUMAN	Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O14949|QCR8_HUMAN	Cytochrome b-c1 complex subunit 8 OS=Homo sapiens OX=9606 GN=UQCRQ PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	11-UNIMOD:35	0.34	25.0	2	2	2
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9Y3C1|NOP16_HUMAN	Nucleolar protein 16 OS=Homo sapiens OX=9606 GN=NOP16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	76-UNIMOD:35	0.07	25.0	1	1	1
PRT	sp|Q8IWF2|FXRD2_HUMAN	FAD-dependent oxidoreductase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FOXRED2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q8NHP6|MSPD2_HUMAN	Motile sperm domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MOSPD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	6	4	2
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O43395|PRPF3_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	85-UNIMOD:4,87-UNIMOD:35,88-UNIMOD:4	0.05	25.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	414-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	60-UNIMOD:35,63-UNIMOD:35	0.30	24.0	3	3	3
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P06753-7|TPM3_HUMAN	Isoform 7 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	174-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	56-UNIMOD:4	0.15	24.0	1	1	1
PRT	sp|P61457|PHS_HUMAN	Pterin-4-alpha-carbinolamine dehydratase OS=Homo sapiens OX=9606 GN=PCBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	281-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	35-UNIMOD:35	0.05	24.0	2	2	2
PRT	sp|Q9H6T3-3|RPAP3_HUMAN	Isoform 3 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BRQ6|MIC25_HUMAN	MICOS complex subunit MIC25 OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	218-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	138-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	301-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P25490|TYY1_HUMAN	Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P57060|RWD2B_HUMAN	RWD domain-containing protein 2B OS=Homo sapiens OX=9606 GN=RWDD2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9HBT8-2|Z286A_HUMAN	Isoform 2 of Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	430-UNIMOD:4,433-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	534-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q6PK04|CC137_HUMAN	Coiled-coil domain-containing protein 137 OS=Homo sapiens OX=9606 GN=CCDC137 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	31-UNIMOD:35,159-UNIMOD:35	0.21	24.0	3	2	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q10471|GALT2_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	539-UNIMOD:4	0.06	24.0	2	2	2
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	889-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q96BP3-2|PPWD1_HUMAN	Isoform 2 of Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	2	1	0
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O14733|MP2K7_HUMAN	Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|Q92974-3|ARHG2_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P56270-3|MAZ_HUMAN	Isoform 3 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	1
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	3	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q16775|GLO2_HUMAN	Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	3	3	3
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O00401|WASL_HUMAN	Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.18	24.0	2	2	2
PRT	sp|O14802|RPC1_HUMAN	DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	175-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P17480|UBF1_HUMAN	Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|Q96B97|SH3K1_HUMAN	SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	469-UNIMOD:35,475-UNIMOD:4	0.03	24.0	3	3	3
PRT	sp|Q9P000|COMD9_HUMAN	COMM domain-containing protein 9 OS=Homo sapiens OX=9606 GN=COMMD9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9Y2Q9|RT28_HUMAN	28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	4	2	0
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|P63151|2ABA_HUMAN	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	623-UNIMOD:35	0.02	24.0	2	2	2
PRT	sp|Q9Y3B8|ORN_HUMAN	Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	217-UNIMOD:35	0.05	24.0	2	1	0
PRT	sp|P46199|IF2M_HUMAN	Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q71UM5|RS27L_HUMAN	40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	33-UNIMOD:35	0.19	24.0	2	1	0
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	279-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q5RKV6|EXOS6_HUMAN	Exosome complex component MTR3 OS=Homo sapiens OX=9606 GN=EXOSC6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	338-UNIMOD:4	0.02	23.0	4	3	2
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P11171-6|EPB41_HUMAN	Isoform 6 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9H845|ACAD9_HUMAN	Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	488-UNIMOD:4	0.05	23.0	2	2	2
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	229-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|P51553-2|IDH3G_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P12081-4|HARS1_HUMAN	Isoform 4 of Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	106-UNIMOD:4	0.14	23.0	2	2	2
PRT	sp|Q9Y6D9-3|MD1L1_HUMAN	Isoform 2 of Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	360-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|P02794|FRIH_HUMAN	Ferritin heavy chain OS=Homo sapiens OX=9606 GN=FTH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|O43167-2|ZBT24_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens OX=9606 GN=ZBTB24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q6GMV3|PTRD1_HUMAN	Putative peptidyl-tRNA hydrolase PTRHD1 OS=Homo sapiens OX=9606 GN=PTRHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.11	23.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O75323-2|NIPS2_HUMAN	Isoform 2 of Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q12899|TRI26_HUMAN	Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P62854|RS26_HUMAN	40S ribosomal protein S26 OS=Homo sapiens OX=9606 GN=RPS26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	23-UNIMOD:4,26-UNIMOD:4	0.14	23.0	2	2	2
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O14981-2|BTAF1_HUMAN	Isoform 2 of TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9P0V9|SEP10_HUMAN	Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	16-UNIMOD:35	0.03	23.0	2	1	0
PRT	sp|Q96HN2-2|SAHH3_HUMAN	Isoform 2 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P55265-5|DSRAD_HUMAN	Isoform 5 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	3	2	1
PRT	sp|P21359-3|NF1_HUMAN	Isoform 3 of Neurofibromin OS=Homo sapiens OX=9606 GN=NF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q75N03-2|HAKAI_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8ND82|Z280C_HUMAN	Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	714-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	174-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q99829|CPNE1_HUMAN	Copine-1 OS=Homo sapiens OX=9606 GN=CPNE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O95239-2|KIF4A_HUMAN	Isoform 2 of Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	2	2
PRT	sp|Q9UBC2-3|EP15R_HUMAN	Isoform 3 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P53582|MAP11_HUMAN	Methionine aminopeptidase 1 OS=Homo sapiens OX=9606 GN=METAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	292-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8N3U4-2|STAG2_HUMAN	Isoform 2 of Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	139-UNIMOD:35	0.02	23.0	2	2	2
PRT	sp|P38935|SMBP2_HUMAN	DNA-binding protein SMUBP-2 OS=Homo sapiens OX=9606 GN=IGHMBP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1666-UNIMOD:35	0.01	23.0	2	2	2
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	267-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q8IX01|SUGP2_HUMAN	SURP and G-patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUGP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9NUW8|TYDP1_HUMAN	Tyrosyl-DNA phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=TDP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q7Z3C6|ATG9A_HUMAN	Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9UKY1|ZHX1_HUMAN	Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	164-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q9H892|TTC12_HUMAN	Tetratricopeptide repeat protein 12 OS=Homo sapiens OX=9606 GN=TTC12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	699-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9H2J4|PDCL3_HUMAN	Phosducin-like protein 3 OS=Homo sapiens OX=9606 GN=PDCL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	39-UNIMOD:4	0.14	23.0	2	2	2
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P35251|RFC1_HUMAN	Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	4	2	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	2	2	2
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	3	3	3
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	297-UNIMOD:35	0.03	23.0	2	1	0
PRT	sp|Q9NUD5|ZCHC3_HUMAN	Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	372-UNIMOD:4,375-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	64-UNIMOD:4	0.04	23.0	2	1	0
PRT	sp|P0DMP2|SRG2B_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=3 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	61-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q96AJ9|VTI1A_HUMAN	Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens OX=9606 GN=VTI1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	300-UNIMOD:35	0.02	23.0	2	2	2
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	97-UNIMOD:35	0.13	23.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q9UPN9|TRI33_HUMAN	E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q2TBE0|C19L2_HUMAN	CWF19-like protein 2 OS=Homo sapiens OX=9606 GN=CWF19L2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9NW13|RBM28_HUMAN	RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q14318|FKBP8_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	2	2	2
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	15-UNIMOD:35	0.15	22.0	1	1	1
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	3	2	1
PRT	sp|O43172-2|PRP4_HUMAN	Isoform 2 of U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O60524-4|NEMF_HUMAN	Isoform 4 of Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UGY1|NOL12_HUMAN	Nucleolar protein 12 OS=Homo sapiens OX=9606 GN=NOL12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P46087-3|NOP2_HUMAN	Isoform 3 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	572-UNIMOD:35	0.04	22.0	2	2	2
PRT	sp|P61254|RL26_HUMAN	60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P28370-2|SMCA1_HUMAN	Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	945-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9GZN8|CT027_HUMAN	UPF0687 protein C20orf27 OS=Homo sapiens OX=9606 GN=C20orf27 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	149-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|Q9BXK1|KLF16_HUMAN	Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q96CB9-3|NSUN4_HUMAN	Isoform 3 of 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9Y4Y9|LSM5_HUMAN	U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	30-UNIMOD:35	0.11	22.0	2	1	0
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=MACROH2A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P46736-4|BRCC3_HUMAN	Isoform 4 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q96S94-5|CCNL2_HUMAN	Isoform 5 of Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9UJU6-6|DBNL_HUMAN	Isoform 6 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	137-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q69YN4-3|VIR_HUMAN	Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	168-UNIMOD:35,169-UNIMOD:35,172-UNIMOD:35	0.16	22.0	5	4	3
PRT	sp|Q96SN8-3|CK5P2_HUMAN	Isoform 3 of CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	3	3	3
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	250-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|O43663-3|PRC1_HUMAN	Isoform 3 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q01664|TFAP4_HUMAN	Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96RT8-2|GCP5_HUMAN	Isoform 2 of Gamma-tubulin complex component 5 OS=Homo sapiens OX=9606 GN=TUBGCP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	21-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O15111|IKKA_HUMAN	Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O43709-2|BUD23_HUMAN	Isoform 2 of Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|O14647|CHD2_HUMAN	Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	2	1	0
PRT	sp|Q01484|ANK2_HUMAN	Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P61020-2|RAB5B_HUMAN	Isoform 2 of Ras-related protein Rab-5B OS=Homo sapiens OX=9606 GN=RAB5B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|Q5VV42|CDKAL_HUMAN	Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P56945-4|BCAR1_HUMAN	Isoform 4 of Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75083-3|WDR1_HUMAN	Isoform 2 of WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	263-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q06124-3|PTN11_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q5TFE4-2|NT5D1_HUMAN	Isoform 2 of 5'-nucleotidase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NT5DC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	147-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9Y2I1-4|NISCH_HUMAN	Isoform 4 of Nischarin OS=Homo sapiens OX=9606 GN=NISCH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q13823|NOG2_HUMAN	Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q6L8Q7|PDE12_HUMAN	2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O43670|ZN207_HUMAN	BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	54-UNIMOD:4,55-UNIMOD:35	0.04	22.0	1	1	0
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	292-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q9UNL2|SSRG_HUMAN	Translocon-associated protein subunit gamma OS=Homo sapiens OX=9606 GN=SSR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P52926|HMGA2_HUMAN	High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	2	1	0
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	1	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9UNF0|PACN2_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q99700|ATX2_HUMAN	Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P61513|RL37A_HUMAN	60S ribosomal protein L37a OS=Homo sapiens OX=9606 GN=RPL37A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9NWB6|ARGL1_HUMAN	Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O15392|BIRC5_HUMAN	Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.15	22.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8TEV9|SMCR8_HUMAN	Guanine nucleotide exchange protein SMCR8 OS=Homo sapiens OX=9606 GN=SMCR8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P36543|VATE1_HUMAN	V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	359-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	2	2	2
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9H081|MIS12_HUMAN	Protein MIS12 homolog OS=Homo sapiens OX=9606 GN=MIS12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q99523|SORT_HUMAN	Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	740-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9BYN8|RT26_HUMAN	28S ribosomal protein S26, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS26 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	2	1	0
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q15650|TRIP4_HUMAN	Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q12972|PP1R8_HUMAN	Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PPP1R8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q15382|RHEB_HUMAN	GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	170-UNIMOD:35	0.10	22.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	107-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	3	3	3
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	2	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q13510-3|ASAH1_HUMAN	Isoform 3 of Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P36551|HEM6_HUMAN	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Homo sapiens OX=9606 GN=CPOX PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	373-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q8NBU5-2|ATAD1_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ATAD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	308-UNIMOD:4,309-UNIMOD:35	0.06	21.0	1	1	1
PRT	sp|Q9NQE9|HINT3_HUMAN	Histidine triad nucleotide-binding protein 3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|P62993|GRB2_HUMAN	Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9H832-2|UBE2Z_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	207-UNIMOD:35,135-UNIMOD:4	0.11	21.0	2	2	2
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9HC21-2|TPC_HUMAN	Isoform 2 of Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens OX=9606 GN=SLC25A19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P15924-3|DESP_HUMAN	Isoform DSPIa of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1203-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96DE0-3|NUD16_HUMAN	Isoform 3 of U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606 GN=NUDT16	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	2	2	2
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	61-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q04760-2|LGUL_HUMAN	Isoform 2 of Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	124-UNIMOD:4	0.11	21.0	1	1	1
PRT	sp|O94813-3|SLIT2_HUMAN	Isoform 3 of Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P08574|CY1_HUMAN	Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.00	21.0	1	1	1
PRT	sp|O75446|SAP30_HUMAN	Histone deacetylase complex subunit SAP30 OS=Homo sapiens OX=9606 GN=SAP30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	112-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q9Y6A9|SPCS1_HUMAN	Signal peptidase complex subunit 1 OS=Homo sapiens OX=9606 GN=SPCS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|Q9NQ55-2|SSF1_HUMAN	Isoform 2 of Suppressor of SWI4 1 homolog OS=Homo sapiens OX=9606 GN=PPAN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q7Z4H8-3|PLGT3_HUMAN	Isoform 3 of Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q71UI9-2|H2AV_HUMAN	Isoform 2 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|O75439|MPPB_HUMAN	Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q53H47-3|SETMR_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=POLR1F PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.12	21.0	2	2	2
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UL03-3|INT6_HUMAN	Isoform 3 of Integrator complex subunit 6 OS=Homo sapiens OX=9606 GN=INTS6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	739-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|O95396|MOCS3_HUMAN	Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	563-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q7Z3B4-2|NUP54_HUMAN	Isoform 2 of Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	224-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|Q9BZL6|KPCD2_HUMAN	Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P06213-2|INSR_HUMAN	Isoform Short of Insulin receptor OS=Homo sapiens OX=9606 GN=INSR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	301-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q16822-3|PCKGM_HUMAN	Isoform 3 of Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9H7Z6|KAT8_HUMAN	Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q12923-3|PTN13_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9P0W2|HM20B_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O43776-2|SYNC_HUMAN	Isoform 2 of Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=NARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	186-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P56270|MAZ_HUMAN	Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q96HN2|SAHH3_HUMAN	Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	0
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	2	1	0
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P43308|SSRB_HUMAN	Translocon-associated protein subunit beta OS=Homo sapiens OX=9606 GN=SSR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|B2RPK0|HGB1A_HUMAN	Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P61011|SRP54_HUMAN	Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q5GLZ8|HERC4_HUMAN	Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	163-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	1	1	1
PRT	sp|Q12789|TF3C1_HUMAN	General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1363-UNIMOD:4	0.01	21.0	2	2	2
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:35	0.10	21.0	4	2	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	368-UNIMOD:35	0.06	21.0	2	2	2
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q14527|HLTF_HUMAN	Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.13	21.0	2	2	2
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	170-UNIMOD:35	0.06	21.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9ULI0|ATD2B_HUMAN	ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	110-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P0C7P4|UCRIL_HUMAN	Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens OX=9606 GN=UQCRFS1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	160-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8IZP0|ABI1_HUMAN	Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9BTT0|AN32E_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	2	2	2
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|O60306|AQR_HUMAN	RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P09496|CLCA_HUMAN	Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q16181|SEPT7_HUMAN	Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O14578|CTRO_HUMAN	Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P11172-4|UMPS_HUMAN	Isoform 4 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	126-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q9P032|NDUF4_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 OS=Homo sapiens OX=9606 GN=NDUFAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P62495-2|ERF1_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.25	20.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	519-UNIMOD:4	0.01	20.0	2	2	2
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	734-UNIMOD:4	0.02	20.0	2	2	2
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q5JVF3-3|PCID2_HUMAN	Isoform 3 of PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	235-UNIMOD:35,239-UNIMOD:35	0.03	20.0	3	2	1
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q15475|SIX1_HUMAN	Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q92800-5|EZH1_HUMAN	Isoform 5 of Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens OX=9606 GN=EZH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	557-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q15008-3|PSMD6_HUMAN	Isoform 3 of 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q8TED0-2|UTP15_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q15404-2|RSU1_HUMAN	Isoform 2 of Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	42-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	123-UNIMOD:4,126-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q6P1K2-3|PMF1_HUMAN	Isoform 3 of Polyamine-modulated factor 1 OS=Homo sapiens OX=9606 GN=PMF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|Q5SY16|NOL9_HUMAN	Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens OX=9606 GN=NOL9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NV66-2|TYW1_HUMAN	Isoform 2 of S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 OS=Homo sapiens OX=9606 GN=TYW1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O60279|SUSD5_HUMAN	Sushi domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SUSD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9P021|CRIPT_HUMAN	Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	73-UNIMOD:4,76-UNIMOD:4	0.19	20.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	2	1	0
PRT	sp|O75369-4|FLNB_HUMAN	Isoform 4 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	2	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9H6R4-3|NOL6_HUMAN	Isoform 3 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9P246-3|STIM2_HUMAN	Isoform 3 of Stromal interaction molecule 2 OS=Homo sapiens OX=9606 GN=STIM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9UGR2|Z3H7B_HUMAN	Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	909-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:4	0.09	20.0	1	1	1
PRT	sp|Q16352|AINX_HUMAN	Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|Q15334|L2GL1_HUMAN	Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q04637-3|IF4G1_HUMAN	Isoform B of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	984-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	407-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|Q9BRK4|LZTS2_HUMAN	Leucine zipper putative tumor suppressor 2 OS=Homo sapiens OX=9606 GN=LZTS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6ZN18-3|AEBP2_HUMAN	Isoform 3 of Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	75-UNIMOD:4,76-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|O75970-5|MPDZ_HUMAN	Isoform 4 of Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	234-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|P63279|UBC9_HUMAN	SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	88-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	710-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P51398-2|RT29_HUMAN	Isoform 2 of 28S ribosomal protein S29, mitochondrial OS=Homo sapiens OX=9606 GN=DAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9P0L1|ZKSC7_HUMAN	Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q96N58|ZN578_HUMAN	Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O75971-2|SNPC5_HUMAN	Isoform 2 of snRNA-activating protein complex subunit 5 OS=Homo sapiens OX=9606 GN=SNAPC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.18	20.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	40-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	342-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q5TCQ9-3|MAGI3_HUMAN	Isoform 3 of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	177-UNIMOD:35	0.05	20.0	2	2	2
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	492-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6UB28|MAP12_HUMAN	Methionine aminopeptidase 1D, mitochondrial OS=Homo sapiens OX=9606 GN=METAP1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q8N6R0-1|EFNMT_HUMAN	Isoform 4 of eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=EEF1AKNMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q8TEW0-5|PARD3_HUMAN	Isoform 5 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.12	20.0	2	2	2
PRT	sp|Q9Y4C2-2|TCAF1_HUMAN	Isoform 2 of TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	65-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|Q86WZ6-2|ZN227_HUMAN	Isoform 2 of Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P53778|MK12_HUMAN	Mitogen-activated protein kinase 12 OS=Homo sapiens OX=9606 GN=MAPK12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q58FG0|HS905_HUMAN	Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	257-UNIMOD:4	0.08	20.0	2	2	2
PRT	sp|Q8TD26|CHD6_HUMAN	Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	744-UNIMOD:4,745-UNIMOD:4	0.01	20.0	2	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q00325|MPCP_HUMAN	Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q8NCA5|FA98A_HUMAN	Protein FAM98A OS=Homo sapiens OX=9606 GN=FAM98A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9BQ75|CMS1_HUMAN	Protein CMSS1 OS=Homo sapiens OX=9606 GN=CMSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P10644|KAP0_HUMAN	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9HC07|TM165_HUMAN	Transmembrane protein 165 OS=Homo sapiens OX=9606 GN=TMEM165 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P52209|6PGD_HUMAN	6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P04818|TYSY_HUMAN	Thymidylate synthase OS=Homo sapiens OX=9606 GN=TYMS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9NW15|ANO10_HUMAN	Anoctamin-10 OS=Homo sapiens OX=9606 GN=ANO10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P62136|PP1A_HUMAN	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q14444|CAPR1_HUMAN	Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9Y6M4|KC1G3_HUMAN	Casein kinase I isoform gamma-3 OS=Homo sapiens OX=9606 GN=CSNK1G3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	2	1	0
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q53H12|AGK_HUMAN	Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	408-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q96EK5|KBP_HUMAN	KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	533-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|Q5VW32|BROX_HUMAN	BRO1 domain-containing protein BROX OS=Homo sapiens OX=9606 GN=BROX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q7L576|CYFP1_HUMAN	Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H857|NT5D2_HUMAN	5'-nucleotidase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NT5DC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	206-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	271-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O43752|STX6_HUMAN	Syntaxin-6 OS=Homo sapiens OX=9606 GN=STX6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|Q16594|TAF9_HUMAN	Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NZN3|EHD3_HUMAN	EH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EHD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9HAF1|EAF6_HUMAN	Chromatin modification-related protein MEAF6 OS=Homo sapiens OX=9606 GN=MEAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P26358-2|DNMT1_HUMAN	Isoform 2 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6P2P2|ANM9_HUMAN	Protein arginine N-methyltransferase 9 OS=Homo sapiens OX=9606 GN=PRMT9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	92-UNIMOD:4	0.10	20.0	3	2	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q01081|U2AF1_HUMAN	Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q14191|WRN_HUMAN	Werner syndrome ATP-dependent helicase OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1374-UNIMOD:4,1382-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9UJX6|ANC2_HUMAN	Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P78332|RBM6_HUMAN	RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|O95819|M4K4_HUMAN	Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P62308|RUXG_HUMAN	Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.17	19.0	1	1	1
PRT	sp|Q9P2W9|STX18_HUMAN	Syntaxin-18 OS=Homo sapiens OX=9606 GN=STX18 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	65-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q13557-8|KCC2D_HUMAN	Isoform Delta 6 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|O43251-3|RFOX2_HUMAN	Isoform 3 of RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UHQ1-4|NARF_HUMAN	Isoform 4 of Nuclear prelamin A recognition factor OS=Homo sapiens OX=9606 GN=NARF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P78316|NOP14_HUMAN	Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q99640-2|PMYT1_HUMAN	Isoform 2 of Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BWE0|REPI1_HUMAN	Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q86UA1|PRP39_HUMAN	Pre-mRNA-processing factor 39 OS=Homo sapiens OX=9606 GN=PRPF39 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P17568|NDUB7_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFB7 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	90-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P29353-2|SHC1_HUMAN	Isoform p52Shc of SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	369-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P50213-2|IDH3A_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	240-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P61024|CKS1_HUMAN	Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CKS1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	23-UNIMOD:35	0.14	19.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	884-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q9BPX7|CG025_HUMAN	UPF0415 protein C7orf25 OS=Homo sapiens OX=9606 GN=C7orf25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9NVQ4|FAIM1_HUMAN	Fas apoptotic inhibitory molecule 1 OS=Homo sapiens OX=9606 GN=FAIM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9UHQ4|BAP29_HUMAN	B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9Y5U8|MPC1_HUMAN	Mitochondrial pyruvate carrier 1 OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	103-UNIMOD:35	0.08	19.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9Y2K7-2|KDM2A_HUMAN	Isoform 2 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	248-UNIMOD:4,251-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|O15460-2|P4HA2_HUMAN	Isoform IIa of Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	54-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P53805-4|RCAN1_HUMAN	Isoform 4 of Calcipressin-1 OS=Homo sapiens OX=9606 GN=RCAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q969Q5|RAB24_HUMAN	Ras-related protein Rab-24 OS=Homo sapiens OX=9606 GN=RAB24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q92997-2|DVL3_HUMAN	Isoform 2 of Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P47974|TISD_HUMAN	mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q8TCF1-4|ZFAN1_HUMAN	Isoform 4 of AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	44-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P52747-2|ZN143_HUMAN	Isoform 2 of Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7L5Y9-4|MAEA_HUMAN	Isoform 4 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O75027-3|ABCB7_HUMAN	Isoform 3 of ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96CM3-2|RUSD4_HUMAN	Isoform 2 of Mitochondrial RNA pseudouridine synthase RPUSD4 OS=Homo sapiens OX=9606 GN=RPUSD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q5T3I0-2|GPTC4_HUMAN	Isoform 2 of G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P01889|HLAB_HUMAN	HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	283-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	1	1	1
PRT	sp|O15020|SPTN2_HUMAN	Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O15091|MRPP3_HUMAN	Mitochondrial ribonuclease P catalytic subunit OS=Homo sapiens OX=9606 GN=PRORP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P68431|H31_HUMAN	Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O43663|PRC1_HUMAN	Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	2	2
PRT	sp|P23258|TBG1_HUMAN	Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O60287|NPA1P_HUMAN	Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|Q9BVC6|TM109_HUMAN	Transmembrane protein 109 OS=Homo sapiens OX=9606 GN=TMEM109 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9NV88|INT9_HUMAN	Integrator complex subunit 9 OS=Homo sapiens OX=9606 GN=INTS9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q6PJT7|ZC3HE_HUMAN	Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	77-UNIMOD:35	0.09	19.0	1	1	1
PRT	sp|P51153|RAB13_HUMAN	Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	99-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q9BVG9|PTSS2_HUMAN	Phosphatidylserine synthase 2 OS=Homo sapiens OX=9606 GN=PTDSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UIF9|BAZ2A_HUMAN	Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O43896|KIF1C_HUMAN	Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UHR5|S30BP_HUMAN	SAP30-binding protein OS=Homo sapiens OX=9606 GN=SAP30BP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	149-UNIMOD:35	0.05	19.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BUV8|RCAF1_HUMAN	Respirasome Complex Assembly Factor 1 OS=Homo sapiens OX=9606 GN=RAB5IF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	1	1	1
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P23368|MAOM_HUMAN	NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	239-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q9UHX1|PUF60_HUMAN	Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPH	1	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63		ms_run[2]:scan=4421	16.163	4	3249.3804	3249.3804	K	K	60	97
PSM	KKAACEFSETDVTNTEHHQPSNNDLNTTEK	2	sp|P38398|BRCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	61	5-UNIMOD:4	ms_run[1]:scan=6673	19.854539422933332	4	3444.554555	3444.548805	A	R	222	252
PSM	RLKTDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPH	3	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=4430	16.185	4	3249.3804	3249.3804	K	K	60	97
PSM	RRPTPNDDTLDEGVGLVHSNIATEHIPSPAK	4	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	58		ms_run[1]:scan=9202	24.253335309866667	5	3335.688952	3335.685831	A	K	468	499
PSM	RGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTEN	5	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=9223	24.305	5	4573.0138	4573.0138	K	K	210	252
PSM	RNSSYVHGGVDASGKPQEAVYGQNDIHH	6	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=6522	19.566	4	3021.4078	3021.4078	G	K	36	64
PSM	RPTHSGGGGGGGGGGGGGGGGR	7	sp|Q13595-4|TRA2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57		ms_run[2]:scan=3248	14.232	3	1664.7476	1664.7476	G	R	110	132
PSM	RKAAQQQEEQEEKEEEDDEQTLH	8	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	56		ms_run[1]:scan=5374	17.653664344	4	2826.258360	2826.254003	F	R	294	317
PSM	RKNTETALDNKPCGPQCYQHLEGA	9	sp|Q15910|EZH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54	13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=7180	20.683356964266668	4	2786.288731	2786.286447	K	K	308	332
PSM	RKNTETALDNKPCGPQCYQHLEGA	10	sp|Q15910|EZH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	53	13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=7219	20.7497961584	4	2786.288731	2786.286447	K	K	308	332
PSM	KSAVADKHELLSLASSNHLG	11	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=8774	23.274	3	2076.0964	2076.0964	K	K	221	241
PSM	RTSSAQVEGGVHSLHSYEK	12	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=6189	18.975	3	2071.0083	2071.0083	K	R	493	512
PSM	KKHQVSVEGTNQTDVKAVGGPA	13	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=5519	17.875131599733333	3	2249.178683	2249.176408	I	K	539	561
PSM	KGADINAPDKHHITPLLSAVYEGHVSCV	14	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	27-UNIMOD:4	ms_run[2]:scan=9442	25.037	4	3027.5236	3027.5236	L	K	57	85
PSM	RDAGLHCLELGHTGEAGPHAMV	15	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	7-UNIMOD:4,21-UNIMOD:35	ms_run[2]:scan=8085	22.111	4	2343.0848	2343.0848	Y	R	969	991
PSM	RKSSGGKGGSCSQAACSNSAQGSDESLITCKA	16	sp|P10321|HLAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50	11-UNIMOD:4,16-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=5979	18.60258518826667	4	3245.447472	3245.445937	R	-	335	367
PSM	RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLE	17	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7389	21.012	4	3544.6428	3544.6428	P	K	305	341
PSM	KKYEDICPSTHNMDVPNIK	18	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=6903	20.259609808	3	2304.088319	2304.087853	G	R	67	86
PSM	KHDVSAHHDLNIDQSQCNEMYINSSQ	19	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	17-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=7243	20.783	4	3085.3254	3085.3254	S	R	58	84
PSM	KIKADIIYPGHGPVIHNAEA	20	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=8044	22.048	3	2142.1586	2142.1586	L	K	189	209
PSM	KLITQTFSHHNQLAQKT	21	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6706	19.919	3	1994.0698	1994.0698	E	R	53	70
PSM	KYIGTGHADTTKWEWLVNQH	22	sp|Q9BWJ5|SF3B5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=9329	24.649	4	2383.1709	2383.1709	S	R	17	37
PSM	REEILANGGSLSHHHGVG	23	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=6403	19.351	3	1868.9242	1868.9242	A	K	603	621
PSM	RSHSHTQEQTGETASEEQRPGGPSANVT	24	sp|Q9BWH6-2|RPAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4606	16.465	4	2977.351	2977.3510	L	K	263	291
PSM	KKKDQVTAQEIFQDNHEDGPTA	25	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	47		ms_run[1]:scan=7639	21.4128352536	3	2498.206707	2498.203745	A	K	543	565
PSM	KDDKHGSYEDAVHSGALND	26	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6215	19.014	3	2056.9086	2056.9086	S	-	538	557
PSM	KGFNKNDAPLHEINGDHL	27	sp|O75487|GPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7980	21.954	3	2017.997	2017.9970	S	K	40	58
PSM	KHHITPLLSAVYEGHVSCV	28	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	18-UNIMOD:4	ms_run[2]:scan=9211	24.276	3	2146.0993	2146.0993	D	K	66	85
PSM	KPHLEHLVADSHESTQ	29	sp|Q14997-2|PSME4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=5872	18.428	2	1826.8911	1826.8911	L	R	736	752
PSM	RGVAMNPVEHPFGGGNHQHIG	30	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7530	21.237	3	2210.0552	2210.0552	V	K	200	221
PSM	RPFKVETSDEEIHDLHQ	31	sp|P07099|HYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7667	21.459	4	2079.0021	2079.0021	I	R	49	66
PSM	RRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGY	32	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=8277	22.445	4	3912.9408	3912.9408	Y	K	153	187
PSM	KKQLLCGAAIGTHEDDKY	33	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	6-UNIMOD:4	ms_run[1]:scan=7177	20.68079850213333	4	2046.021119	2046.020425	A	R	241	259
PSM	RKDVHEITSDTAPKPDAVL	34	sp|Q4LE39|ARI4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46		ms_run[1]:scan=7593	21.341008921333334	3	2091.097342	2091.096033	P	K	227	246
PSM	KKKDSETSFVPTNMAVNYVQHN	35	sp|Q9NZ63|TLS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	14-UNIMOD:35	ms_run[1]:scan=7943	21.9007091304	3	2552.234998	2552.232937	N	R	204	226
PSM	RRSYDVPPPPMEPDHPFYSNISKD	36	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45	11-UNIMOD:35	ms_run[1]:scan=8431	22.716605955466665	4	2859.331502	2859.328629	W	R	116	140
PSM	KHPELADKNVPNLHVM	37	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=8202	22.32	3	1840.9618	1840.9618	P	K	31	47
PSM	REQHQHSDLDSNQTHSSGTVTSSSSTANIDDL	38	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7492	21.174	4	3453.5265	3453.5265	S	K	1929	1961
PSM	RLHLGSTPHNLTDANIHELA	39	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=8725	23.192	4	2208.14	2208.1400	F	R	304	324
PSM	RKAGPAKEQEPMPTVDSHEP	40	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5782	18.275474829333334	3	2203.071331	2203.069166	A	R	146	166
PSM	RKPTDGASSSNCVTDISHLVR	41	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	12-UNIMOD:4	ms_run[1]:scan=8294	22.4785013768	4	2299.133485	2299.133892	S	K	697	718
PSM	KVFDEHKEEDLFELSH	42	sp|Q9NSV4-7|DIAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=9076	23.91	3	2000.948	2000.9480	L	R	390	406
PSM	REGGGEGGPHLAVLHSVLH	43	sp|Q6P9B9|INT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=8641	23.055	4	1920.9918	1920.9918	S	R	975	994
PSM	RPLHPVANPHAEISTKVPAS	44	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=6667	19.839	4	2120.1491	2120.1491	Q	K	153	173
PSM	RQSHYGTPYPPGPSGHGQQSYH	45	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=5734	18.211	4	2437.0948	2437.0948	G	R	527	549
PSM	KKSTPKEETVNDPEEAGH	46	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=3827	14.992761102666666	3	1994.955782	1994.954513	R	R	535	553
PSM	KKQDIENILHWNVTQH	47	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9441	25.032	3	2002.0385	2002.0385	V	K	56	72
PSM	RDLHESSFSLSGSQIDDHVPK	48	sp|Q9BPU6|DPYL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8527	22.865	4	2353.1299	2353.1299	M	R	526	547
PSM	RGEHVHSLPEASVSSKPDEG	49	sp|Q01804-5|OTUD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5662	18.098	3	2117.0138	2117.0138	A	R	850	870
PSM	RPGLSSLPPRGPHHLDNSSPGPGSEA	50	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6992	20.388	3	2618.295	2618.2950	G	R	373	399
PSM	RSVTVVEDDEDEDGDDLLHHHHVSGS	51	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7696	21.498	4	2898.2652	2898.2652	V	R	545	571
PSM	KKVPDKLLDSSTVTHLF	52	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=9433	25.00729310053333	3	1927.078752	1927.077863	Q	K	54	71
PSM	KDVSHEIIQHEVKSS	53	sp|Q7Z6E9-4|RBBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6097	18.835	3	1734.8901	1734.8901	T	K	538	553
PSM	KEHMDAINHDTKELE	54	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:35	ms_run[2]:scan=4814	16.804	3	1824.8312	1824.8312	E	K	909	924
PSM	KLRFPAEDEFPDLSAHNNHMA	55	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9351	24.733	4	2438.1437	2438.1437	L	K	11	32
PSM	KTVQGSGHQEHINIH	56	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4365	16.067	3	1683.8441	1683.8441	A	K	42	57
PSM	RAGSEKDDDSFNLHNSNSTHQE	57	sp|Q86WP2-4|GPBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5322	17.569	4	2487.0647	2487.0647	S	R	148	170
PSM	RDSLVHSSPHVALSHVDA	58	sp|Q9P2B2|FPRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7341	20.94	4	1925.9708	1925.9708	D	R	336	354
PSM	RQKHSQAVEELAEQLEQT	59	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9331	24.654	3	2123.0607	2123.0607	M	K	1191	1209
PSM	RQPLTVEHMYEDISQDHVK	60	sp|Q9NT62-2|ATG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9221	24.302	4	2324.1219	2324.1219	Q	K	224	243
PSM	RSKNVGMPIAMLLHTDGAHE	61	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=9505	25.281236801866665	4	2176.095367	2176.088127	G	R	201	221
PSM	KKFYPLEIDYGQDEEAVK	62	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=9268	24.438482134399997	3	2171.084647	2171.078651	P	K	636	654
PSM	KKKAAAQLLQSQAQQSGAQQT	63	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=5938	18.522166988533336	3	2212.193523	2212.192393	Q	K	397	418
PSM	KKKDQVTAQEIFQDNHEDGPTA	64	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=7630	21.39850002213333	3	2498.206707	2498.203745	A	K	543	565
PSM	KRQESQQNSDQNSNLNPHVIRNPDVE	65	sp|O14646|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=6814	20.100687746933332	4	3045.464182	3045.461251	K	R	1503	1529
PSM	KALLNNSHYYHMAHG	66	sp|P09622-3|DLDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	12-UNIMOD:35	ms_run[2]:scan=5513	17.865	3	1770.826	1770.8260	S	K	89	104
PSM	KASAPYNHHGSRDSGPPPSTVSEAEFEDIM	67	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	30-UNIMOD:35	ms_run[2]:scan=8208	22.333	4	3228.4418	3228.4418	M	K	303	333
PSM	KGATYGKPVHHGVNQL	68	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4994	17.069	2	1704.906	1704.9060	P	K	77	93
PSM	KHIYYITGETKDQVANSAFVE	69	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8739	23.213	3	2412.1961	2412.1961	Q	R	489	510
PSM	KKTTHFVEGGDAGN	70	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=4055	15.322	2	1459.7056	1459.7056	K	R	222	236
PSM	KLKLEQIDGHIAEHNS	71	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7516	21.213	3	1830.9588	1830.9588	I	K	1015	1031
PSM	KLQDKQEHCSQLESHL	72	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	9-UNIMOD:4	ms_run[2]:scan=6316	19.189	3	1978.9531	1978.9531	A	K	696	712
PSM	RAQHVFQHAVPQEGKPITNQ	73	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6417	19.369	4	2284.1825	2284.1825	Q	K	48	68
PSM	RQSVTNSIKAGLTDQVSHHA	74	sp|Q8NHH9-3|ATLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8026	22.016	3	2148.1036	2148.1036	I	R	388	408
PSM	RSKNVGMPIAMLLHTDGAHE	75	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=8478	22.793	4	2208.078	2208.0780	G	R	201	221
PSM	KLHLQAPQHYPDANH	76	sp|P34949|MPI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=6640	19.789518968533333	3	1769.882619	1767.880501	E	K	120	135
PSM	RKREEAAAVPAAAPDDLALL	77	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=9492	25.222756018666665	3	2076.135135	2076.132753	P	K	87	107
PSM	KKKDQVTAQEIFQDNHEDGPTA	78	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7875	21.773107989066666	4	2498.201703	2498.203745	A	K	543	565
PSM	RKHVTTAEGTPGTTDQEGPPPDGPPEK	79	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=5000	17.0801850112	4	2798.349319	2798.347115	P	R	1879	1906
PSM	KAIWHAFTALDQDHSGKVS	80	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8891	23.482	4	2110.0596	2110.0596	L	K	10	29
PSM	KEHQAHVENLEADIK	81	sp|Q13439-3|GOGA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6555	19.629	3	1759.8853	1759.8853	L	R	773	788
PSM	KGIPALIENDHHMNSIR	82	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	13-UNIMOD:35	ms_run[2]:scan=7507	21.197	3	1959.9949	1959.9949	E	K	252	269
PSM	KIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSA	83	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6770	20.03	5	3517.6723	3517.6723	S	R	252	289
PSM	KNKSILISSVASVHHANGLA	84	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8131	22.196	4	2045.1382	2045.1382	L	K	140	160
PSM	KPKNAIHTFVQSGSHLAA	85	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7591	21.339	3	1905.0221	1905.0221	E	R	504	522
PSM	KVDEAVAVLQAHHAK	86	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7023	20.438	3	1614.8842	1614.8842	S	K	602	617
PSM	RLHHPAQGSAAGTPYPSSASL	87	sp|Q9NSV4-7|DIAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7266	20.823	3	2104.045	2104.0450	P	R	7	28
PSM	RQLFHPEQLITGKEDAANNYA	88	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=9270	24.448	3	2414.1979	2414.1979	Y	R	49	70
PSM	RQLTANTGHTIHVHYPGN	89	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6933	20.299	4	2015.0086	2015.0086	L	R	2551	2569
PSM	KKAEVEGKDLPEHAVL	90	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7095	20.557939283466666	4	1761.962851	1761.962499	Q	K	619	635
PSM	KKLGELTGTVKESLHEVS	91	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=8385	22.640239690933335	3	1954.076543	1954.073506	R	K	120	138
PSM	KKISSIQSIVPALEIANAHR	92	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=9515	25.318434704533335	4	2174.254842	2174.253536	E	K	249	269
PSM	RKLTALDYHNPAGFNCKDETEF	93	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	16-UNIMOD:4	ms_run[1]:scan=8863	23.431263666933333	4	2625.230191	2625.228186	R	R	4	26
PSM	RKLTDTSKDEENHEESESLQEDMLGN	94	sp|Q8IX12|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=8137	22.202788415466667	4	3033.348373	3033.346917	Y	R	977	1003
PSM	KDHAATTAGAASLAGGHH	95	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4472	16.244	3	1671.8077	1671.8077	S	R	218	236
PSM	KHAPINSAQHLDNVDQTGPKAW	96	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7672	21.465	4	2426.2091	2426.2091	Q	K	138	160
PSM	KKTHQPSDEVGTSIEHP	97	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5574	17.958	3	1888.9279	1888.9279	P	R	750	767
PSM	KMKVVEVLAGHGHLYS	98	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:35	ms_run[2]:scan=7633	21.402	3	1782.9451	1782.9451	L	R	1239	1255
PSM	KREVPIPEHIDIYHLT	99	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9321	24.616	4	1959.0578	1959.0578	G	R	133	149
PSM	KRGFGFVTFDDHDPVD	100	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9493	25.228	3	1850.8588	1850.8588	K	K	140	156
PSM	KRPPSDIHDSDGSSSSSHQSL	101	sp|O43665|RGS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=4445	16.207	4	2223.0152	2223.0152	R	K	12	33
PSM	RHPDSHQLFIGNLPHEVD	102	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8920	23.547	4	2110.0344	2110.0344	V	K	335	353
PSM	RHQAQIDHYLGLAN	103	sp|Q9NQC3-3|RTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8570	22.932	2	1634.8277	1634.8277	E	K	164	178
PSM	RSLENYHFVDEHGKDQGINI	104	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=8755	23.242	4	2370.1353	2370.1353	L	R	91	111
PSM	RVTQVDGHSSKNDIHTLL	105	sp|O43324-2|MCA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7547	21.268	4	2019.0498	2019.0498	Y	K	78	96
PSM	RVAPEEHPVLLTEAPLNPKAN	106	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8824	23.362810063999998	3	2295.246812	2294.238280	L	R	95	116
PSM	KKKVEEVLEEEEEEYVVE	107	sp|P83916|CBX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=9437	25.018007348	3	2236.102841	2236.099840	N	K	7	25
PSM	RRSYDVPPPPMEPDHPFYSNISKD	108	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8845	23.4004912224	4	2843.337896	2843.333714	W	R	116	140
PSM	RKLTDTSKDEENHEESESLQEDMLGN	109	sp|Q8IX12|CCAR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	23-UNIMOD:35	ms_run[1]:scan=6724	19.949265838933332	4	3049.342737	3049.341832	Y	R	977	1003
PSM	KDVGAQILLHSHK	110	sp|Q96KP4-2|CNDP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6896	20.249	3	1444.815	1444.8150	A	K	205	218
PSM	KELEHLSHIKESVED	111	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6690	19.888	3	1791.9003	1791.9003	G	K	144	159
PSM	KGIHHGPSVAQPIHLDSTQLS	112	sp|Q8NBT2-2|SPC24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7856	21.746	4	2221.1604	2221.1604	V	R	115	136
PSM	KHPELADKNVPNLHVM	113	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	16-UNIMOD:35	ms_run[2]:scan=7347	20.95	4	1856.9567	1856.9567	P	K	31	47
PSM	KKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHG	114	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4671	16.573	5	3492.7664	3492.7664	A	K	34	66
PSM	KLFVGGIKEDTEEHHL	115	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8067	22.083	4	1850.9527	1850.9527	K	R	101	117
PSM	KQKTHVHIGEGPSTISNSTIPENATSSG	116	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7200	20.722	4	2876.4264	2876.4264	A	R	525	553
PSM	KQLQAAAAHWQQHQQH	117	sp|P49750-3|YLPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5617	18.025	3	1908.9456	1908.9456	L	R	381	397
PSM	KRGFGFVTFDDHDPVD	118	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9503	25.274	3	1850.8588	1850.8588	K	K	140	156
PSM	KTANKDHLVTAYNHLFET	119	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8836	23.383	3	2101.0593	2101.0593	A	K	52	70
PSM	KVKSAFLLQNLLVGHPEH	120	sp|Q9NZL4|HPBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9721	26.257	4	2029.1473	2029.1473	L	K	247	265
PSM	RHLQLAIRNDEELN	121	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7851	21.738	2	1719.9016	1719.9016	P	K	82	96
PSM	RHQPASASSTAASPAHPAKL	122	sp|Q96L91-3|EP400_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4675	16.581	3	1984.0239	1984.0239	P	R	1462	1482
PSM	RKLDQEMEQLNHHTTT	123	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:35	ms_run[2]:scan=4728	16.681	3	1995.9432	1995.9432	L	R	380	396
PSM	RLHGVRDYAAYNVLDDPEL	124	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9668	26.004	3	2215.1022	2215.1022	L	R	78	97
PSM	RNPHAAKDSSDPNELYVNH	125	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5394	17.681	4	2163.0093	2163.0093	T	K	148	167
PSM	RTTGIVMDSGDGVTHTVPIYEGYALPHAIL	126	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:35	ms_run[2]:scan=10089	27.868	4	3198.6019	3198.6019	G	R	147	177
PSM	RRIQLVEEELDRAQE	127	sp|P09493|TPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8722	23.187277838133333	3	1882.987471	1882.986088	N	R	90	105
PSM	RKKEIEELQSQAQALSQEG	128	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8769	23.266270927466667	3	2171.123494	2171.118225	V	K	1432	1451
PSM	RKDETKTQAIVCQQLDLTHL	129	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	12-UNIMOD:4	ms_run[1]:scan=9366	24.7833943392	4	2396.249083	2396.248193	D	K	190	210
PSM	KKKFACNGTVIEHPEYGEVIQLQGDQ	130	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	6-UNIMOD:4	ms_run[1]:scan=8756	23.24451730666667	4	2987.486818	2987.481107	F	R	64	90
PSM	KGEEHCGHLIEAH	131	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:4	ms_run[2]:scan=4211	15.711	2	1515.6889	1515.6889	E	K	40	53
PSM	KHGDPGDAAQQEAKH	132	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3450	14.588	3	1587.739	1587.7390	A	R	20	35
PSM	KHTTSIFDDFSHYEK	133	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9156	24.126	3	1853.8584	1853.8584	Y	R	498	513
PSM	KKSDVEDHSVHLLFSAN	134	sp|P23919-2|KTHY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8704	23.162	3	1924.9643	1924.9643	Q	R	59	76
PSM	KLITSDKVENFHEEHE	135	sp|Q7Z5K2|WAPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6831	20.129	4	1953.9432	1953.9432	N	K	162	178
PSM	KNRHEIAVMLLEGGANPDA	136	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9427	24.986	3	2034.0317	2034.0317	S	K	116	135
PSM	KNVMVEPHRHEGVFIC	137	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=7094	20.556	3	1966.9506	1966.9506	G	R	84	100
PSM	KRGHVFEESQVAGTPMFVV	138	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9543	25.432	3	2117.0728	2117.0728	R	K	766	785
PSM	RAFHNEAQVNPER	139	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4706	16.64	2	1566.7651	1566.7651	L	K	468	481
PSM	RGKAHAAVWNAQEAQADFA	140	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8459	22.764	3	2039.9926	2039.9926	K	K	271	290
PSM	RHAEQERDELADEITNSASG	141	sp|P35580-5|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8145	22.214	3	2227.0101	2227.0101	R	K	1713	1733
PSM	RPSHAQLHSDYMQPLTEAKA	142	sp|Q9NQH7-3|XPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:35	ms_run[2]:scan=6388	19.328	4	2295.1066	2295.1066	M	K	208	228
PSM	RSKNVGMPIAMLLHTDGAHE	143	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=9141	24.078	4	2192.083	2192.0830	G	R	201	221
PSM	RTPLPTVNERDTENHTSHGDG	144	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5540	17.905	4	2332.0792	2332.0792	T	R	4	25
PSM	KRGHVFEESQVAGTPMFVV	145	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	16-UNIMOD:35	ms_run[1]:scan=9153	24.1146655448	3	2134.071836	2133.067710	R	K	766	785
PSM	KHGDPGDAAQQEAKH	146	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=3431	14.5681203704	3	1587.738450	1587.738982	A	R	20	35
PSM	KKVIQYLAYVASSHKS	147	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=8736	23.209327586399997	3	1821.017829	1821.014869	T	K	185	201
PSM	KRGGEVLDSSHDDIKLE	148	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7297	20.869443365066665	3	1896.956715	1896.954120	E	K	269	286
PSM	KKAAGIDEQENWHEGKENI	149	sp|P28838|AMPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=6941	20.313907539733336	4	2195.059854	2195.060710	G	R	103	122
PSM	RKRGEAASGSGAELQEQAGCEAPEAAAP	150	sp|Q9UBU6|FA8A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	20-UNIMOD:4	ms_run[1]:scan=6892	20.2417826808	4	2797.307625	2797.304933	L	R	74	102
PSM	RRVSVCAETYNPDEEEEDTDPRVIHP	151	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	6-UNIMOD:4	ms_run[1]:scan=8158	22.237250691466667	4	3112.416184	3112.415606	N	K	96	122
PSM	KGEEHCGHLIEAH	152	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:4	ms_run[2]:scan=4186	15.65	3	1515.6889	1515.6889	E	K	40	53
PSM	KGFQVAPEHHNDH	153	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4466	16.235	3	1514.7015	1514.7015	F	K	400	413
PSM	KGGHGAASPSEKGAHPSGGADDVA	154	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=3725	14.877	3	2158.9992	2158.9992	S	K	10	34
PSM	KGHYTEGAELVDSVLDVV	155	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10586	30.024	3	1929.9684	1929.9684	A	R	103	121
PSM	KLSTDDLNSLIAHAHR	156	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9217	24.292	4	1789.9435	1789.9435	D	R	363	379
PSM	KQEGHNLGLLHGDMDQSERN	157	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=6098	18.836	4	2293.0506	2293.0506	L	K	400	420
PSM	KRGDQLLSVNGVSVEGEHHE	158	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7855	21.746	4	2189.0825	2189.0825	L	K	135	155
PSM	KRGFAFVTFDDHDSVD	159	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9452	25.076	3	1854.8537	1854.8537	K	K	145	161
PSM	KSDALETLGFLNHYQM	160	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	16-UNIMOD:35	ms_run[2]:scan=10017	27.576	3	1881.8931	1881.8931	S	K	552	568
PSM	KWLQDEMFHSDFQHHN	161	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35	ms_run[2]:scan=8377	22.626	3	2113.9065	2113.9065	A	K	1206	1222
PSM	KYLDNIHLHPEEEKY	162	sp|Q9BZV1-2|UBXN6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8251	22.402	4	1926.9476	1926.9476	A	R	127	142
PSM	RKYFTCDEGHGIFV	163	sp|Q14203-3|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:4	ms_run[2]:scan=8910	23.521	3	1727.809	1727.8090	G	R	59	73
PSM	RNQTQLSNKHELQLEQMH	164	sp|O94804|STK10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:35	ms_run[2]:scan=5971	18.589	3	2249.0971	2249.0971	H	K	578	596
PSM	RQLHQELPSHGVPLINHL	165	sp|Q9UJX4-3|APC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8878	23.459	4	2087.1388	2087.1388	F	-	626	644
PSM	RRPVHGESDTEQLQDDDIETT	166	sp|Q9BW27-3|NUP85_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6740	19.979	3	2440.1102	2440.1102	S	K	564	585
PSM	RSHPETLTHTASPHPGGAEEGD	167	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4686	16.598	4	2282.0312	2282.0312	S	R	578	600
PSM	RSKNVGMPIAMLLHTDGAHE	168	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35	ms_run[2]:scan=8998	23.709	4	2192.083	2192.0830	G	R	201	221
PSM	RWSPHHNCTQVATANDTTL	169	sp|Q53HC9|EIPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:4	ms_run[2]:scan=7120	20.597	3	2208.013	2208.0130	G	R	191	210
PSM	KQKMNDSMDTSNKEEK	170	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	4-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3250	14.236228622666665	3	1943.857503	1943.856456	Q	-	913	929
PSM	KRTGSDHTNPTSPLLVKPSDLLEEN	171	sp|Q96D71|REPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=9369	24.7936046488	4	2747.414772	2747.408987	L	K	471	496
PSM	KEGDLAGHDMGHESK	172	sp|Q9UI36-2|DACH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:35	ms_run[2]:scan=3466	14.604	3	1625.7104	1625.7104	P	R	503	518
PSM	KHAAENPGKYNILGTNTIMD	173	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	19-UNIMOD:35	ms_run[2]:scan=8398	22.661	3	2202.0739	2202.0739	T	K	497	517
PSM	KHTTSIFDDFAHYEK	174	sp|Q9BYJ9|YTHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9318	24.608	4	1837.8635	1837.8635	Y	R	527	542
PSM	KHYVGHGNAINEL	175	sp|O75530-3|EED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6616	19.741	2	1450.7317	1450.7317	I	K	184	197
PSM	KLRFPAEDEFPDLSAHNNHMA	176	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	20-UNIMOD:35	ms_run[2]:scan=9126	24.034	4	2454.1386	2454.1386	L	K	11	32
PSM	KMKVVEVLAGHGHLYS	177	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8616	23.026	3	1766.9502	1766.9502	L	R	1239	1255
PSM	KVIQYLAHVASSHKG	178	sp|P35580-5|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7950	21.913	3	1636.9049	1636.9049	K	R	190	205
PSM	KVKALLSHDSGSDHLAFV	179	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8678	23.119	3	1923.0214	1923.0214	D	R	884	902
PSM	RCLLLHPAGHAEPAAGSH	180	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=6129	18.873	4	1892.9428	1892.9428	D	R	38	56
PSM	RDKENALMPNWLHLPVGYHG	181	sp|P16930-2|FAAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:35	ms_run[2]:scan=9701	26.159	4	2362.1641	2362.1641	F	R	72	92
PSM	RGVAGAHGLLCLLSDHVDK	182	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4	ms_run[2]:scan=9624	25.803	4	2017.0527	2017.0527	E	R	47	66
PSM	RGVAMNPVEHPFGGGNHQHIG	183	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:35	ms_run[2]:scan=6680	19.87	4	2226.0501	2226.0501	V	K	200	221
PSM	RHYGGLTGLNKAETAA	184	sp|P15259|PGAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7039	20.461	3	1657.8536	1657.8536	E	K	90	106
PSM	RKSNIHCNTIAPNAGS	185	sp|P51659-3|DHB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=4487	16.275	2	1738.8533	1738.8533	G	R	165	181
PSM	RRQEDGTQPQVNGQQVGCVTDGHHASS	186	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	18-UNIMOD:4	ms_run[2]:scan=5504	17.847	4	2947.3339	2947.3339	V	R	886	913
PSM	RTDLCDHALHISHDEL	187	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=8329	22.535	4	1930.8956	1930.8956	K	-	167	183
PSM	RVLHTALHSSSSY	188	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5714	18.178	2	1456.7423	1456.7423	F	R	114	127
PSM	RTKPQGDQDTGKEADDGCALGGR	189	sp|O75127|PTCD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	18-UNIMOD:4	ms_run[1]:scan=4255	15.838782677333334	4	2431.116459	2431.114613	F	-	678	701
PSM	KKALAAAGYDVEKNNS	190	sp|Q02539|H11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5544	17.916135514666667	3	1677.870600	1677.868599	L	R	66	82
PSM	KRNIIGYFEQKDSDNY	191	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9086	23.932325148533334	3	1988.961967	1988.959205	S	R	160	176
PSM	RKKIDDPIDEEEEFEEL	192	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9529	25.3678757912	3	2133.013578	2133.011360	N	K	1743	1760
PSM	KKKVWLDPNETNEIANANS	193	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8153	22.2272344496	3	2170.103538	2170.101846	G	R	19	38
PSM	KKISSIQSIVPALEIANAHR	194	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9505	25.281236801866665	4	2174.254842	2174.253536	E	K	249	269
PSM	RRKGEESEGFLNPELLETS	195	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=9563	25.528062274933333	3	2190.094698	2190.091676	K	R	939	958
PSM	KKKDSETSFVPTNMAVNYVQHN	196	sp|Q9NZ63|TLS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8833	23.377566456533334	4	2536.241086	2536.238022	N	R	204	226
PSM	KAAVVKFHPIQGH	197	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6074	18.801	3	1430.8147	1430.8147	D	R	154	167
PSM	KDHLVTAYNHLFETK	198	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8661	23.093	4	1814.9315	1814.9315	N	R	56	71
PSM	KHLNEIDLFHCIDPNDS	199	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=9752	26.413	3	2065.9527	2065.9527	F	K	48	65
PSM	KLFVGGIKEDTEEHHL	200	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7838	21.718	4	1850.9527	1850.9527	K	R	101	117
PSM	KMAVTFIGNSTAIQELFK	201	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=10358	29.039	3	2013.0605	2013.0605	L	R	362	380
PSM	KMIDERQQELTHQEH	202	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35	ms_run[2]:scan=4462	16.23	4	1936.9061	1936.9061	A	R	173	188
PSM	KRGFGFVYFQNHDAAD	203	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9239	24.358	3	1870.8751	1870.8751	K	K	138	154
PSM	KTAFHQEQGHQLLK	204	sp|P51580|TPMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5348	17.621	4	1663.8794	1663.8794	G	K	37	51
PSM	KTSLHYPESFNHPFHQ	205	sp|Q9Y2L5-2|TPPC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8256	22.41	4	1967.9278	1967.9278	I	K	1235	1251
PSM	KTVKHGAGAEISTVHPEQYA	206	sp|Q8TBX8-2|PI42C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6670	19.847	3	2122.0807	2122.0807	A	K	342	362
PSM	KVPGNFHVSTHSATAQPQNPDMTHVIH	207	sp|Q969X5-2|ERGI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:35	ms_run[2]:scan=6915	20.275	5	2965.4253	2965.4253	N	K	33	60
PSM	RCPLHSCVSCHASNPSNPRPS	208	sp|O96028-2|NSD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4835	16.829	4	2419.0692	2419.0692	F	K	106	127
PSM	RDIGTAIQFLHSHNIAH	209	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9340	24.691	4	1928.9969	1928.9969	M	R	148	165
PSM	RDLEFSHSDSRDQVIGH	210	sp|Q8IX01-4|SUGP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6996	20.397	4	1996.9351	1996.9351	G	R	109	126
PSM	REHPFLVKGGEDL	211	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8122	22.184	3	1495.7783	1495.7783	E	R	3746	3759
PSM	RFHEFHSPALEDADFEN	212	sp|Q9H223|EHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9058	23.859	3	2059.9024	2059.9024	Y	K	44	61
PSM	RHATALEELSEQLEQAK	213	sp|P35580-5|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9851	26.876	3	1951.9963	1951.9963	Q	R	1209	1226
PSM	RHGFEAASIKEE	214	sp|P35580-5|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5904	18.474	2	1372.6735	1372.6735	E	R	42	54
PSM	RHLQLAVRNDEELN	215	sp|Q8IUE6|H2A2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7317	20.896	3	1705.886	1705.8860	P	K	82	96
PSM	RKHYFYADLPAGYQITQQ	216	sp|O75879|GATB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9335	24.673	3	2198.0909	2198.0909	D	R	138	156
PSM	RLHTLEEEKEELAQYQ	217	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8893	23.485	3	2014.996	2014.9960	E	K	199	215
PSM	RNPVHNGHALLMQDTH	218	sp|O43252|PAPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:35	ms_run[2]:scan=5148	17.296	3	1854.8907	1854.8907	L	K	421	437
PSM	RPQQHFLPNQAHQGDHY	219	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6270	19.112	4	2071.9725	2071.9725	P	R	351	368
PSM	RSVEDVRPHHTDANNQSACFEAPDQ	220	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	19-UNIMOD:4	ms_run[2]:scan=6614	19.735	4	2879.2641	2879.2641	S	K	634	659
PSM	RYASICQQNGIVPIVEPEILPDGDHDLK	221	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4	ms_run[2]:scan=9882	27.01	4	3175.5972	3175.5972	A	R	173	201
PSM	RYGSALASAGDPGHPNHPLHASQNSA	222	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6173	18.944	4	2611.2276	2611.2276	L	R	1854	1880
PSM	RTDLCDHALHISHDEL	223	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	5-UNIMOD:4	ms_run[1]:scan=8318	22.516380055466666	4	1930.895743	1930.895559	K	-	167	183
PSM	RRDLEGSDIDTR	224	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5060	17.1581906256	3	1431.707464	1431.706619	I	R	371	383
PSM	RRIVDDWANDGWGLK	225	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=9514	25.3161470272	3	1799.908396	1799.906716	D	K	444	459
PSM	KKGFTEVKSQNGEFMTH	226	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	15-UNIMOD:35	ms_run[1]:scan=5538	17.901183568799997	3	1982.953019	1982.952011	R	K	485	502
PSM	KKALEEETKNHEAQIQDM	227	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	18-UNIMOD:35	ms_run[1]:scan=4925	16.967577397066666	4	2157.035317	2157.037198	L	R	1180	1198
PSM	KKDEENDSKAPPHELTEEE	228	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4999	17.0791868984	4	2224.015613	2224.013151	L	K	194	213
PSM	RKAAVEALQSQALHATSQQPLR	229	sp|Q92599|SEPT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8184	22.2884983448	4	2402.315274	2402.314239	R	K	401	423
PSM	KCHAEHTPEEEIDHTGA	230	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4	ms_run[2]:scan=5192	17.371	3	1959.8381	1959.8381	Q	K	539	556
PSM	KEHNGHITGIDWAPKSD	231	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7591	21.339	3	1903.9177	1903.9177	L	R	49	66
PSM	KHLAPFLPNHPVISLK	232	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9105	23.982	4	1810.0618	1810.0618	K	R	774	790
PSM	KHTTSIFDDFSHYEK	233	sp|Q9Y5A9-2|YTHD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9173	24.173	4	1853.8584	1853.8584	Y	R	498	513
PSM	KILTTASSHEFEHTK	234	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5744	18.225	4	1727.8842	1727.8842	E	K	27	42
PSM	KKDNGEFSHHDLAPALDTGTTEED	235	sp|P57740-2|NU107_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7845	21.728	4	2626.1783	2626.1783	R	R	616	640
PSM	KKHLEINPDHPIVETL	236	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8493	22.813	3	1882.0312	1882.0312	A	R	623	639
PSM	KKISSIQSIVPALEIANAH	237	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9772	26.512	3	2018.1524	2018.1524	E	R	249	268
PSM	KKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHG	238	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4698	16.624	4	3492.7664	3492.7664	A	K	34	66
PSM	KPHVDITDPEKPHQP	239	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5831	18.36	4	1736.8846	1736.8846	Q	K	213	228
PSM	KTKMTNHCVFSANEDHETI	240	sp|Q9Y6E2-2|BZW2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=6777	20.045	4	2277.0154	2277.0154	D	R	90	109
PSM	KYHTVNGHNCEV	241	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:4	ms_run[2]:scan=4213	15.721	2	1456.6517	1456.6517	Q	R	166	178
PSM	RHFLLEEDKPEEPTAHAFVSTLT	242	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9509	25.296	4	2666.334	2666.3340	F	R	1515	1538
PSM	RHHGDVMDLQFFDQE	243	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=9302	24.555	3	1888.8162	1888.8162	I	R	72	87
PSM	RHPHDIIDDINSGAVECPAS	244	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=9045	23.83	3	2202.0124	2202.0124	G	-	113	133
PSM	RHSEAATAQREEW	245	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5612	18.019	3	1569.7284	1569.7284	P	K	85	98
PSM	RHVFGQAVKNDQCYDDI	246	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:4	ms_run[2]:scan=7963	21.929	3	2063.9483	2063.9483	F	R	11	28
PSM	RLSEVDIDDDERPHNPH	247	sp|Q6UX04-2|CWC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6626	19.764	4	2042.9406	2042.9406	L	K	143	160
PSM	RNKIAGYVTHLM	248	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=7668	21.46	3	1417.75	1417.7500	L	K	47	59
PSM	RPGLSSLPPRGPHHLDNSSPGPGSEA	249	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7761	21.593	4	2618.295	2618.2950	G	R	373	399
PSM	RREPWLLPSQHNDII	250	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9481	25.182	3	1872.9959	1872.9959	G	R	683	698
PSM	RRVEVNGEHATV	251	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5036	17.126	2	1365.7113	1365.7113	G	R	12	24
PSM	RTIAPTGHLHTVEFHQQ	252	sp|Q96FX7|TRM61_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7174	20.677	4	1971.0075	1971.0075	I	R	123	140
PSM	RVHLENMGSHDIVDGNH	253	sp|P11277-3|SPTB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=5825	18.349	3	1944.8861	1944.8861	Q	R	127	144
PSM	RYEYHWADGTNIK	254	sp|Q9H8S9-2|MOB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8030	22.021	3	1651.7743	1651.7743	P	K	92	105
PSM	RYPHLGQKPGGSDFL	255	sp|P56211-2|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8620	23.029	3	1670.8529	1670.8529	A	R	19	34
PSM	KHLSPYATLTVGDSSHKT	256	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7109	20.578472198133333	4	1942.000167	1940.995590	T	K	817	835
PSM	KKRVDIIPGFEFD	257	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9782	26.557043267466668	2	1562.848433	1562.845679	K	R	468	481
PSM	KKKDTAASGYGTQNI	258	sp|Q9Y314|NOSIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5371	17.65074780533333	3	1580.817118	1580.815835	E	R	19	34
PSM	RKSMYEEEINETR	259	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:35	ms_run[1]:scan=5665	18.102078092533336	3	1699.784968	1699.783549	F	R	208	221
PSM	KKLENCNYAVELGKHPA	260	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:4	ms_run[1]:scan=6931	20.297128277866666	4	1970.005292	1970.004381	M	K	458	475
PSM	RRGFCFITYTDEEPVK	261	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	5-UNIMOD:4	ms_run[1]:scan=9185	24.204283628533336	3	2016.978042	2016.972747	E	K	273	289
PSM	KKHSQFIGYPITLFVEKE	262	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9891	27.047796048266665	3	2163.177686	2163.172827	V	R	208	226
PSM	RRDKPSVEPVEEYDYEDL	263	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=9087	23.935114473333332	3	2238.047227	2238.044057	S	K	44	62
PSM	KKYEDICPSTHNMDVPNIK	264	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:4	ms_run[1]:scan=7763	21.595354938666667	4	2288.094225	2288.092938	G	R	67	86
PSM	KKKMQQNIQELEEQLEEEESA	265	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:35	ms_run[1]:scan=9444	25.046092684533335	3	2576.231865	2576.227577	E	R	938	959
PSM	KANIRNMSVIAHVDHG	266	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=5580	17.967	3	1776.9053	1776.9053	K	K	16	32
PSM	KEKLCYVALDFEQEMATAASSSSLE	267	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4	ms_run[2]:scan=10581	30.005	3	2806.3041	2806.3041	I	K	213	238
PSM	KGRPAPGFHHGDGPGNAVQEIMIPAS	268	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	22-UNIMOD:35	ms_run[2]:scan=8349	22.565	4	2655.2976	2655.2976	E	K	170	196
PSM	KHKELAPYDENWFYT	269	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9530	25.373	3	1939.9105	1939.9105	A	R	41	56
PSM	KIAHIMGPPDRCEHAA	270	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=5030	17.118	3	1817.8665	1817.8665	E	R	368	384
PSM	KIGEHMEEHGIKFI	271	sp|Q16881-7|TRXR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35	ms_run[2]:scan=7798	21.65	4	1682.845	1682.8450	N	R	197	211
PSM	KLFVGGIKEDTEEHHL	272	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7908	21.833	3	1850.9527	1850.9527	K	R	101	117
PSM	KPKPIDVQVITHHMQ	273	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=6883	20.228	3	1785.956	1785.9560	L	R	359	374
PSM	KTVETRDGQVINETSQHHDDLE	274	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6228	19.04	4	2550.1946	2550.1946	I	-	445	467
PSM	KVPSAPHFVHPNDHAN	275	sp|Q9NVN8|GNL3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6218	19.019	4	1765.8649	1765.8649	S	R	39	55
PSM	RDWQSYYYHHPQD	276	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8132	22.197	3	1793.7546	1793.7546	N	R	720	733
PSM	RERGSDASGQLFHG	277	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6190	18.977	2	1515.7179	1515.7179	L	R	1229	1243
PSM	RFYHEELNAPIR	278	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7645	21.426	3	1543.7896	1543.7896	N	R	226	238
PSM	RHFFHEDEEPFNPDYVEVD	279	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9489	25.211	3	2420.0346	2420.0346	M	R	430	449
PSM	RKLHNSYTDVMCNPFYNPGD	280	sp|Q9UL33-2|TPC2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8903	23.505	3	2443.0685	2443.0685	F	R	101	121
PSM	RKNGGLGHMNIALLSDLT	281	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=9482	25.185	3	1925.0153	1925.0153	P	K	130	148
PSM	RLGHGYHTLEDQALYN	282	sp|P00813|ADA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8016	22.002	3	1885.9071	1885.9071	E	R	235	251
PSM	RNIHSSDWPKFFE	283	sp|Q9Y224|RTRAF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9413	24.947	3	1661.795	1661.7950	L	K	49	62
PSM	RNIHSSDWPKFFE	284	sp|Q9Y224|RTRAF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9525	25.359	3	1661.795	1661.7950	L	K	49	62
PSM	RNKDHPAFAPLYFPMELH	285	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=9580	25.607	4	2198.0731	2198.0731	E	R	58	76
PSM	RNKIAGYVTHLM	286	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8860	23.427	3	1401.7551	1401.7551	L	K	47	59
PSM	RQQIIHSGHFMVSSPH	287	sp|Q9HAP2-3|MLXIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=6704	19.915	4	1875.9162	1875.9162	R	R	73	89
PSM	RRFDSELSQAHEEAQ	288	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6627	19.765	3	1801.8343	1801.8343	Q	R	1003	1018
PSM	RSKNVGMPIAMLLHTDGAHE	289	sp|P13995|MTDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9515	25.318	4	2176.0881	2176.0881	G	R	201	221
PSM	RVFDHKQGTYGGYF	290	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8588	22.966	2	1673.795	1673.7950	E	R	862	876
PSM	KLITSDKVENFHEEHE	291	sp|Q7Z5K2|WAPL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6821	20.112148117333334	4	1953.950234	1953.943220	N	K	162	178
PSM	RGDDTPLHLAASHGH	292	sp|Q13418|ILK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6211	19.007174115199998	4	1582.760055	1582.760051	N	R	65	80
PSM	REVLEGLEYLHKNGQIH	293	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8914	23.529054671733334	4	2034.066847	2034.064673	L	R	128	145
PSM	RHPEKQGSYSPALPLQPLGGH	294	sp|Q6ZRI6|CO039_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8487	22.804290719466668	4	2268.196911	2268.176349	C	K	290	311
PSM	KKKEEGVIDSSD	295	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3950	15.141520703733333	2	1333.673189	1333.672525	K	K	249	261
PSM	KKIKLTAEAEEL	296	sp|P35610|SOAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7622	21.385964984533334	2	1371.798486	1371.797331	A	K	50	62
PSM	KKKDEELSSALE	297	sp|Q99816|TS101_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6179	18.955155792000003	2	1375.721008	1375.719475	L	K	292	304
PSM	RRGALIVLEGVDRAG	298	sp|P23919|KTHY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8821	23.3568267992	3	1580.912569	1580.911073	A	K	4	19
PSM	RKTVTAMDVVYALK	299	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=9507	25.2894868544	3	1593.892536	1593.891249	K	R	79	93
PSM	KRGGEVLDSSHDDIKLE	300	sp|O76031|CLPX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7316	20.895507646133336	4	1896.955655	1896.954120	E	K	269	286
PSM	RRKPEDVLDDDDAGSAPL	301	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8330	22.536465420800003	3	1967.956495	1967.954848	K	K	348	366
PSM	RKENSGAAEKPVTIHATPEGTSEAC	302	sp|Q9Y6M1|IF2B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	25-UNIMOD:4	ms_run[1]:scan=5464	17.79500103946667	4	2639.262778	2639.260943	H	R	231	256
PSM	KARHGFCGIPITDTG	303	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=8228	22.37	3	1628.8093	1628.8093	A	R	134	149
PSM	KCHVTIEKDGGCNHMVC	304	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=4499	16.303	3	2059.8696	2059.8696	P	R	346	363
PSM	KDEIRHWILPQDYDHAQAEA	305	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9131	24.046	4	2434.1666	2434.1666	D	R	215	235
PSM	KDRTQIAICPNNHEVHIYE	306	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4	ms_run[2]:scan=8164	22.248	4	2336.1332	2336.1332	N	K	18	37
PSM	KEQSIFGDHRDEEEETHM	307	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	18-UNIMOD:35	ms_run[2]:scan=6366	19.279	3	2231.9389	2231.9389	L	K	252	270
PSM	KHLEINPDHSIIETL	308	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9322	24.619	3	1757.9312	1757.9312	K	R	632	647
PSM	KLFVGGIKEDTEEHHL	309	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8291	22.473	3	1850.9527	1850.9527	K	R	101	117
PSM	KLKHYGPGWVSMANAG	310	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=7359	20.97	3	1730.8563	1730.8563	F	K	129	145
PSM	KLKHYGPGWVSMANAG	311	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8406	22.676	3	1714.8613	1714.8613	F	K	129	145
PSM	KNRHEIAVMLLEGGANPDA	312	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=8881	23.464	3	2050.0266	2050.0266	S	K	116	135
PSM	KPHVNVGTIGHVDHG	313	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5857	18.4	4	1565.8063	1565.8063	D	K	55	70
PSM	KSIYGEKFEDENFIL	314	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9920	27.17	3	1830.904	1830.9040	G	K	76	91
PSM	KSMTEAEQQQLIDDHFLFD	315	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=10029	27.627	3	2310.0474	2310.0474	L	K	177	196
PSM	KSMTEAEQQQLIDDHFLFD	316	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10114	27.972	3	2294.0525	2294.0525	L	K	177	196
PSM	KTRHLALNLQE	317	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7355	20.963	2	1321.7466	1321.7466	T	K	723	734
PSM	KWKAYDATHLV	318	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8458	22.762	3	1330.7034	1330.7034	S	K	198	209
PSM	RDLKPENILLDDHGHI	319	sp|P43250-3|GRK6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8980	23.677	4	1883.9854	1883.9854	Y	R	310	326
PSM	REHGVYASSKEE	320	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3718	14.868	2	1390.6477	1390.6477	R	K	140	152
PSM	REKEHYCLADLASLMD	321	sp|Q92552|RT27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=9438	25.023	3	1965.8924	1965.8924	A	K	43	59
PSM	REKLHAVNAEECNVLQG	322	sp|O75521-2|ECI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4	ms_run[2]:scan=7394	21.021	3	1965.9691	1965.9691	E	R	322	339
PSM	REVLEGLEYLHKNGQIH	323	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8927	23.567	4	2034.0647	2034.0647	L	R	128	145
PSM	RFGGPVHHQAQ	324	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3917	15.089	2	1232.6163	1232.6163	R	R	206	217
PSM	RFHEFHSPALEDADFDN	325	sp|Q9NZN3-2|EHD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9053	23.847	3	2045.8868	2045.8868	Y	K	41	58
PSM	RGFGFVTFDDHDPVD	326	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9908	27.121	3	1722.7638	1722.7638	K	K	141	156
PSM	RHESGASIKIDEPLEGSED	327	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7946	21.906	3	2067.9709	2067.9709	I	R	390	409
PSM	RHIIKEYAENIGDG	328	sp|Q8WYA6-3|CTBL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7156	20.648	3	1613.8162	1613.8162	V	R	278	292
PSM	RHLQLAIRNDEELN	329	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8073	22.093	3	1719.9016	1719.9016	P	K	82	96
PSM	RHPLVPNQGDHSAHLP	330	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6648	19.803	3	1773.9023	1773.9023	A	R	335	351
PSM	RHSQQLFPDGSPGDQWVKH	331	sp|Q8IU60-2|DCP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8552	22.908	4	2218.0668	2218.0668	F	R	274	293
PSM	RINFDKYHPGYFG	332	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8986	23.688	3	1612.7787	1612.7787	H	K	42	55
PSM	RMSHSSSSDTDINEIHTNH	333	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35	ms_run[2]:scan=4738	16.7	4	2182.9298	2182.9298	S	K	675	694
PSM	RNKWGETPLHTAC	334	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=6890	20.239	3	1568.7518	1568.7518	H	R	487	500
PSM	RPLHPVANPHAEISTKVPAS	335	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6753	20.005	4	2120.1491	2120.1491	Q	K	153	173
PSM	RSPVVGFDPHHHM	336	sp|Q04727-2|TLE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:35	ms_run[2]:scan=5982	18.613	3	1530.715	1530.7150	G	R	349	362
PSM	RTGISHGHTVYVVHDGFEGLA	337	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8573	22.935	4	2251.1134	2251.1134	V	K	423	444
PSM	RYLHDESGLNR	338	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5229	17.436	3	1358.6691	1358.6691	E	R	128	139
PSM	KCPTPGCNSLGHLTGKHE	339	sp|O95251|KAT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=5988	18.620462062666665	4	1993.936113	1991.930565	M	R	184	202
PSM	RHPGSFDVVHVKDANGNSFAT	340	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8210	22.336806239999998	3	2255.076108	2254.087928	E	R	200	221
PSM	RRDDGLSAAAR	341	sp|P84101|SERF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4035	15.289332205066668	3	1186.617276	1186.616682	K	K	26	37
PSM	RKFVMKPPQVV	342	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8090	22.12102438906667	2	1327.780650	1327.779848	K	R	200	211
PSM	RKFDGVEGPRTP	343	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6148	18.905454047733333	3	1358.712922	1357.710248	Y	K	366	378
PSM	RKLLEGEEERL	344	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7375	20.9896422576	2	1370.753285	1370.751778	Y	R	377	388
PSM	RKREDEAPILEQ	345	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6361	19.264882929866666	2	1482.781677	1482.779056	K	R	1274	1286
PSM	RKSVFEEEVRET	346	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6995	20.394927621866668	3	1507.762792	1507.763071	F	R	222	234
PSM	KRAQEEAERLEAD	347	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4976	17.044130944533332	3	1543.758643	1543.759048	R	R	380	393
PSM	KKKYSDADIEPFL	348	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9096	23.9585603584	3	1552.814992	1552.813710	Y	K	1857	1870
PSM	RRDVDFELIKVEG	349	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9241	24.3619574512	3	1574.842615	1574.841656	E	K	201	214
PSM	RKTVTAMDVVYALK	350	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9501	25.2685433256	3	1593.892536	1593.891249	K	R	79	93
PSM	KKLPQVEHVLPLLK	351	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8888	23.4754739592	3	1641.034008	1641.034148	D	R	436	450
PSM	KKKIEQQGGFTFEN	352	sp|O15397|IPO8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7220	20.750768844	3	1652.853765	1652.852221	A	K	1008	1022
PSM	RKLSSKGSFADLGLEP	353	sp|Q9NUL7|DDX28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8956	23.623154247733332	3	1703.924035	1703.920634	V	R	120	136
PSM	KKKGWLDQEDQEAPLQ	354	sp|Q8IWC1|MA7D3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8176	22.270092180800003	3	1911.969418	1911.969041	K	K	663	679
PSM	RRNSCNQCNEPRPEDS	355	sp|Q92804|RBP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=3617	14.765321003466665	3	2017.845812	2017.844269	A	R	372	388
PSM	KRGQTCVVHYTGMLEDGK	356	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	6-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=6368	19.283703727733332	4	2093.998378	2093.998644	P	K	18	36
PSM	RKRPAPQQIQQVQQQAVQN	357	sp|Q96GM5|SMRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6045	18.736646820533334	3	2244.223169	2244.219945	S	R	100	119
PSM	RKGTGKEQAPLEMSMHPAASAPLSVFT	358	sp|Q6P1X5|TAF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	13-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=8752	23.235146132266667	4	2872.422227	2872.421149	A	K	1109	1136
PSM	RRGPPRNYAGEEEEEGSGSSEGFDPPATD	359	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7385	21.005260930133332	4	3092.339029	3092.334378	R	R	185	214
PSM	KEAAKLGLSVFTHH	360	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8387	22.642	4	1536.8413	1536.8413	D	R	138	152
PSM	KFHGTVKAENG	361	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3713	14.863	2	1186.6095	1186.6095	G	K	13	24
PSM	KGHSLGTASGNPHLDPRA	362	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5526	17.886	4	1813.9183	1813.9183	G	R	1028	1046
PSM	KHLQLNETSTANHIHS	363	sp|Q96HV5|TM41A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5557	17.938	4	1828.918	1828.9180	Q	R	245	261
PSM	KIHQEGDALPGHSKPS	364	sp|Q1ED39|KNOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4156	15.576	3	1699.8642	1699.8642	K	R	217	233
PSM	KKNCHLNENIE	365	sp|Q13907|IDI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4	ms_run[2]:scan=4464	16.232	2	1397.6721	1397.6721	T	K	36	47
PSM	KKYVATLGVEVHPLVFHTN	366	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9209	24.273	4	2151.1841	2151.1841	E	R	37	56
PSM	KLKHECGAAFTS	367	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4	ms_run[2]:scan=4825	16.816	2	1347.6605	1347.6605	S	K	614	626
PSM	KPWSQHYHQGYY	368	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7051	20.479	3	1592.7161	1592.7161	Q	-	795	807
PSM	KRPHTPTPGIYMG	369	sp|P62995-3|TRA2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7191	20.704	2	1453.75	1453.7500	T	R	97	110
PSM	KRVLIAAHGNSL	370	sp|P15259|PGAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6404	19.351	3	1277.7568	1277.7568	G	R	179	191
PSM	KVHLVGIDIFTGK	371	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9641	25.877	3	1425.8344	1425.8344	A	K	55	68
PSM	KVPGNFHVSTHSATAQPQNPDMTHVIH	372	sp|Q969X5-2|ERGI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7625	21.391	5	2949.4304	2949.4304	N	K	33	60
PSM	KWKPGSLASHV	373	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7402	21.035	3	1208.6666	1208.6666	P	K	186	197
PSM	RAISHEHSPSDLEAHFVPLV	374	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9394	24.884	4	2240.1338	2240.1338	L	K	113	133
PSM	RAIWSQPELAYEEHHAH	375	sp|Q8IYS1|P20D2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8466	22.775	3	2072.9817	2072.9817	S	R	43	60
PSM	RELHPPATSHEAPGTK	376	sp|Q15345-3|LRC41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4308	15.95	4	1726.8751	1726.8751	K	R	340	356
PSM	RERLEDTHFVQCPSVPGH	377	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=7703	21.509	3	2163.028	2163.0280	C	K	507	525
PSM	RGHLSRPEAQSLSPYTTSAN	378	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7195	20.714	3	2171.0719	2171.0719	S	R	250	270
PSM	RGSKGGHGAASPSE	379	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3277	14.35	2	1296.6171	1296.6171	Q	K	7	21
PSM	RGTHMQHAYDFY	380	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35	ms_run[2]:scan=7331	20.919	2	1540.6517	1540.6517	L	K	194	206
PSM	RHADHSSLTLGSGSSTT	381	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5486	17.821	3	1712.8078	1712.8078	V	R	2521	2538
PSM	RHAYGLGEHYNSVT	382	sp|Q8N6M0|OTU6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6687	19.881	3	1602.7539	1602.7539	M	R	269	283
PSM	RHGNQYIQVNEPWK	383	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8261	22.418	3	1767.8805	1767.8805	S	R	713	727
PSM	RHLQLAIRNDEELN	384	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9807	26.676	3	1719.9016	1719.9016	P	K	82	96
PSM	RHQFGTDKDVFGP	385	sp|O95104-2|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7825	21.701	3	1502.7266	1502.7266	S	R	74	87
PSM	RIKTLHAQIIE	386	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7143	20.63	2	1320.7878	1320.7878	G	K	747	758
PSM	RKHAVGDDAQFEMDI	387	sp|Q13542|4EBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=7810	21.677	3	1746.7995	1746.7995	D	-	106	121
PSM	RKHPSSPECLVSAQ	388	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4	ms_run[2]:scan=6229	19.041	2	1594.7886	1594.7886	N	K	72	86
PSM	RKHTLSYVDVGTG	389	sp|P31040-2|SDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7090	20.541	2	1431.747	1431.7470	W	K	575	588
PSM	RLAHGGQVNLDMEDHRDEDFV	390	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=7908	21.833	4	2468.1139	2468.1139	R	K	113	134
PSM	RLLECHFMPPEKVH	391	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=7570	21.307	4	1807.8862	1807.8862	E	K	114	128
PSM	RNHLTQFSPHF	392	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8504	22.829	3	1382.6844	1382.6844	L	K	847	858
PSM	RPKCGFCHVGEEENEA	393	sp|Q8IWS0-4|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5625	18.039	3	1917.8098	1917.8098	T	R	208	224
PSM	RQHLASIYEKEEDW	394	sp|Q9BT78-2|CSN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8546	22.891	3	1802.8588	1802.8588	I	R	107	121
PSM	RQLHDDYFYHDEL	395	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8870	23.444	3	1749.7747	1749.7747	G	-	305	318
PSM	RRDQALTEEHA	396	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4089	15.41	3	1324.6484	1324.6484	P	R	613	624
PSM	RRGPSASSVAVMTSSTSDHHLDAAAA	397	sp|Q9NZQ3-5|SPN90_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=6321	19.201	4	2597.2252	2597.2252	S	R	106	132
PSM	RSSDLIQHQATHTGEKPY	398	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5809	18.327	4	2067.0134	2067.0134	Y	K	273	291
PSM	RVLHHMGGMAGLQSMM	399	sp|P61011-2|SRP54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,15-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=5790	18.291	3	1802.8048	1802.8048	P	R	420	436
PSM	RVPTANVSVVDLTCRLE	400	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:4	ms_run[2]:scan=9707	26.19	3	1928.0149	1928.0149	F	K	192	209
PSM	RVRPDYTAQNLDHG	401	sp|P82930|RT34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6042	18.729	3	1640.8019	1640.8019	T	K	99	113
PSM	KEHQAHVENLEADIK	402	sp|Q13439|GOGA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6527	19.575666306933332	3	1759.887507	1759.885312	L	R	773	788
PSM	RHGNQYIQVNEPWK	403	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8255	22.408537234133334	3	1767.881535	1767.880501	S	R	713	727
PSM	RQHLASIYEKEEDW	404	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8529	22.8667800048	3	1802.858306	1802.858763	I	R	107	121
PSM	RHLQLAIRNDEELN	405	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10516	29.7191179304	3	1719.902962	1719.901630	P	K	82	96
PSM	RHLQLAIRNDEELN	406	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=11432	33.19989691466667	3	1719.902990	1719.901630	P	K	82	96
PSM	RKLAQQIKQEV	407	sp|P13995|MTDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6168	18.9363373328	2	1339.795094	1339.793583	G	R	43	54
PSM	RKVWDQVKASNPDL	408	sp|Q969G3|SMCE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8095	22.138482661333335	3	1654.880138	1654.879104	S	K	78	92
PSM	KRKGVEGLIDIENPN	409	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8843	23.3952619576	3	1680.917790	1680.915883	Q	R	73	88
PSM	RKETQTVKEELESL	410	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8937	23.585654246133334	3	1688.895871	1688.894479	S	R	985	999
PSM	RKSMYEEEINETR	411	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	4-UNIMOD:35	ms_run[1]:scan=5649	18.081163817333334	3	1699.784968	1699.783549	F	R	208	221
PSM	KKIRELGSLPQEAFE	412	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8726	23.192867262666667	3	1743.953571	1743.951935	M	K	941	956
PSM	RKCIGKPGGSLDNSEQ	413	sp|Q9Y5L4|TIM13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	3-UNIMOD:4	ms_run[1]:scan=4450	16.214907252533333	3	1744.852687	1744.852632	F	K	48	64
PSM	RKYYFNNPEDGFFK	414	sp|Q9P0I2|EMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9254	24.396561376	3	1823.864880	1823.863120	T	K	76	90
PSM	KKRGEGEDEVEEESTALQ	415	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6645	19.798454736266667	3	2032.956878	2032.954907	D	K	798	816
PSM	KKKEIIQDVTLHDLDVANA	416	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9130	24.045103410933333	4	2149.174742	2149.174283	H	R	230	249
PSM	KKVDLTHLEGEVEK	417	sp|Q96S94|CCNL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7805	21.665785834933335	3	1623.886452	1623.883186	R	R	287	301
PSM	KKKDTAASGYGTQNI	418	sp|Q9Y314|NOSIP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5345	17.613883900266668	2	1580.819083	1580.815835	E	R	19	34
PSM	KKKMTGTLETQFTCPFCNHE	419	sp|P60002|ELOF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	4-UNIMOD:35,14-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=8477	22.791172108	4	2472.120299	2472.123587	P	K	13	33
PSM	RKDNAEAISGHSVEADPKEVEEEE	420	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7009	20.418548165866664	4	2667.228954	2667.225997	G	R	2742	2766
PSM	KAYVIGGLVDHNHH	421	sp|Q8TBZ6|TM10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7227	20.76	4	1558.8005	1558.8005	S	K	201	215
PSM	KDKLESEMEDAYHEHQANLL	422	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35	ms_run[2]:scan=8025	22.014	4	2415.1013	2415.1013	A	R	516	536
PSM	KDKLESEMEDAYHEHQANLL	423	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9514	25.316	4	2399.1063	2399.1063	A	R	516	536
PSM	KFIPHKDYTAN	424	sp|Q9BTE3-3|MCMBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5042	17.137	2	1332.6826	1332.6826	L	R	256	267
PSM	KGRPAPGFHHGDGPGNAVQEIMIPAS	425	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8784	23.289	4	2639.3027	2639.3027	E	K	170	196
PSM	KHKELAPYDENWFYT	426	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9635	25.849	3	1939.9105	1939.9105	A	R	41	56
PSM	KHLEINPDHPIVETL	427	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9005	23.729	3	1753.9363	1753.9363	K	R	624	639
PSM	KHPDEDAVEAEGHEVK	428	sp|Q9NY27-2|PP4R2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5032	17.121	4	1788.8279	1788.8279	N	R	174	190
PSM	KKHLEINPDHSIIETL	429	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8889	23.478	3	1886.0262	1886.0262	A	R	631	647
PSM	KLKEHEDYCGA	430	sp|O14545-2|TRAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=4161	15.591	2	1348.6082	1348.6082	L	R	101	112
PSM	KPRAEDSGEYHCVYHFVSAP	431	sp|Q9Y639-3|NPTN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4	ms_run[2]:scan=8470	22.783	4	2348.0644	2348.0644	N	K	91	111
PSM	KRGDQLLSVNGVSVEGEHHE	432	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7959	21.923	3	2189.0825	2189.0825	L	K	135	155
PSM	KSPYQEFTDHLVKTHT	433	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9016	23.759	4	1929.9585	1929.9585	T	R	263	279
PSM	KSVGKIEHSFW	434	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8394	22.654	3	1316.6877	1316.6877	I	R	374	385
PSM	KVSEHSGGRDLDSLH	435	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4856	16.87	4	1635.7965	1635.7965	K	R	299	314
PSM	KWIEQWIKDHNS	436	sp|Q9Y3D8-2|KAD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9360	24.765	3	1582.7892	1582.7892	L	-	158	170
PSM	KYHSDDYIKFL	437	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9385	24.844	3	1427.7085	1427.7085	T	R	66	77
PSM	RCHQGPIKPYQQG	438	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=4492	16.291	3	1567.7678	1567.7678	R	R	20	33
PSM	RDRDYSDHPSGGSY	439	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4648	16.541	3	1610.671	1610.6710	G	R	255	269
PSM	RERCEELLHFQASQ	440	sp|Q9Y6K9-3|NEMO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4	ms_run[2]:scan=8312	22.505	3	1801.853	1801.8530	L	R	73	87
PSM	RFHWEQDQIAHM	441	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8936	23.585	3	1596.7256	1596.7256	K	K	327	339
PSM	RHAPHCLSEEEGEQD	442	sp|O75190-3|DNJB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=4595	16.444	3	1792.7435	1792.7435	L	R	270	285
PSM	RHIEIRDQALSNAQA	443	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6908	20.267	3	1720.8969	1720.8969	R	K	570	585
PSM	RHKEPGSGSGGGVYWVDSQQ	444	sp|Q9NQT5-2|EXOS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7648	21.43	3	2129.9879	2129.9879	L	K	87	107
PSM	RHLADHGQLSGIQ	445	sp|O60783|RT14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5987	18.619	3	1430.7379	1430.7379	F	R	112	125
PSM	RHLADHGQLSGIQ	446	sp|O60783|RT14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5996	18.631	3	1430.7379	1430.7379	F	R	112	125
PSM	RHNGTGGKSIYGE	447	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4204	15.696	3	1374.664	1374.6640	T	K	69	82
PSM	RHNVFGLDLKDE	448	sp|Q13206|DDX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8988	23.693	3	1441.7314	1441.7314	K	K	640	652
PSM	RHPGSFDVVHV	449	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7888	21.796	3	1248.6364	1248.6364	E	K	200	211
PSM	RLHQIKQEEGMDLIN	450	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=6968	20.354	3	1838.9309	1838.9309	S	R	84	99
PSM	RLRDHDDAAESLIEQTTALN	451	sp|Q9NVK5-3|FGOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9488	25.206	3	2267.1142	2267.1142	E	K	18	38
PSM	RNKDHPAFAPLYFPMELH	452	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9944	27.269	4	2182.0782	2182.0782	E	R	58	76
PSM	RNVTKDHIMEIFSTYG	453	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=9393	24.882	3	1925.9305	1925.9305	T	K	133	149
PSM	RRILISLATGH	454	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8317	22.514	3	1235.7462	1235.7462	F	R	466	477
PSM	RRNEQLTLHDE	455	sp|Q96GA3|LTV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5370	17.648	3	1409.7011	1409.7011	M	R	251	262
PSM	RSWHDVQVSSAYK	456	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7364	20.975	3	1561.7637	1561.7637	S	K	72	85
PSM	RTMSAQIEGGVHGLHSYEK	457	sp|P20839-2|IMDH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=6604	19.721	4	2115.0167	2115.0167	K	R	468	487
PSM	RYAHQSGFHVD	458	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5644	18.075	3	1315.6058	1315.6058	T	R	70	81
PSM	RYHQIGSGKCEI	459	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=5797	18.308	3	1446.7038	1446.7038	S	K	175	187
PSM	KPSSSVTPRHPLEGTHEL	460	sp|Q8IWR0|Z3H7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6286	19.137046273333333	4	1972.042615	1971.017388	T	R	425	443
PSM	RKQEEHVTEPAPLVFDFDGHE	461	sp|P53675|CLH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9439	25.026096809600002	4	2480.179367	2479.176802	L	-	1620	1641
PSM	RHHGDVMDLQFFDQE	462	sp|Q8NFH3|NUP43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:35	ms_run[1]:scan=9289	24.510340006133333	3	1888.817483	1888.816246	I	R	72	87
PSM	RHLQLAIRNDEELN	463	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=11261	32.5268846616	3	1719.902990	1719.901630	P	K	82	96
PSM	RHLQLAIRNDEELN	464	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8108	22.1676470952	3	1720.887394	1719.901630	P	K	82	96
PSM	RHLQLAIRNDEELN	465	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=10440	29.384763900266666	3	1719.902962	1719.901630	P	K	82	96
PSM	RKFADIGNTVK	466	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6249	19.0826050592	3	1247.698742	1247.698620	D	K	313	324
PSM	RRQAVDVSPLR	467	sp|P46782|RS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6018	18.678720497066667	3	1295.741665	1295.742216	V	R	135	146
PSM	RRLGSVEAPKTN	468	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4695	16.611196179466667	2	1326.737283	1326.736797	K	K	54	66
PSM	RREPLSLINVR	469	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8486	22.803082392266667	3	1351.804667	1351.804817	D	K	64	75
PSM	RKFGFEIIETK	470	sp|Q9GZZ1|NAA50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8921	23.549502565333334	3	1366.761494	1366.760886	Y	K	125	136
PSM	RKPNEGADGQWK	471	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4208	15.704300324266667	3	1384.684757	1384.684761	I	K	309	321
PSM	RKQSEGLTKEYD	472	sp|P51572|BAP31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4570	16.410970809066665	3	1452.721451	1452.720872	M	R	213	225
PSM	KRFVSEAELDER	473	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6710	19.92665798	3	1477.754079	1477.752506	K	R	13	25
PSM	KRKGDEVDGVDEVA	474	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5245	17.46315313066667	2	1515.753969	1515.752900	G	K	207	221
PSM	KRDSVLTSKNQIE	475	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5436	17.7483512736	3	1516.822059	1516.820920	E	R	32	45
PSM	RKSGVGNVFIKNLD	476	sp|Q13310|PABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8427	22.710324761333332	3	1545.863626	1545.862726	L	K	94	108
PSM	RKKSPNELVDDLF	477	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9587	25.638267812533336	2	1559.833187	1559.830757	P	K	111	124
PSM	RKQDEWIKFDDD	478	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8749	23.230933678666666	3	1593.743053	1593.742336	K	K	442	454
PSM	RRLEESDVLQEAR	479	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7358	20.967390305066665	3	1599.833166	1599.832882	A	R	89	102
PSM	KRKTVTAMDVVYAL	480	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:35	ms_run[1]:scan=8931	23.5757313432	3	1609.886657	1609.886164	A	K	78	92
PSM	RKTVTAMDVVYALK	481	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:35	ms_run[1]:scan=8733	23.204531807466665	3	1609.887887	1609.886164	K	R	79	93
PSM	RRNTFELITVRPQ	482	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8771	23.269573054933335	3	1628.912279	1628.911073	A	R	1052	1065
PSM	KKMEGVTNAVLHEVK	483	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7538	21.251657184800003	4	1681.918316	1681.918526	W	R	408	423
PSM	RKSMYEEEINETR	484	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6513	19.554664331466665	3	1683.789379	1683.788634	F	R	208	221
PSM	KKMEGVTNAVLHEVK	485	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:35	ms_run[1]:scan=6688	19.883770864	4	1697.914224	1697.913441	W	R	408	423
PSM	RRGGDGQINEQVEKL	486	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7154	20.6456426792	3	1698.879128	1697.880895	D	R	350	365
PSM	RRDDSTKLELALTGGEA	487	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9034	23.804721568533335	3	1830.945794	1830.943555	T	K	124	141
PSM	KKIRLESEEEGVPSTAI	488	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7932	21.887694769866666	3	1885.015952	1885.015657	M	R	33	50
PSM	KKRDQEQVELEGESSAPP	489	sp|Q9BW61|DDA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6384	19.3210721368	3	2026.000404	2025.996713	A	R	70	88
PSM	KKHSQFIGYPITLFVEKE	490	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=9812	26.702412920266667	4	2163.174371	2163.172827	V	R	208	226
PSM	KAKHLAAVEE	491	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4078	15.382	2	1094.6084	1094.6084	T	R	880	890
PSM	KHKDVAEEIANY	492	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7842	21.724	3	1415.7045	1415.7045	K	R	772	784
PSM	KHKEQNNDSQL	493	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3684	14.835	2	1339.648	1339.6480	A	K	898	909
PSM	KHKLPNQGED	494	sp|Q9BQP7|MGME1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3596	14.742	2	1164.5887	1164.5887	S	R	84	94
PSM	KKLYTGPGLAIHCMQVH	495	sp|O43670-2|ZN207_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4,14-UNIMOD:35	ms_run[2]:scan=7455	21.116	3	1968.0074	1968.0074	H	K	42	59
PSM	KKNYVHFAATQVQN	496	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6722	19.947	3	1646.8529	1646.8529	E	R	333	347
PSM	KLKDYAFIHFDE	497	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9504	25.277	3	1524.7613	1524.7613	K	R	217	229
PSM	KLRAFHNEAQVNPE	498	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6093	18.829	3	1651.8431	1651.8431	A	R	466	480
PSM	KPRHQEGEIFDTE	499	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6720	19.943	3	1584.7532	1584.7532	R	K	224	237
PSM	KPVTYEEAHAPHYIAH	500	sp|Q96EL2|RT24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6375	19.299	3	1861.9111	1861.9111	D	R	49	65
PSM	KRLYSLALHPNAF	501	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9044	23.828	3	1528.8514	1528.8514	F	K	1061	1074
PSM	KSPYQEFTDHLVKTHT	502	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9057	23.855	4	1929.9585	1929.9585	T	R	263	279
PSM	KVRFHPASVLSQPQY	503	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8429	22.714	3	1755.942	1755.9420	K	K	1000	1015
PSM	RAVFHEEEQR	504	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4425	16.177	3	1299.632	1299.6320	P	R	473	483
PSM	RCLLLHPAGHAEPAAGSH	505	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=6131	18.874	3	1892.9428	1892.9428	D	R	38	56
PSM	RFAGHSEAGGGSGDR	506	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3583	14.73	3	1459.6553	1459.6553	G	R	137	152
PSM	RHGANPDLRDEDG	507	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3995	15.214	3	1450.6549	1450.6549	L	K	448	461
PSM	RHHGDVMDLQFFDQE	508	sp|Q8NFH3-2|NUP43_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9836	26.811	3	1872.8213	1872.8213	I	R	72	87
PSM	RHLEFSHDQY	509	sp|Q9NR45|SIAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6804	20.087	2	1330.6054	1330.6054	K	R	86	96
PSM	RHLHPIQTSFQEATAS	510	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7552	21.276	3	1821.9122	1821.9122	A	K	1560	1576
PSM	RHLSLCHGLSDLA	511	sp|Q9P2I0|CPSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=8591	22.973	3	1477.746	1477.7460	F	R	306	319
PSM	RHLVYESDQNKDG	512	sp|O43852-9|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4599	16.45	2	1559.7328	1559.7328	A	K	110	123
PSM	RHNSTTSSTSSGGYR	513	sp|Q8IZP0-2|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3475	14.615	3	1596.7241	1596.7241	S	R	287	302
PSM	RHSHAVSTAAMT	514	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=3506	14.65	2	1283.6041	1283.6041	G	R	1163	1175
PSM	RIHVIDHSGA	515	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4936	16.981	2	1103.5836	1103.5836	C	R	33	43
PSM	RIINEPTAAAIAYGLDK	516	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9604	25.716	3	1814.989	1814.9890	L	K	171	188
PSM	RKAESGWFHVEED	517	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8469	22.78	3	1588.727	1588.7270	K	R	118	131
PSM	RKAHSPFYQEGVSNALL	518	sp|Q9NWX5-2|ASB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9083	23.924	3	1915.9904	1915.9904	E	K	58	75
PSM	RLLLEGISSTHAHHL	519	sp|Q9Y371-3|SHLB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8449	22.747	3	1682.9216	1682.9216	T	R	110	125
PSM	RPGLSSLPPRGPHHLDNSSPGPGSEA	520	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7091	20.545	3	2618.295	2618.2950	G	R	373	399
PSM	RQRNGVMPSHFS	521	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5839	18.373	2	1414.6888	1414.6888	G	R	82	94
PSM	RRGHVTQDAPIPGSPLYTI	522	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9152	24.112	3	2077.1069	2077.1069	R	K	818	837
PSM	RRVDPVYIHLAE	523	sp|Q13085-2|ACACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8521	22.855	3	1466.7994	1466.7994	M	R	2080	2092
PSM	RSKAGLAYHL	524	sp|Q96ME7-2|ZN512_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7106	20.575	3	1114.6247	1114.6247	Y	R	220	230
PSM	RSKEGSIWNHQPCFL	525	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4	ms_run[2]:scan=9287	24.504	3	1857.8944	1857.8944	E	K	95	110
PSM	RTHNDIIHNENM	526	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5783	18.277	2	1492.6841	1492.6841	K	R	547	559
PSM	RTVRDSDSGLEQMSIGHHI	527	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:35	ms_run[2]:scan=6900	20.256	4	2153.0284	2153.0284	R	R	139	158
PSM	RVHHFYPSLPTPLL	528	sp|A8CG34|P121C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9756	26.435	3	1675.9198	1675.9198	H	R	170	184
PSM	RVHHPDYNNELTQFLP	529	sp|Q5EBL8|PDZ11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9785	26.573	3	1978.965	1978.9650	E	R	30	46
PSM	RVLHHQGQQLDSVM	530	sp|Q5SQN1-2|SNP47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:35	ms_run[2]:scan=5143	17.286	3	1662.826	1662.8260	A	R	183	197
PSM	RYGIKPEWMMIH	531	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=9089	23.939	3	1575.769	1575.7690	Y	R	614	626
PSM	RYHVLVNLGK	532	sp|O75643-2|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7736	21.558	2	1197.6982	1197.6982	T	K	168	178
PSM	VKLDIHTLAHHL	533	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8983	23.682	3	1395.7987	1395.7987	M	K	2	14
PSM	KHASGGSTVHIHPQAAPVVC	534	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	20-UNIMOD:4	ms_run[1]:scan=6110	18.8501502016	3	2052.033449	2052.032327	E	R	3314	3334
PSM	RSPVVGFDPHHHM	535	sp|Q04727|TLE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:35	ms_run[1]:scan=5975	18.596903980533334	4	1530.713480	1530.715016	G	R	418	431
PSM	KSLQQVDEHSKPPHL	536	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6273	19.1152505576	4	1742.916761	1741.911132	N	R	605	620
PSM	KAVHLQGHEGPVYAVHAVYQ	537	sp|Q6IA86|ELP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7915	21.848826299200002	4	2203.138920	2202.133421	L	R	99	119
PSM	RHLQLAIRNDEELN	538	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10283	28.706328826133333	3	1719.902962	1719.901630	P	K	82	96
PSM	RHLQLAIRNDEELN	539	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11350	32.86416994026667	3	1719.902990	1719.901630	P	K	82	96
PSM	RKSAPATGGVK	540	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3350	14.464148072	3	1070.620543	1070.619642	A	K	27	38
PSM	RKGGPDDRGF	541	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4415	16.152005648266666	3	1103.547894	1103.547205	F	R	129	139
PSM	KRLQSIGTENTEENR	542	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4724	16.676137532800002	3	1774.901254	1773.896939	A	R	42	57
PSM	KKKETITESAG	543	sp|Q9UM00|TMCO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3627	14.775245808266668	2	1190.652009	1190.650667	E	R	103	114
PSM	RKFADGEVVRG	544	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5238	17.451803201333334	3	1232.662474	1232.662569	S	R	4	15
PSM	KKKEAGGGGVGGPGA	545	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3459	14.595724135733333	3	1268.683997	1268.683699	N	K	37	52
PSM	RKLDLNQEEK	546	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4755	16.7276728736	3	1271.687538	1271.683364	K	K	246	256
PSM	KKKDAIDPLLF	547	sp|Q9NRL2|BAZ1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9374	24.80777116293333	2	1286.761818	1286.759824	G	K	180	191
PSM	RRLSSEVEALR	548	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6991	20.386754606666667	3	1314.736202	1314.736797	L	R	1655	1666
PSM	RRSAQDGPAPAEK	549	sp|Q9BQ52|RNZ2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3432	14.568807793866666	3	1381.705304	1381.706225	Y	R	464	477
PSM	RRAPFDLFENK	550	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9107	23.986053752266667	3	1391.731464	1391.730983	P	K	279	290
PSM	RRPTLGVQLDDK	551	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7066	20.500687162933332	3	1396.778759	1396.778662	R	R	325	337
PSM	RIRVMLYPSRI	552	sp|P18077|RL35A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8887	23.473190446933334	3	1402.822696	1402.823109	H	-	100	111
PSM	RKIIDSVRGELQ	553	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7789	21.634381773333335	3	1412.812406	1412.809962	L	K	2285	2297
PSM	RKLDELYGTWR	554	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8658	23.089932667733333	3	1435.760195	1435.757198	F	K	258	269
PSM	RKAAALEAMKDYT	555	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7744	21.570103110933335	3	1466.756785	1466.755149	T	K	433	446
PSM	RKAAALEAMKDYT	556	sp|P31948|STIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:35	ms_run[1]:scan=5097	17.209186129866666	3	1482.751309	1482.750064	T	K	433	446
PSM	RRVAEELALEQAK	557	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7176	20.6792214184	3	1511.842721	1511.841990	K	K	64	77
PSM	KKKELEEEVNNFQ	558	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7061	20.491968519466663	3	1633.831291	1633.831151	D	K	384	397
PSM	KKLPQVEHVLPLLK	559	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8874	23.451515636	4	1641.035039	1641.034148	D	R	436	450
PSM	KKIADDKYNDTFW	560	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8766	23.2614105776	3	1642.800390	1642.799122	I	K	473	486
PSM	RKAAYWEEEPAEVR	561	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7619	21.38130862346667	3	1733.882558	1732.853283	I	R	328	342
PSM	RKKEPELFQTVAEGL	562	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9583	25.61722643466667	3	1743.953161	1743.951935	R	R	11	26
PSM	RKMAQELYMEQKNE	563	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6880	20.222957764	3	1796.852409	1796.854939	Y	R	761	775
PSM	RRDVYLSPRDDGYST	564	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7065	20.499506014933335	3	1798.859962	1798.859825	S	K	202	217
PSM	KKKNGNYCVLQMDQSY	565	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	8-UNIMOD:4	ms_run[1]:scan=8322	22.52425085546667	3	1974.929996	1974.929167	S	K	356	372
PSM	RKKDASDDLDDLNFFNQ	566	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9828	26.77444987386667	3	2040.957414	2039.954848	T	K	62	79
PSM	KKKMQQNIQELEEQLEEEESA	567	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:35	ms_run[1]:scan=9448	25.062282045333333	4	2576.229893	2576.227577	E	R	938	959
PSM	KRSEAEEAITSFNGHKPPGSSEPITV	568	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8901	23.501815204266666	4	2767.381662	2767.377687	D	K	156	182
PSM	RKKPVFQPVHPIQPIQMPAFTTVQ	569	sp|Q9H9A5|CNO10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:35	ms_run[1]:scan=9060	23.86513576586667	4	2802.540924	2802.536711	V	R	719	743
PSM	KAFVDFLSDEIKEE	570	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10190	28.302	3	1668.8247	1668.8247	D	R	80	94
PSM	KCSVIRDSLLQDGEFSMDL	571	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=9873	26.971	3	2228.0453	2228.0453	Q	R	70	89
PSM	KFHNELNAHI	572	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7231	20.766	3	1221.6255	1221.6255	E	K	274	284
PSM	KHASGGSTVHIHPQAAPVVC	573	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:4	ms_run[2]:scan=6102	18.841	3	2052.0323	2052.0323	E	R	3298	3318
PSM	KKVSYSHIQS	574	sp|P27816-4|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4128	15.502	2	1175.6299	1175.6299	S	K	717	727
PSM	KLRFPAEDEFPDLSAHNNHMA	575	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:35	ms_run[2]:scan=9261	24.413	4	2454.1386	2454.1386	L	K	11	32
PSM	KSPDDPSRYISPDQLADLY	576	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10042	27.679	3	2179.0433	2179.0433	F	K	169	188
PSM	KTEHASGIGDHSQHGPGWTLL	577	sp|Q8TEU7|RPGF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8793	23.305	4	2227.077	2227.0770	E	K	1309	1330
PSM	KTRQTWLLLHMYDSD	578	sp|Q9BRJ6|CG050_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=9280	24.483	3	1921.9356	1921.9356	Q	K	120	135
PSM	KTSHTVKWEGVW	579	sp|Q9Y512|SAM50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8806	23.327	3	1456.7463	1456.7463	W	R	221	233
PSM	KTVTAMDVVYALK	580	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9861	26.921	3	1437.7901	1437.7901	R	R	80	93
PSM	KVKALLSHDSGSDHLAFV	581	sp|Q7L2E3-3|DHX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8679	23.122	4	1923.0214	1923.0214	D	R	884	902
PSM	KVVLDDKDYFLF	582	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10258	28.598	2	1500.7864	1500.7864	T	R	80	92
PSM	RAIWSQPELAYEEHHAH	583	sp|Q8IYS1|P20D2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8502	22.826	4	2072.9817	2072.9817	S	R	43	60
PSM	RCEDRPVVFTHLLTADHGPP	584	sp|Q6P1X6-2|CH082_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=9298	24.54	4	2316.1433	2316.1433	L	R	98	118
PSM	RDCHHLGIQNNFDY	585	sp|Q9Y3Z3-4|SAMH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=8519	22.852	3	1787.7798	1787.7798	A	K	318	332
PSM	RDCHHLGIQNNFDY	586	sp|Q9Y3Z3-4|SAMH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=8526	22.864	3	1787.7798	1787.7798	A	K	318	332
PSM	RENYSHHTQDD	587	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3384	14.511	3	1400.5705	1400.5705	Q	R	150	161
PSM	RFHQLHGSNAVITNGG	588	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6176	18.948	3	1706.8601	1706.8601	L	R	718	734
PSM	RHDGKEVDEGAWET	589	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6504	19.541	3	1627.7227	1627.7227	S	K	181	195
PSM	RHITESVNSIR	590	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5428	17.739	3	1310.7055	1310.7055	R	R	1060	1071
PSM	RHKLVSDGQALPEMEIHLQTNAE	591	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35	ms_run[2]:scan=8278	22.448	4	2631.3075	2631.3075	L	K	75	98
PSM	RHLEQRDEPQEPSN	592	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3855	15.024	3	1733.8081	1733.8081	E	K	1623	1637
PSM	RHLQLAIRNDEELN	593	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10129	28.035	3	1719.9016	1719.9016	P	K	82	96
PSM	RHSLASSEYPVR	594	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5561	17.942	3	1400.7161	1400.7161	V	R	228	240
PSM	RIGHHSTSDDSSAY	595	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3980	15.19	3	1531.6651	1531.6651	Y	R	332	346
PSM	RIHAEIKNSL	596	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6291	19.144	3	1179.6724	1179.6724	Q	K	354	364
PSM	RIHSDTFASGGERA	597	sp|Q15750|TAB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5158	17.308	3	1502.7226	1502.7226	K	R	336	350
PSM	RILQHFHSES	598	sp|Q8NB37|GALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5595	17.989	2	1252.6313	1252.6313	A	K	109	119
PSM	RKHIMGQNVADYM	599	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=5106	17.228	3	1593.7392	1593.7392	H	R	196	209
PSM	RKHLVESTNEMAPL	600	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=6285	19.136	3	1639.8352	1639.8352	L	K	281	295
PSM	RKHPAPPPSNYEILV	601	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8535	22.876	3	1716.9311	1716.9311	L	K	659	674
PSM	RLGNDFHTNK	602	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4656	16.548	3	1200.6	1200.6000	T	R	23	33
PSM	RLHISQLQHENSIL	603	sp|Q14203-3|DCTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8767	23.264	3	1686.9166	1686.9166	M	K	1059	1073
PSM	RLKSFFEGHF	604	sp|P57678|GEMI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9231	24.328	3	1266.6509	1266.6509	L	K	773	783
PSM	RMVNHFIAEFK	605	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=8216	22.351	3	1406.7129	1406.7129	N	R	236	247
PSM	RNHNNKDENPCFLYL	606	sp|Q9H8K7|PAAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:4	ms_run[2]:scan=9266	24.431	3	1932.8901	1932.8901	K	R	63	78
PSM	RNKNFNIHGTN	607	sp|P15586-2|GNS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4657	16.551	3	1313.6589	1313.6589	P	K	235	246
PSM	RPRHQGVMVGMGQ	608	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=4337	16.024	3	1467.7187	1467.7187	G	K	37	50
PSM	RPRQLSISHF	609	sp|Q8WVM0|TFB1M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7634	21.405	3	1239.6836	1239.6836	L	K	291	301
PSM	RPSHLTNKFED	610	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5327	17.577	3	1342.663	1342.6630	F	K	207	218
PSM	RRESLAEEHEGLVGEGQ	611	sp|Q10570|CPSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6682	19.873	3	1894.9133	1894.9133	F	R	165	182
PSM	RRFQGVSLPVHL	612	sp|Q9NYK5|RM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9361	24.768	3	1407.8099	1407.8099	I	R	295	307
PSM	RRYNIPHGPVVGST	613	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7392	21.018	3	1551.827	1551.8270	L	R	17	31
PSM	RSISLYYTGEKGQNQDY	614	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8554	22.911	3	2020.949	2020.9490	G	R	457	474
PSM	RSKVDEAVAVLQAHHA	615	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8612	23.021	4	1729.9224	1729.9224	L	K	600	616
PSM	RSTKHWELTAEGEEIA	616	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8360	22.592	3	1855.9064	1855.9064	L	R	56	72
PSM	RTVGPRLDHE	617	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4820	16.81	3	1178.6156	1178.6156	M	R	259	269
PSM	RVHHEPQLSD	618	sp|O43852-9|CALU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4255	15.839	2	1216.5949	1216.5949	D	K	27	37
PSM	RVHHFYPSLPTPLL	619	sp|A8CG34|P121C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9760	26.453	3	1675.9198	1675.9198	H	R	170	184
PSM	RVKDLESLFH	620	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9218	24.294	3	1242.6721	1242.6721	G	R	148	158
PSM	RWRPEDAEEAEH	621	sp|Q14493|SLBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6208	19.003	3	1523.6753	1523.6753	R	R	39	51
PSM	RDSLVHSSPHVALSHVDA	622	sp|Q9P2B2|FPRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7321	20.903574081600002	3	1926.948324	1925.970773	D	R	336	354
PSM	RGQHHQQQQAAGGSESHPVPPTAPLTPLLHGEGASQQP	623	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8497	22.817686434933332	5	3931.936262	3929.926958	H	R	266	304
PSM	RKAVAEELAK	624	sp|Q969Z0|FAKD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4383	16.09447674	3	1113.650665	1113.650607	M	-	622	632
PSM	RKVTLSTDKN	625	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3795	14.958417585866666	3	1160.650958	1160.651336	V	K	877	887
PSM	KKLEDGPKFL	626	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7646	21.427441609066666	3	1173.675866	1173.675760	G	K	385	395
PSM	KRYEMLQDNVEGYR	627	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7926	21.8777114	3	1799.861841	1799.862468	S	R	723	737
PSM	KRVLLGETGKE	628	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5139	17.280075242133332	3	1228.714530	1228.713936	K	K	21	32
PSM	RKIVDQIRPD	629	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5759	18.243760374666667	2	1238.710452	1238.709519	I	R	340	350
PSM	RKIVDQIRPD	630	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5766	18.253468820000002	2	1238.710452	1238.709519	I	R	340	350
PSM	RKIYTNVKID	631	sp|Q9HD45|TM9S3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6343	19.2360748056	3	1248.718496	1248.719021	V	-	580	590
PSM	RKALELDQER	632	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5317	17.564310756266664	3	1256.682738	1256.683699	T	K	370	380
PSM	RKALELDQER	633	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5330	17.579254522933336	3	1256.682738	1256.683699	T	K	370	380
PSM	RKAASLTEDRD	634	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3793	14.957046772266667	3	1260.642175	1260.642228	L	R	1205	1216
PSM	KKNTKDEFEE	635	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4194	15.672519086666666	2	1266.607685	1266.609196	Q	R	780	790
PSM	KKNKEEAAEYA	636	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3910	15.0812396512	2	1279.642018	1279.640831	T	K	200	211
PSM	RRALELEQER	637	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5667	18.10623228213333	3	1298.705902	1298.705497	T	K	370	380
PSM	RKILGKNEETL	638	sp|P82663|RT25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6214	19.011538665600003	3	1299.751322	1299.751050	I	R	103	114
PSM	RKLLEEERDQ	639	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4822	16.8133117536	3	1314.690222	1314.689178	L	R	3154	3164
PSM	KRNEFLGELQK	640	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7765	21.597513215200003	3	1360.747816	1360.746299	A	K	326	337
PSM	RKYELGRPAANT	641	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5263	17.493292670933332	3	1374.736574	1374.736797	K	K	25	37
PSM	RKADGYNQPDSK	642	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3503	14.645561241866666	3	1377.664930	1377.663691	K	R	565	577
PSM	KKVKLQNILSQL	643	sp|Q86WJ1|CHD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9558	25.5014312552	3	1410.892700	1410.892235	A	R	307	319
PSM	RKSDGIYIINLK	644	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8867	23.439743210133333	3	1418.825066	1418.824549	K	R	41	53
PSM	RRSINQPVAFVR	645	sp|Q9GZT3|SLIRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7216	20.746771444533334	3	1441.827216	1441.826615	L	R	13	25
PSM	RRQVDQLTNDKA	646	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4631	16.5125931528	2	1442.759575	1442.758989	L	R	158	170
PSM	RKLFNLSKEDDV	647	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8079	22.102111952799998	3	1462.777722	1462.777993	I	R	142	154
PSM	RKKQLAEQEELE	648	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5180	17.341985402133332	2	1499.796886	1499.794371	L	R	327	339
PSM	RKQKGSEENLDEA	649	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3927	15.1022478536	2	1502.733958	1502.732499	E	R	581	594
PSM	KRPKISFSNIISDM	650	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:35	ms_run[1]:scan=9010	23.743884877333336	3	1650.877456	1650.876327	A	K	195	209
PSM	KKNKDLQITCDSLN	651	sp|Q8TCG1|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4	ms_run[1]:scan=6801	20.08277336613333	3	1675.857419	1675.856320	E	K	743	757
PSM	RKVKLDYEEVGACQ	652	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:4	ms_run[1]:scan=7096	20.559601409600003	3	1693.845207	1693.845755	S	K	873	887
PSM	RRDLIQDQNMDEKG	653	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=4861	16.874144925333333	3	1732.816441	1732.816246	T	K	125	139
PSM	RRKDSAIQQQVANLQM	654	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	16-UNIMOD:35	ms_run[1]:scan=7488	21.165639083200002	3	1900.994245	1900.990128	M	K	1226	1242
PSM	RKRPDEVPDDDEPAGPM	655	sp|Q9Y639|NPTN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	17-UNIMOD:35	ms_run[1]:scan=5401	17.693786980533332	3	1938.873823	1938.874155	K	K	363	380
PSM	KKLGELTGTVKESLHEVS	656	sp|O43615|TIM44_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8376	22.624468941866667	4	1954.076354	1954.073506	R	K	120	138
PSM	RKRSELSQDAEPAGSQET	657	sp|Q9BVJ6|UT14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4529	16.347306381066666	3	1987.959384	1987.955910	L	K	431	449
PSM	RKKDASDDLDDLNFFNQ	658	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9844	26.845299425333334	3	2040.945983	2039.954848	T	K	62	79
PSM	RKYAALYQPLFDK	659	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9056	23.853552528799998	3	1612.880937	1611.877313	E	R	93	106
PSM	KRRNVSSFPDDATSPLQEN	660	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7960	21.924798580799997	3	2160.058124	2160.055959	L	R	49	68
PSM	KRRNVSSFPDDATSPLQEN	661	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7740	21.563367643733333	3	2160.058124	2160.055959	L	R	49	68
PSM	KKKDQVTAQEIFQDNHEDGPTA	662	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7976	21.949073564266666	4	2498.201703	2498.203745	A	K	543	565
PSM	KEQSIFGDHRDEEEETHM	663	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7483	21.159	4	2215.944	2215.9440	L	K	252	270
PSM	KHHNQPYCGIAPYI	664	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=8775	23.275	3	1696.8144	1696.8144	E	R	32	46
PSM	KHHPNALNLQL	665	sp|Q9H1A4|APC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8507	22.835	2	1283.7099	1283.7099	C	R	29	40
PSM	KHKGYGFIEYE	666	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8348	22.563	2	1369.6667	1369.6667	G	K	205	216
PSM	KHKLDVTSVEDY	667	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7656	21.445	3	1432.7198	1432.7198	T	K	170	182
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	668	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	25-UNIMOD:4	ms_run[2]:scan=10040	27.671	3	2790.3218	2790.3218	L	K	91	118
PSM	KIYHPNVDKLG	669	sp|P61088|UBE2N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6621	19.755	3	1282.7034	1282.7034	T	R	74	85
PSM	KKAHLGTAL	670	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4886	16.906	2	937.5709	937.5709	Y	K	28	37
PSM	KKSAEFLLHML	671	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9685	26.084	3	1315.7322	1315.7322	P	K	47	58
PSM	KLKHTENTFS	672	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4210	15.708	2	1203.6248	1203.6248	H	R	241	251
PSM	KLLHHVTEE	673	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4454	16.219	2	1104.5928	1104.5928	E	K	136	145
PSM	KNRHGLVPFAFV	674	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9667	26.002	3	1383.7775	1383.7775	L	R	46	58
PSM	KNSKHECTLSSQEYVHEL	675	sp|O60879-2|DIAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:4	ms_run[2]:scan=7627	21.394	4	2188.0219	2188.0219	L	R	153	171
PSM	KPIRPGQHPAASPTHPSAI	676	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5293	17.528	4	1961.0595	1961.0595	A	R	922	941
PSM	KQNWLHSYFH	677	sp|Q9NUW8-2|TYDP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9041	23.823	3	1358.652	1358.6520	E	K	230	240
PSM	KRILNFLMHP	678	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9373	24.804	3	1267.7223	1267.7223	V	K	143	153
PSM	KRQYLLLHSL	679	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8866	23.437	3	1269.7557	1269.7557	P	K	736	746
PSM	KSALDPTPKHECHVS	680	sp|Q9UK61-3|TASOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=4070	15.357	3	1704.8254	1704.8254	N	K	266	281
PSM	KSVGKIEHSFW	681	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8430	22.715	2	1316.6877	1316.6877	I	R	374	385
PSM	KVHAEQVLNDKESHI	682	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6386	19.325	4	1745.906	1745.9060	S	K	212	227
PSM	KYFLHDDRDDGVDYWA	683	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9451	25.073	3	2013.8857	2013.8857	K	K	672	688
PSM	KYGFNEGHSFR	684	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6930	20.296	3	1340.6262	1340.6262	P	R	80	91
PSM	KYHTINGHNAEV	685	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4932	16.978	3	1381.6739	1381.6739	Q	R	161	173
PSM	RAGGHHNDLEDVG	686	sp|Q5JTZ9|SYAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4956	17.013	2	1375.6229	1375.6229	V	R	110	123
PSM	RDHLGEGLADSR	687	sp|Q2M1P5|KIF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5680	18.124	3	1324.6484	1324.6484	S	R	1172	1184
PSM	RDKFESSFSH	688	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6023	18.689	3	1238.568	1238.5680	A	K	168	178
PSM	REHDIAIKFFQ	689	sp|P30260|CDC27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9288	24.507	3	1402.7357	1402.7357	Q	R	581	592
PSM	REHTSHLEAELE	690	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6357	19.258	3	1449.6848	1449.6848	V	K	1195	1207
PSM	REKFGSFLCH	691	sp|Q5VUA4|ZN318_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=8316	22.512	3	1279.6132	1279.6132	L	K	467	477
PSM	RGAKEEHGGLI	692	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5110	17.233	3	1165.6204	1165.6204	T	R	67	78
PSM	RGGKICLTDHF	693	sp|Q9Y3C8|UFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4	ms_run[2]:scan=7996	21.974	3	1302.6503	1302.6503	Y	K	111	122
PSM	RHEALLYTWLAEH	694	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9958	27.327	3	1637.8314	1637.8314	V	K	2576	2589
PSM	RHEHQVMLM	695	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=4182	15.642	2	1211.5539	1211.5539	A	R	215	224
PSM	RHGSLGFLPR	696	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7848	21.732	3	1138.636	1138.6360	P	K	10	20
PSM	RHLQLAIRNDEELN	697	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9731	26.302	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	698	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9966	27.357	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	699	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10047	27.698	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	700	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10206	28.372	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	701	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10676	30.398	3	1719.9016	1719.9016	P	K	82	96
PSM	RHSLLQTLYKV	702	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9163	24.147	3	1356.7878	1356.7878	A	-	577	588
PSM	RHSVVAGGGGGEGR	703	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3576	14.722	3	1294.649	1294.6490	K	K	961	975
PSM	RHVFLTGPPGVGKTTLIH	704	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8594	22.984	4	1929.0949	1929.0949	A	K	3	21
PSM	RIPHLAIHLQ	705	sp|Q9ULA0-2|DNPEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8731	23.201	3	1196.7142	1196.7142	L	R	163	173
PSM	RIQNWHEEH	706	sp|P35241-4|RADI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4838	16.836	2	1247.5796	1247.5796	E	R	35	44
PSM	RIRNGENGIHFLLN	707	sp|Q12849-5|GRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9081	23.92	3	1651.8907	1651.8907	C	R	12	26
PSM	RKDLYANTVLSGGTTMYPGIAD	708	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:35	ms_run[2]:scan=9465	25.123	3	2358.1526	2358.1526	I	R	290	312
PSM	RKDYLAHSSMDF	709	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=7086	20.532	3	1484.6718	1484.6718	G	-	611	623
PSM	RKFNILGTHT	710	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7587	21.331	3	1185.6618	1185.6618	F	K	378	388
PSM	RKHIMGQNVADYM	711	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=6442	19.419	3	1577.7443	1577.7443	H	R	196	209
PSM	RKHIMGQNVADYM	712	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=7360	20.971	3	1577.7443	1577.7443	H	R	196	209
PSM	RLDHLAEKF	713	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7666	21.457	2	1127.6087	1127.6087	E	R	391	400
PSM	RLHFTIKDPAN	714	sp|P10253|LYAG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7942	21.899	3	1310.7095	1310.7095	N	R	178	189
PSM	RLHGGKDSASP	715	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3465	14.603	2	1123.5734	1123.5734	T	R	793	804
PSM	RLHIFSGAHGPE	716	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7611	21.368	3	1319.6735	1319.6735	G	K	33	45
PSM	RLHTGEKPYEC	717	sp|P17039|ZNF30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4	ms_run[2]:scan=4481	16.262	3	1388.6507	1388.6507	G	K	392	403
PSM	RLHVENEDK	718	sp|P48444-2|COPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3828	14.995	2	1138.5731	1138.5731	I	K	226	235
PSM	RLLHVIEDRD	719	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7201	20.727	2	1264.6888	1264.6888	L	R	1785	1795
PSM	RLLPHKVFEGN	720	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7240	20.778	3	1308.7303	1308.7303	E	R	461	472
PSM	RLVNHFVEEFK	721	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8656	23.086	3	1416.7514	1416.7514	N	R	181	192
PSM	RMLHDYIGDKDF	722	sp|A6NEC2-2|PSAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=8304	22.494	3	1524.7031	1524.7031	I	K	231	243
PSM	RMLHDYIGDKDF	723	sp|A6NEC2-2|PSAL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8690	23.144	3	1508.7082	1508.7082	I	K	231	243
PSM	RNHPSFYVFNH	724	sp|Q8N4V1|MMGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8513	22.842	3	1416.6687	1416.6687	L	R	85	96
PSM	RNTLFGTFHVAHSSSLDDVDH	725	sp|Q13586-2|STIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9145	24.087	4	2354.104	2354.1040	K	K	387	408
PSM	RNVTKDHIMEIFSTYG	726	sp|Q15287-3|RNPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9834	26.803	3	1909.9356	1909.9356	T	K	133	149
PSM	RPAVKQFHDS	727	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4220	15.742	3	1183.6098	1183.6098	R	K	139	149
PSM	RQDPAHPHVVATGGKENAL	728	sp|Q6RFH5-2|WDR74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5767	18.255	4	1996.0239	1996.0239	M	K	137	156
PSM	RQKQLLDMHF	729	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9059	23.862	3	1314.6867	1314.6867	F	K	205	215
PSM	RRILTDYGFEGHPF	730	sp|O75489|NDUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9355	24.747	3	1706.8529	1706.8529	L	R	185	199
PSM	RSKSAVLHSQSSSSSS	731	sp|Q86WJ1-5|CHD1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3539	14.686	3	1633.802	1633.8020	P	R	596	612
PSM	RSNVRWDHESVC	732	sp|O95232-2|LC7L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=6276	19.12	2	1543.695	1543.6950	K	K	24	36
PSM	RSVHYCPATK	733	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4	ms_run[2]:scan=3861	15.031	3	1217.5975	1217.5975	V	K	143	153
PSM	RTDDHHGTEEPKQDTNV	734	sp|Q9Y2X9-2|ZN281_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3727	14.88	3	1977.8777	1977.8777	S	K	166	183
PSM	RTHNDIIHNENM	735	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:35	ms_run[2]:scan=4196	15.679	3	1508.679	1508.6790	K	R	547	559
PSM	RTRNLESNHPGQTGGFV	736	sp|Q5HYK7-3|SH319_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6624	19.76	3	1868.9242	1868.9242	E	R	265	282
PSM	RYNHSHDQLVLTGSSDS	737	sp|Q53HC9|EIPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6649	19.805	3	1914.882	1914.8820	V	R	279	296
PSM	RYPDHSVDR	738	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3765	14.922	2	1143.5421	1143.5421	G	R	687	696
PSM	RYTEHKDIPLGI	739	sp|Q8TAT6|NPL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8331	22.538	3	1440.7725	1440.7725	G	R	255	267
PSM	KHGYIPGKN	740	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4130	15.5076166536	2	1012.546468	1012.545414	L	R	391	400
PSM	REEILANGGSLSHHHGVG	741	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6999	20.401760814666666	3	1869.905608	1868.924157	A	K	603	621
PSM	REKVTQLLPQNVHSHNSIS	742	sp|Q9UNY4|TTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7493	21.17578273253333	4	2187.160297	2186.155613	L	K	255	274
PSM	KAELIKTHHNDTELI	743	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7252	20.7988477384	3	1761.962790	1760.942098	G	R	384	399
PSM	RNKDHPAFAPLYFPMELH	744	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9958	27.3272795912	4	2182.080088	2182.078215	E	R	87	105
PSM	RHHCPNTPIILVGT	745	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4	ms_run[1]:scan=8326	22.530761464	3	1615.879893	1613.846030	V	K	102	116
PSM	KKMEGVTNAVLHEVK	746	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7518	21.215580355733334	4	1681.918316	1681.918526	W	R	408	423
PSM	RKYTELQLEAAK	747	sp|Q5T8P6|RBM26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6952	20.33077816693333	3	1448.802309	1448.798728	R	R	836	848
PSM	KKKALTSFE	748	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5528	17.887885749333336	2	1050.608107	1050.607346	V	R	413	422
PSM	RKSAPSTGGVK	749	sp|P84243|H33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3351	14.465346100266666	3	1086.617110	1086.614556	A	K	27	38
PSM	KKKEDDVGIE	750	sp|Q5T200|ZC3HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4256	15.8408307424	2	1159.609445	1159.608468	K	R	969	979
PSM	RKFAADAVKLE	751	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7171	20.672475618933333	3	1246.703458	1246.703371	I	R	313	324
PSM	RREDLVEEIK	752	sp|P12081|HARS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7193	20.7104587848	3	1285.699505	1285.699014	V	R	490	500
PSM	RKNPAAYENDK	753	sp|O14949|QCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3691	14.8416540256	3	1304.647850	1304.647313	K	-	72	83
PSM	RKVLEEEEQR	754	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4045	15.306444388266668	3	1314.686234	1314.689178	R	R	576	586
PSM	KRLEFLYDKL	755	sp|O94979|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9354	24.741702872266668	3	1323.755948	1323.755073	S	R	1148	1158
PSM	RRDDAYWPEAK	756	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7077	20.5180809096	3	1405.675036	1405.673862	D	R	718	729
PSM	RKLTPQGQRDLD	757	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4634	16.520919823466667	2	1425.772329	1425.768825	G	R	121	133
PSM	RKVKAMEVDIEE	758	sp|Q9Y3C1|NOP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:35	ms_run[1]:scan=5600	17.9999538944	3	1461.748644	1461.749730	K	R	71	83
PSM	RHDWNSLLSHDP	759	sp|Q8IWF2|FXRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8772	23.270593844	3	1475.678341	1475.690575	L	R	96	108
PSM	KKKQDFDEDDIL	760	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8231	22.37266255946667	3	1492.740680	1492.740939	E	K	48	60
PSM	KKQKLLEENVSAF	761	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8295	22.479816174133337	3	1532.857902	1532.856243	K	K	854	867
PSM	RKSGVGNIFIKNLD	762	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8810	23.333441552533333	3	1559.879853	1559.878376	L	K	94	108
PSM	RKKVEAQLQELQV	763	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8130	22.194967954133332	3	1567.908251	1567.904590	K	K	1247	1260
PSM	RKQKEGNFDIVSGT	764	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7107	20.576638720800002	3	1577.816258	1577.816169	I	R	133	147
PSM	RRFEAEYVTDKSD	765	sp|Q8NHP6|MSPD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6503	19.539383100266665	3	1614.764975	1614.763799	R	K	18	31
PSM	RKEKAQALEELTGF	766	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9316	24.60395802773333	3	1618.869868	1618.867871	T	R	1822	1836
PSM	RKIATEKDFLEAVN	767	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8624	23.034064282933333	3	1632.884343	1632.883521	R	K	401	415
PSM	RKKAEAVVNTVDISE	768	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6998	20.39966914933333	3	1657.904329	1657.899899	T	R	761	776
PSM	RKAAQQQEEQEEKEEEDDEQTLH	769	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5384	17.666220543199998	5	2826.256493	2826.254003	F	R	294	317
PSM	RKSMYEEEINETR	770	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:35	ms_run[1]:scan=6557	19.6327513416	3	1699.784966	1699.783549	F	R	208	221
PSM	RKKQLSFISPPTPQP	771	sp|O43395|PRPF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8388	22.644641774666663	3	1722.979234	1722.978090	E	K	156	171
PSM	KKKEQLQQEIEDWS	772	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8999	23.711564285599998	3	1787.910711	1787.905378	K	K	1358	1372
PSM	RRSECNMCNTPKYA	773	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=4043	15.302753040533334	3	1801.765719	1801.765808	A	K	81	95
PSM	KKRNFILDQTNVSAAAQ	774	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8065	22.0814412616	3	1903.027317	1903.027559	R	R	573	590
PSM	RRDTGEKLTVAENEAET	775	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5900	18.469400627466666	3	1917.939075	1917.939198	V	K	1383	1400
PSM	RKKTTPTPSTNSVLSTSTN	776	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5781	18.274012321066667	3	2019.061177	2019.059647	E	R	463	482
PSM	RKKEENSTEEQALEDQNA	777	sp|Q9NQZ2|SAS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5505	17.84812343866667	3	2117.983748	2117.982519	K	K	390	408
PSM	RRAIKNDSVVAGGGAIEMELS	778	sp|Q99832|TCPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	18-UNIMOD:35	ms_run[1]:scan=8447	22.742580802400003	3	2188.126538	2188.127016	V	K	397	418
PSM	KAMGIMNSFVNDIFE	779	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=10342	28.963	2	1746.7957	1746.7957	S	R	58	73
PSM	KDHAATTAGAASLAGGHH	780	sp|P29083|T2EA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4456	16.222	4	1671.8077	1671.8077	S	R	218	236
PSM	KEHMDAINHDTKELE	781	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5953	18.548	3	1808.8363	1808.8363	E	K	909	924
PSM	KFHHTIGGS	782	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3976	15.181	2	982.49846	982.4985	H	R	179	188
PSM	KGALHTVSHEDIRDI	783	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7102	20.568	4	1689.8798	1689.8798	H	R	756	771
PSM	KHGYIPGKN	784	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4101	15.43	2	1012.5454	1012.5454	L	R	391	400
PSM	KHIAEEADR	785	sp|P06753-7|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3496	14.64	2	1067.536	1067.5360	A	K	26	35
PSM	KIKSDFFELLSNHHLDSQS	786	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9778	26.541	4	2244.1175	2244.1175	E	R	773	792
PSM	KIVVQKYHTINGHNCEV	787	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:4	ms_run[2]:scan=6415	19.367	4	2038.0418	2038.0418	D	K	160	177
PSM	KKSAEFLLHML	788	sp|P18621-2|RL17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9689	26.102	3	1315.7322	1315.7322	P	K	47	58
PSM	KKVHPAVVI	789	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6060	18.779	2	989.63859	989.6386	R	R	74	83
PSM	KKVLAQYYTVTDEHH	790	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6979	20.368	3	1830.9264	1830.9264	R	R	334	349
PSM	KKYNPTWHCIVG	791	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4	ms_run[2]:scan=8013	21.999	3	1501.75	1501.7500	D	R	48	60
PSM	KLDHHPEWFNVYN	792	sp|P61457|PHS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9263	24.419	3	1697.795	1697.7950	E	K	59	72
PSM	KLLPQLTYLDGYDRDD	793	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9942	27.261	3	1923.9578	1923.9578	F	K	137	153
PSM	KLPLDINPVVHPHGHIF	794	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9517	25.323	4	1932.0734	1932.0734	E	K	289	306
PSM	KRHIEIFTDLSS	795	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8813	23.34	3	1444.7674	1444.7674	E	R	129	141
PSM	KRILHCLGLAEEIQ	796	sp|P53004|BIEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4	ms_run[2]:scan=8800	23.317	3	1678.9189	1678.9189	K	K	276	290
PSM	KRVETSEHF	797	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4625	16.505	2	1131.5673	1131.5673	R	R	260	269
PSM	KYHSDEYIKFL	798	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9272	24.455	3	1441.7242	1441.7242	T	R	37	48
PSM	KYHTVNGHNCEV	799	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=4199	15.684	3	1456.6517	1456.6517	Q	R	166	178
PSM	RAHAHLDTG	800	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3602	14.749	2	976.48388	976.4839	F	R	674	683
PSM	RALFNHIDKSGL	801	sp|Q9H6T3-3|RPAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8221	22.358	3	1369.7466	1369.7466	A	K	481	493
PSM	RDRPHEVLLCSDLV	802	sp|Q9BRQ6|MIC25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=9111	23.993	3	1707.8726	1707.8726	Y	K	209	223
PSM	REHLLTNHL	803	sp|P10155-3|RO60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6909	20.268	3	1131.6149	1131.6149	V	K	255	264
PSM	REIEHVMYHDW	804	sp|P82930|RT34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=7749	21.577	3	1529.6721	1529.6721	A	R	129	140
PSM	REKEHYCLADLASLMD	805	sp|Q92552|RT27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=10053	27.723	3	1949.8975	1949.8975	A	K	43	59
PSM	RERELQHAALGGTAT	806	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5493	17.831	3	1608.8332	1608.8332	R	R	90	105
PSM	RHAQGEKTAGINV	807	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5095	17.206	3	1379.727	1379.7270	N	R	453	466
PSM	RHGTDLWIDNMSSAVPNHSPEK	808	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=7811	21.678	4	2506.1659	2506.1659	A	K	128	150
PSM	RHLAEHSPYYEAM	809	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=6155	18.914	3	1618.7198	1618.7198	N	K	452	465
PSM	RHLMHLELDISDS	810	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=8475	22.789	3	1580.7617	1580.7617	E	K	298	311
PSM	RHLQLAIRNDEELN	811	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9233	24.335	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	812	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9885	27.023	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	813	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8002	21.984	4	1719.9016	1719.9016	P	K	82	96
PSM	RHQLVHTGE	814	sp|P25490|TYY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3859	15.029	2	1075.5523	1075.5523	K	K	342	351
PSM	RHREDIPFDGTNDETE	815	sp|P57060|RWD2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7450	21.108	3	1929.8453	1929.8453	I	R	254	270
PSM	RHVLIHTGE	816	sp|Q9Y2X9-2|ZN281_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4752	16.723	2	1060.5778	1060.5778	R	R	242	251
PSM	RIHFPLATYAPVISAE	817	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10153	28.146	3	1783.9621	1783.9621	P	K	229	245
PSM	RIHLEIKQLN	818	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8194	22.307	3	1262.7459	1262.7459	N	R	340	350
PSM	RIHTGEKPYECNECG	819	sp|Q9HBT8-2|Z286A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4664	16.56	3	1848.7883	1848.7883	Q	K	420	435
PSM	RKASDVHEV	820	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3702	14.852	2	1039.5411	1039.5411	I	R	231	240
PSM	RKFLHDNMVEIPN	821	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=7678	21.473	3	1627.8141	1627.8141	R	R	527	540
PSM	RKGESDGAYIH	822	sp|Q6PK04|CC137_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4202	15.691	3	1231.5945	1231.5945	Q	R	117	128
PSM	RKHGVVPLATYM	823	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=7248	20.793	3	1386.7442	1386.7442	F	R	20	32
PSM	RKHIMGQNVADYM	824	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8240	22.384	3	1561.7494	1561.7494	H	R	196	209
PSM	RKLDPELHLDI	825	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9219	24.297	3	1347.751	1347.7510	L	K	185	196
PSM	RKQHPYTFPGGSGTVFA	826	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8789	23.3	3	1848.9271	1848.9271	F	R	362	379
PSM	RLEHPSATKF	827	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5726	18.197	3	1184.6302	1184.6302	C	R	154	164
PSM	RLHDEKEETAGSYDS	828	sp|O60610-2|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4301	15.936	3	1735.7649	1735.7649	K	R	188	203
PSM	RLKSLHEAELLQSDE	829	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8023	22.011	3	1766.9163	1766.9163	R	R	725	740
PSM	RMVNHFIAEFK	830	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8735	23.208	3	1390.718	1390.7180	N	R	236	247
PSM	RNADHSMNYQYR	831	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=4115	15.464	3	1569.6743	1569.6743	G	-	883	895
PSM	RNGYYNGHTFH	832	sp|Q96BP3-2|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5650	18.082	3	1364.601	1364.6010	S	R	368	379
PSM	RNHDDWSHDYDN	833	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5828	18.355	3	1572.5978	1572.5978	D	R	240	252
PSM	RNKLDHYAII	834	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8057	22.069	2	1241.6881	1241.6881	R	K	68	78
PSM	RPGAHLTVK	835	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4263	15.854	2	977.57705	977.5770	Q	K	97	106
PSM	RPHVAGIHG	836	sp|Q96T88|UHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4403	16.125	2	942.51478	942.5148	H	R	443	452
PSM	RPRHMLGLPSTLFTP	837	sp|O14733|MP2K7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=9551	25.469	3	1737.9348	1737.9348	A	R	70	85
PSM	RQHALLQEELR	838	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7226	20.758	3	1391.7633	1391.7633	Q	R	781	792
PSM	RQVHSTERPF	839	sp|P56270-3|MAZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5129	17.264	3	1255.6422	1255.6422	V	K	334	344
PSM	RRMDEISDHA	840	sp|P55010|IF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5053	17.151	3	1228.5619	1228.5619	R	K	214	224
PSM	RSLFVHKVDP	841	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6925	20.289	3	1196.6666	1196.6666	F	R	45	55
PSM	RSPNRDFLTHVSA	842	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7590	21.337	3	1498.7641	1498.7641	L	R	568	581
PSM	RTREGNDLYHEMIESGVINL	843	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=9419	24.96	4	2361.1383	2361.1383	E	K	239	259
PSM	RVCHAHPTLSEAF	844	sp|P09622-3|DLDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=7658	21.447	3	1523.7303	1523.7303	A	R	434	447
PSM	RVHGIIKNGGV	845	sp|Q8IYS1|P20D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5305	17.548	3	1148.6778	1148.6778	W	K	250	261
PSM	RVHTGFDQHEQ	846	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4392	16.106	3	1352.6222	1352.6222	H	K	20	31
PSM	RVSFELFADKVP	847	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9949	27.289	3	1406.7558	1406.7558	G	K	19	31
PSM	RHVEPGNAAIRE	848	sp|Q16775|GLO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4616	16.489801218133334	3	1348.699744	1347.700746	A	K	232	244
PSM	KPRAEDSGEYHCVYHFVSAP	849	sp|Q9Y639|NPTN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:4	ms_run[1]:scan=8448	22.744864307466667	4	2348.064672	2348.064415	N	K	207	227
PSM	KKPKVPQST	850	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3525	14.668450702666666	2	1011.608523	1011.607680	P	-	482	491
PSM	RKVLELTGK	851	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5688	18.141782051733333	2	1042.651064	1042.649879	V	-	260	269
PSM	RKADIDLTK	852	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4811	16.801136846933336	2	1058.609099	1058.608408	L	R	46	55
PSM	RRLAPSPARP	853	sp|O14654|IRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4527	16.344670887733333	3	1119.662548	1119.662510	F	R	434	444
PSM	RKAVTDLLGR	854	sp|O00401|WASL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7251	20.7975955928	3	1127.676806	1127.677491	F	R	131	141
PSM	KRNPGVKEGY	855	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3847	15.017981720266667	2	1146.613990	1146.614556	L	K	110	120
PSM	KRGNGLIKVNG	856	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5074	17.178644686933335	3	1154.688494	1154.688390	C	R	26	37
PSM	KKLEDGPKFL	857	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7652	21.436872710666666	2	1175.705384	1173.675760	G	K	385	395
PSM	RRDDGLSAAAR	858	sp|P84101|SERF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4014	15.2444385872	3	1186.617276	1186.616682	K	K	26	37
PSM	KRPGLTYLQK	859	sp|O14802|RPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6465	19.4534983144	3	1202.712141	1202.713542	L	R	130	140
PSM	RRNTLIKDTM	860	sp|O43592|XPOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:35	ms_run[1]:scan=4474	16.2465695344	2	1262.677770	1262.676505	A	R	166	176
PSM	KKKDYEVELL	861	sp|P17480|UBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8395	22.655410382133333	2	1263.708660	1263.707454	Q	R	350	360
PSM	RKIEFPLPDR	862	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8480	22.794986589066664	3	1269.719401	1269.719356	D	R	329	339
PSM	KKVKGVGFGDIF	863	sp|Q96B97|SH3K1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9273	24.4573924384	3	1293.745371	1293.744508	P	K	208	220
PSM	RKQVEELFER	864	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7564	21.295313134133334	2	1332.718312	1332.714999	L	K	362	372
PSM	KKIFEYETQR	865	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6533	19.586289059733335	3	1340.709128	1340.708851	E	R	36	46
PSM	RIRDQLSAVASK	866	sp|Q9P000|COMD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6346	19.240354054933334	3	1342.768354	1342.768097	G	-	187	199
PSM	RRPEVDGEKYQ	867	sp|Q9Y2Q9|RT28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4372	16.079079010933334	3	1375.685216	1375.684427	C	K	125	136
PSM	RRDDAYWPEGK	868	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6918	20.278536621866667	3	1391.658991	1391.658212	D	R	736	747
PSM	RRQVDQLTNDKA	869	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4645	16.536701007466668	3	1442.758202	1442.758989	L	R	158	170
PSM	KKLNVTEQEKID	870	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5417	17.72459320933333	3	1443.794334	1443.793309	S	K	80	92
PSM	KRKASGPPVSELIT	871	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7468	21.137212113066667	3	1481.856993	1481.856578	G	K	33	47
PSM	RKTVTAMDVVYALK	872	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:35	ms_run[1]:scan=8719	23.183169376533332	3	1612.913857	1609.886164	K	R	79	93
PSM	KKGRPDPYAYIPLN	873	sp|Q5JTH9|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8832	23.375280932800003	3	1630.885179	1630.883127	K	R	1244	1258
PSM	RKKDEISVDSLDFN	874	sp|P63151|2ABA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8942	23.594350033866665	3	1664.840366	1664.836964	K	K	403	417
PSM	KKLWGDRYFDPANG	875	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9049	23.839142135733333	3	1665.827816	1665.826340	M	K	258	272
PSM	RRNLESTVSQIEKE	876	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8068	22.084616315733335	3	1687.886532	1687.885312	Q	K	474	488
PSM	RRWYPEEYEFAPK	877	sp|Q9Y3B8|ORN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8884	23.468455109599997	3	1769.852733	1769.852555	C	K	177	190
PSM	RKGTDVPKWISIMTE	878	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:35	ms_run[1]:scan=9035	23.806513139733333	3	1775.925387	1775.924006	K	R	205	220
PSM	RKYEQEQEKGQEDL	879	sp|P46199|IF2M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4844	16.851369857866665	3	1778.845329	1778.843506	W	K	447	461
PSM	KRKSEQEFSFDTPAD	880	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7966	21.935138328	3	1783.837574	1783.837693	Y	R	1124	1139
PSM	KKRLVQSPNSYFMDV	881	sp|Q71UM5|RS27L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:35	ms_run[1]:scan=8627	23.03728295333333	3	1826.936853	1826.934905	K	K	21	36
PSM	KKKNGNYCVLQMDQSY	882	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=7185	20.694600558133335	3	1990.924530	1990.924082	S	K	356	372
PSM	RKREEAAAVPAAAPDDLALL	883	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9478	25.170450064	3	2076.135135	2076.132753	P	K	87	107
PSM	RKRDQEEEMDYAPDDVYDY	884	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:35	ms_run[1]:scan=8414	22.68623729413333	3	2452.016358	2452.012499	K	K	271	290
PSM	RRIRGPEESQPPQLYAADEEEAPGT	885	sp|Q5RKV6|EXOS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8049	22.056374863200002	4	2795.351373	2795.347450	H	R	6	31
PSM	KDLFDPIIED	886	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10088	27.863	2	1203.6023	1203.6023	F	R	86	96
PSM	KEHIKNPDW	887	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5940	18.529	3	1165.588	1165.5880	I	R	227	236
PSM	KEKPYFPIPEEYTFIQNVPLED	888	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10570	29.956	3	2695.3421	2695.3421	Q	R	443	465
PSM	KELTEEKESAFEFLSSA	889	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9925	27.191	3	1943.9364	1943.9364	A	-	229	246
PSM	KFLPHKYDV	890	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7084	20.53	2	1145.6233	1145.6233	P	K	216	225
PSM	KGTHNFHNFTSQ	891	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5709	18.171	3	1416.6535	1416.6535	Y	K	212	224
PSM	KHHASISEL	892	sp|P11171-6|EPB41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5577	17.962	2	1020.5352	1020.5352	K	K	382	391
PSM	KHKAGFLDL	893	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8713	23.175	2	1027.5815	1027.5815	Q	K	254	263
PSM	KKFHTVSGS	894	sp|Q99729-3|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3657	14.803	2	989.52943	989.5294	E	K	214	223
PSM	KKHELLNST	895	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4448	16.212	2	1068.5928	1068.5928	I	R	393	402
PSM	KKHLQDLSG	896	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4109	15.453	2	1024.5665	1024.5665	V	R	339	348
PSM	KKHTLGEVWVQ	897	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7877	21.777	3	1323.7299	1323.7299	S	K	338	349
PSM	KKHVNPVQALSEF	898	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9109	23.99	3	1495.8147	1495.8147	Q	K	518	531
PSM	KKHYILNGS	899	sp|Q9H845|ACAD9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5091	17.201	2	1058.5873	1058.5873	D	K	202	211
PSM	KKIHPQTIIAGW	900	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8865	23.434	3	1390.8085	1390.8085	A	R	72	84
PSM	KKISSIQSIVPALEIANAH	901	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9744	26.374	3	2018.1524	2018.1524	E	R	249	268
PSM	KKYHNVGLS	902	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4535	16.357	2	1044.5716	1044.5716	E	K	242	251
PSM	KKYVLENHPGTNSNYQMHLL	903	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:35	ms_run[2]:scan=7800	21.654	4	2401.1849	2401.1849	L	K	213	233
PSM	KLGIHEDSTNR	904	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4360	16.06	3	1268.6473	1268.6473	L	R	438	449
PSM	KLHSYATSIR	905	sp|P51553-2|IDH3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5372	17.652	3	1174.6459	1174.6459	L	K	340	350
PSM	KNVMVEPHRHEGVFIC	906	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:4	ms_run[2]:scan=7679	21.474	4	1950.9557	1950.9557	G	R	84	100
PSM	KRGFGFVYFQNHDAAD	907	sp|Q13151|ROA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9242	24.364	4	1870.8751	1870.8751	K	K	138	154
PSM	KRHGAEVIDTPVFEL	908	sp|P12081-4|HARS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9670	26.015	3	1709.9101	1709.9101	F	K	85	100
PSM	KRPPSAFFLFCSEH	909	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=9683	26.076	3	1721.8348	1721.8348	P	R	96	110
PSM	KVHSHSAEMEAQLSQALEELGGQKQ	910	sp|Q9Y6D9-3|MD1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=9369	24.794	4	2750.3294	2750.3294	Q	R	352	377
PSM	KWKPGSLASHV	911	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7448	21.103	2	1208.6666	1208.6666	P	K	186	197
PSM	KYFLHQSHEE	912	sp|P02794|FRIH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5315	17.56	3	1316.6149	1316.6149	A	R	54	64
PSM	KYNHFLAIHQ	913	sp|O43167-2|ZBT24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7597	21.348	3	1269.6618	1269.6618	F	R	304	314
PSM	RAALDERYHSDFN	914	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6923	20.286	3	1592.7332	1592.7332	K	R	660	673
PSM	RAKQQGDHSL	915	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3640	14.787	3	1138.5843	1138.5843	E	K	163	173
PSM	RALGISHAKD	916	sp|Q7L2E3-3|DHX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4095	15.419	3	1066.5883	1066.5883	G	K	24	34
PSM	RDHPHTAAYLQELG	917	sp|Q6GMV3|PTRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8161	22.243	3	1606.7852	1606.7852	H	R	63	77
PSM	RDREEALHQF	918	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6500	19.534	3	1299.632	1299.6320	Q	R	462	472
PSM	REAVKHIGYDDSS	919	sp|P31153-2|METK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4827	16.818	3	1475.7005	1475.7005	V	K	21	34
PSM	REDIRNAAWH	920	sp|O75323-2|NIPS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6324	19.207	3	1266.6218	1266.6218	T	K	206	216
PSM	REHVKPLFNMED	921	sp|Q13867|BLMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=6808	20.093	3	1529.7297	1529.7297	Y	K	255	267
PSM	REKLNEEHF	922	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5699	18.156	3	1200.5887	1200.5887	Q	R	43	52
PSM	REREEHLLEQLA	923	sp|Q12899|TRI26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8590	22.971	3	1521.79	1521.7900	L	K	200	212
PSM	RGHVQDPNDR	924	sp|Q14CX7-2|NAA25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3376	14.5	3	1192.5697	1192.5697	T	R	4	14
PSM	RGHVQPIRCTNCA	925	sp|P62854|RS26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=4187	15.652	3	1567.746	1567.7460	G	R	15	28
PSM	RGKHFIGDFLPPDELE	926	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9703	26.168	3	1868.9421	1868.9421	G	K	520	536
PSM	RGYYNGTKFH	927	sp|Q9Y3C6|PPIL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5633	18.061	3	1241.5942	1241.5942	R	R	45	55
PSM	RHEIVPKDI	928	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6474	19.473	2	1105.6244	1105.6244	G	R	217	226
PSM	RHFLEQLLDGK	929	sp|O14981-2|BTAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9528	25.365	3	1354.7357	1354.7357	E	K	69	80
PSM	RHHCPNTPIILVGT	930	sp|P63000|RAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=8308	22.5	3	1613.846	1613.8460	V	K	102	116
PSM	RHLLFQSHMAT	931	sp|Q9P0V9|SEP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=6517	19.559	3	1355.6768	1355.6768	A	K	8	19
PSM	RHLQLAIRNDEELN	932	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9093	23.951	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	933	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9552	25.474	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	934	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9646	25.899	3	1719.9016	1719.9016	P	K	82	96
PSM	RHRDGGEALVSPDGTVTEAP	935	sp|Q96HN2-2|SAHH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7614	21.372	3	2063.0032	2063.0032	Q	R	97	117
PSM	RHRGSEEDPLLSPVETW	936	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9593	25.663	3	2006.981	2006.9810	G	K	1191	1208
PSM	RHYPVFENPKQG	937	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6428	19.389	3	1470.7368	1470.7368	S	K	692	704
PSM	RHYPVFENPKQG	938	sp|P55265-5|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6623	19.759	3	1470.7368	1470.7368	S	K	692	704
PSM	RIQVWHAEH	939	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6390	19.331	3	1174.5996	1174.5996	D	R	171	180
PSM	RIQVWHEEH	940	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6467	19.456	3	1232.6051	1232.6051	E	R	171	180
PSM	RISPHNNQHF	941	sp|P21359-3|NF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4620	16.496	3	1248.6112	1248.6112	F	K	385	395
PSM	RKDYLAHSSMDF	942	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8235	22.377	3	1468.6769	1468.6769	G	-	611	623
PSM	RKFVSLDHI	943	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8056	22.067	3	1113.6295	1113.6295	Y	K	382	391
PSM	RKHSNLITVPIQDDSNSGA	944	sp|Q75N03-2|HAKAI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8125	22.188	3	2051.0396	2051.0396	T	R	286	305
PSM	RKSNFAEALAAH	945	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7303	20.877	3	1313.684	1313.6840	L	K	30	42
PSM	RKTHTCQVIIENVS	946	sp|Q8ND82|Z280C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=6932	20.298	3	1683.8726	1683.8726	Q	K	709	723
PSM	RLGDKHATLQ	947	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4381	16.091	3	1137.6255	1137.6255	K	K	180	190
PSM	RLHDVLHSD	948	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5484	17.819	3	1090.552	1090.5520	V	K	65	74
PSM	RLHICDHFT	949	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=7689	21.488	3	1197.5713	1197.5713	S	R	170	179
PSM	RLIKLEHAEA	950	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6239	19.068	3	1178.6772	1178.6772	E	K	1776	1786
PSM	RLTHLIDHL	951	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8473	22.786	3	1116.6404	1116.6404	E	K	238	247
PSM	RPDHLNSHV	952	sp|P56270-3|MAZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4180	15.638	3	1073.5366	1073.5366	S	R	325	334
PSM	RPGHYDILYK	953	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7237	20.774	3	1260.6615	1260.6615	Y	-	262	272
PSM	RPRHQGVMVGMGQ	954	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=3789	14.952	3	1483.7136	1483.7136	G	K	37	50
PSM	RPRHQGVMVGMGQ	955	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=4805	16.793	3	1467.7187	1467.7187	G	K	37	50
PSM	RPSTGPHKL	956	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3899	15.069	2	991.55631	991.5563	P	R	30	39
PSM	RQGDGKWHLVY	957	sp|Q99829|CPNE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8723	23.19	3	1357.6891	1357.6891	F	R	166	177
PSM	RQVSKHAFSL	958	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6997	20.398	3	1171.6462	1171.6462	V	K	174	184
PSM	RRMDEISDHA	959	sp|P55010|IF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35	ms_run[2]:scan=3954	15.147	3	1244.5568	1244.5568	R	K	214	224
PSM	RRNEQNGAAAHVIAEDV	960	sp|P24928-2|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7264	20.82	3	1848.9191	1848.9191	L	K	291	308
PSM	RRPEDYDIHNS	961	sp|Q96MU7-2|YTDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4906	16.941	2	1400.6433	1400.6433	R	R	517	528
PSM	RSHGIDLDHN	962	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4859	16.873	3	1162.5479	1162.5479	L	R	214	224
PSM	RSHQLIHAASL	963	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6898	20.253	3	1231.6786	1231.6786	K	K	209	220
PSM	RSKLHLVDLAGSE	964	sp|O95239-2|KIF4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8340	22.552	3	1423.7783	1423.7783	F	R	233	246
PSM	RSKLSQLHES	965	sp|Q9UBC2-3|EP15R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4426	16.179	3	1183.6309	1183.6309	A	R	544	554
PSM	RSYCGHGIH	966	sp|P53582|MAP11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=3848	15.019	3	1085.4825	1085.4825	V	K	289	298
PSM	RTHLNDKYGY	967	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5841	18.38	3	1265.6153	1265.6153	G	-	787	797
PSM	RTLFGLHLSQK	968	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8862	23.429	3	1298.7459	1298.7459	V	R	378	389
PSM	RTNLQHAIR	969	sp|Q8N3U4-2|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4449	16.214	3	1107.6261	1107.6261	L	R	1186	1195
PSM	RVHQIAEEHGL	970	sp|P38935|SMBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5945	18.536	3	1287.6684	1287.6684	L	R	757	768
PSM	RVLHHMGGMAGLQSMM	971	sp|P61011-2|SRP54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,9-UNIMOD:35,15-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=4376	16.085	3	1818.7997	1818.7998	P	R	420	436
PSM	RWSLQSEAHR	972	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6780	20.048	3	1268.6374	1268.6374	G	R	100	110
PSM	RYHSDWQMDH	973	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=5081	17.188	3	1389.552	1389.5520	Y	R	1659	1669
PSM	RLHFFMPGFAPLTS	974	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:35	ms_run[1]:scan=10057	27.737253957066667	3	1635.823101	1635.823169	P	R	262	276
PSM	RYGIKPEWMMIH	975	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=8902	23.503236303733335	3	1575.777180	1575.769025	Y	R	614	626
PSM	RDLEFSHSDSRDQVIGH	976	sp|Q8IX01|SUGP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6971	20.357413108	4	1996.936479	1996.935115	G	R	109	126
PSM	KKFSAHYDAVEAEL	977	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8370	22.61607940133333	3	1606.801423	1606.799122	D	K	47	61
PSM	KQNWLHSYFH	978	sp|Q9NUW8|TYDP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9026	23.783326024266668	3	1358.652118	1358.652004	E	K	469	479
PSM	RHLQLAIRNDEELN	979	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8128	22.19148007653333	3	1720.887394	1719.901630	P	K	82	96
PSM	RHFNELEHELQS	980	sp|Q7Z3C6|ATG9A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7721	21.538372013066667	3	1539.724774	1537.727354	L	R	341	353
PSM	KRYDALSEHNL	981	sp|Q9UKY1|ZHX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7099	20.563882552266666	3	1344.676593	1344.678613	T	K	112	123
PSM	KHRVIGSGCNLDSA	982	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4	ms_run[1]:scan=5291	17.52548395066667	3	1513.748794	1512.746710	P	R	156	170
PSM	RKLHGLEILNSTM	983	sp|Q9H892|TTC12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35	ms_run[1]:scan=8433	22.720162013866666	3	1526.834047	1526.823898	L	K	687	700
PSM	RKLLASLVK	984	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7487	21.164007748	2	1026.691574	1026.691350	Q	R	253	262
PSM	KKGAEKEEL	985	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3850	15.020215048	2	1030.565926	1030.565875	Q	-	253	262
PSM	KKKDFDTAL	986	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6026	18.6934700104	2	1064.586523	1064.586610	Y	K	237	246
PSM	KKKEPSVEE	987	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3558	14.704602505866665	2	1072.583383	1072.576440	E	K	465	474
PSM	KKYIDNPKL	988	sp|Q92499|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6071	18.795704782133335	3	1117.649766	1117.649545	F	R	310	319
PSM	RKFGFELVK	989	sp|Q5JTH9|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8514	22.844752958933334	3	1122.655116	1122.654965	I	R	1013	1022
PSM	RKGTAKVDFL	990	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7471	21.1421120344	3	1133.655947	1133.655693	E	K	4	14
PSM	KKTKEAVLLL	991	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8227	22.367499795733334	3	1141.743334	1141.743445	Y	K	162	172
PSM	RKFPDVKFI	992	sp|Q9H2J4|PDCL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9004	23.724357454133333	3	1148.670831	1148.670615	A	K	139	148
PSM	RKSSTPEEVK	993	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3460	14.598009896	3	1159.618079	1159.619701	V	K	21	31
PSM	KKKYEPPVPT	994	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5304	17.5453339472	2	1185.676853	1185.675760	K	R	22	32
PSM	RKFFGVIPSGK	995	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8439	22.729934952266667	3	1234.719811	1234.718627	I	K	4	15
PSM	RKFFGVIPSGK	996	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8418	22.695124754400002	3	1234.719811	1234.718627	I	K	4	15
PSM	RKIQGIEEYK	997	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5737	18.21515023546667	3	1262.698926	1262.698286	I	K	85	95
PSM	RKEDMTYAVR	998	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5275	17.50542985946667	3	1267.632617	1267.634306	V	K	164	174
PSM	RKIEFPLPDR	999	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8276	22.443180548266664	3	1269.719401	1269.719356	D	R	329	339
PSM	KRANEFLEVGK	1000	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7055	20.482831296266667	3	1289.704565	1289.709185	L	K	13	24
PSM	KKIKYFEGVSP	1001	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7752	21.581850976266665	2	1294.730133	1294.728524	A	K	678	689
PSM	RKVDWLTEKM	1002	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8628	23.038095325066667	3	1304.691486	1304.691092	K	R	288	298
PSM	RKGIVCNLCGK	1003	sp|Q9NUD5|ZCHC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5616	18.023618368799998	3	1303.682826	1303.685296	C	R	367	378
PSM	RKKEEQEFVQ	1004	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4715	16.6599729568	2	1319.684631	1319.683364	N	K	925	935
PSM	RKLDAEDVIGSR	1005	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7408	21.043598224	3	1357.731835	1357.731377	K	R	2891	2903
PSM	RKLDAEDVIGSR	1006	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7415	21.053695954933335	3	1357.731835	1357.731377	K	R	2891	2903
PSM	RKTGYSFVNCK	1007	sp|P43897|EFTS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:4	ms_run[1]:scan=5960	18.561979177333335	2	1358.674412	1358.676505	R	K	55	66
PSM	RKKAEIEMDYS	1008	sp|P0DMP2|SRG2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35	ms_run[1]:scan=4607	16.4678868208	2	1384.666904	1384.665666	F	R	54	65
PSM	RKYTELQLEAAK	1009	sp|Q5T8P6|RBM26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6943	20.315994653333334	3	1449.805433	1448.798728	R	R	836	848
PSM	RRVKEGYVPQEEVPVYEN	1010	sp|Q9BRP8|PYM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7959	21.92336948346667	3	2191.106784	2190.106932	Q	K	30	48
PSM	RAHLLDNTERLE	1011	sp|Q96AJ9|VTI1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7353	20.958575777866667	3	1467.747270	1465.763740	Q	R	115	127
PSM	RKDLIKSEEMNT	1012	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:35	ms_run[1]:scan=4870	16.885511217066668	3	1478.741038	1478.739893	A	K	291	303
PSM	RKREELSNVLAAM	1013	sp|Q9Y3U8|RL36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35	ms_run[1]:scan=7490	21.1683681608	3	1531.814482	1531.814061	K	R	85	98
PSM	RKEKNVQGIIEIL	1014	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9339	24.68721598426667	3	1538.915710	1538.914427	R	K	450	463
PSM	KKSKLDEFTNDFA	1015	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8835	23.381724358133333	3	1541.774708	1541.772573	K	K	654	667
PSM	RRTNSTFNQVVLK	1016	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7083	20.527430732266666	3	1561.868991	1561.868874	A	R	37	50
PSM	RKKEDVSESVGASGQ	1017	sp|Q9UPN9|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3845	15.016194633333333	3	1575.783189	1575.785263	I	R	257	272
PSM	KRPNKQEESESPVE	1018	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3804	14.967009501066666	3	1655.812453	1655.811478	Q	R	301	315
PSM	KIHQEGDALPGHSKPS	1019	sp|Q1ED39|KNOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4209	15.706262587466666	3	1699.865540	1699.864182	K	R	217	233
PSM	RKIEQEKNQALEQS	1020	sp|Q2TBE0|C19L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4345	16.036704213333334	3	1699.887025	1699.885312	M	K	178	192
PSM	RHLQLAIRNDEELN	1021	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6562	19.641336696533333	3	1719.869946	1719.901630	P	K	82	96
PSM	RHLQLAIRNDEELN	1022	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10595	30.06186364186667	3	1719.902962	1719.901630	P	K	82	96
PSM	KKREDYESQSNPVF	1023	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7217	20.748144396266664	3	1725.832509	1725.832213	K	R	84	98
PSM	KKPKPQINQW	1024	sp|Q9NW13|RBM28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6265	19.102571513066668	2	1265.724638	1265.724441	P	K	695	705
PSM	KRGQTCVVHYTGMLEDGK	1025	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=6154	18.913124816533333	4	2094.000950	2093.998644	P	K	18	36
PSM	RKGKVLAQQGEYSEAIPIL	1026	sp|Q14318|FKBP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9341	24.694149032533335	3	2099.180898	2099.173889	F	R	311	330
PSM	RRPKPLVDPACITSIQPGAP	1027	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=9124	24.026457608266664	3	2172.190332	2172.183743	A	K	48	68
PSM	KRKELSQNTDESGLNDEAIA	1028	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6882	20.226343337066666	3	2217.091732	2217.087319	S	K	185	205
PSM	KCHAEHTPEEEIDHTGA	1029	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=5293	17.528	4	1959.8381	1959.8381	Q	K	539	556
PSM	KERTHFTV	1030	sp|P52815|RM12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5534	17.897	2	1016.5403	1016.5403	A	R	125	133
PSM	KFPHSAHQ	1031	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3683	14.834	2	950.47225	950.4722	L	K	63	71
PSM	KGFGDHIHW	1032	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8623	23.032	3	1095.525	1095.5250	G	R	32	41
PSM	KGRGHVQPI	1033	sp|P62854|RS26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4042	15.3	2	990.5723	990.5723	K	R	13	22
PSM	KHKASVEDADTQS	1034	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3493	14.637	3	1414.6688	1414.6688	A	K	295	308
PSM	KHKELAPYDENWFYT	1035	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9739	26.342	3	1939.9105	1939.9105	A	R	41	56
PSM	KHNFLQAHNGQGL	1036	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7194	20.713	3	1462.7429	1462.7429	S	R	1602	1615
PSM	KHRDFVAEPMGE	1037	sp|O75531|BAF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=5567	17.95	3	1430.6612	1430.6612	Q	K	6	18
PSM	KHRDYETATLSDI	1038	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8118	22.18	3	1547.758	1547.7580	L	K	218	231
PSM	KIWHHTFYNEL	1039	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8630	23.041	3	1486.7357	1486.7357	E	R	84	95
PSM	KKFLDAGH	1040	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4712	16.656	2	914.4974	914.4974	A	K	288	296
PSM	KKLGIHSALLDE	1041	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8008	21.994	3	1322.7558	1322.7558	L	K	139	151
PSM	KKPHIYYGSLEE	1042	sp|O43172-2|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7424	21.069	3	1462.7456	1462.7456	V	K	25	37
PSM	KLFVGGIKEDTEEHHL	1043	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11322	32.754	3	1850.9527	1850.9527	K	R	101	117
PSM	KLHGELQDR	1044	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4048	15.31	3	1094.5833	1094.5833	E	K	179	188
PSM	KPKIHGSGHVEEPASPLAAYQ	1045	sp|Q12955-6|ANK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7453	21.114	4	2215.1386	2215.1386	L	K	908	929
PSM	KQFVFDLHSGKLH	1046	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8557	22.916	4	1554.8307	1554.8307	L	R	345	358
PSM	KRAEVLGH	1047	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4153	15.569	2	908.5192	908.5192	L	K	114	122
PSM	KRLLDYSLH	1048	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7968	21.938	3	1143.64	1143.6400	C	K	105	114
PSM	KSRGVLHQFSGTETN	1049	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6260	19.098	3	1659.8329	1659.8329	Y	K	186	201
PSM	KVIKHGPQ	1050	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3369	14.491	2	905.54469	905.5447	T	R	315	323
PSM	KYHPDKNPNEGE	1051	sp|P31689-2|DNJA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3529	14.674	3	1426.6477	1426.6477	L	K	32	44
PSM	RAKHSGDYFTLL	1052	sp|Q93008|USP9X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9320	24.612	3	1406.7306	1406.7306	E	R	1368	1380
PSM	RDRGHDSEMIGDLQA	1053	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=6864	20.203	3	1714.7693	1714.7693	R	R	615	630
PSM	REHGVLGGKL	1054	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6360	19.263	3	1064.6091	1064.6091	Q	R	43	53
PSM	REHLLDQLK	1055	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7469	21.139	3	1150.6459	1150.6459	P	R	944	953
PSM	REIISHDTR	1056	sp|P00387-2|NB5R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3921	15.094	3	1125.5891	1125.5891	D	R	27	36
PSM	REKLGFFH	1057	sp|P60983|GMFB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8011	21.997	2	1032.5505	1032.5505	L	-	135	143
PSM	REREAILAIH	1058	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7142	20.628	3	1206.6833	1206.6833	D	K	363	373
PSM	RERYPLDHA	1059	sp|O60524-4|NEMF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5383	17.665	3	1155.5785	1155.5785	V	R	108	117
PSM	REYLTGFHK	1060	sp|Q9UGY1|NOL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6907	20.265	3	1149.5931	1149.5931	R	R	28	37
PSM	RFYPDRPHQ	1061	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5156	17.306	3	1214.5945	1214.5945	P	K	88	97
PSM	RFYPHTHNMDGFFIA	1062	sp|P46087-3|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=9064	23.878	3	1867.8464	1867.8464	R	K	564	579
PSM	RHFNAPSHI	1063	sp|P61254|RL26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5941	18.531	3	1077.5468	1077.5468	K	R	17	26
PSM	RHGATHVFAS	1064	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4459	16.227	2	1081.5417	1081.5417	I	K	658	668
PSM	RHGQKGTCGIQY	1065	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=5035	17.125	3	1403.6728	1403.6728	S	R	938	950
PSM	RHHGTPMLLDGV	1066	sp|Q9GZN8|CT027_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=8029	22.019	3	1347.6718	1347.6718	D	K	143	155
PSM	RHLLVKVID	1067	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7491	21.171	3	1091.6815	1091.6815	E	R	549	558
PSM	RHLNDLLEDR	1068	sp|O95239-2|KIF4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7799	21.652	3	1279.6633	1279.6633	K	K	762	772
PSM	RHLQLAIRNDEELN	1069	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8915	23.532	3	1719.9016	1719.9016	P	K	82	96
PSM	RHLQLAIRNDEELN	1070	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9435	25.013	3	1719.9016	1719.9016	P	K	82	96
PSM	RHPFIVNHP	1071	sp|P55265-5|DSRAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6151	18.91	3	1115.5988	1115.5988	L	K	801	810
PSM	RHPGFHPDLL	1072	sp|Q9BXK1|KLF16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8375	22.622	3	1187.62	1187.6200	R	R	208	218
PSM	RHSLHEEENNIF	1073	sp|Q96CB9-3|NSUN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7581	21.323	3	1523.7117	1523.7117	D	K	64	76
PSM	RIHFPLATYAPVISAE	1074	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10099	27.909	3	1783.9621	1783.9621	P	K	229	245
PSM	RIHIVMKSD	1075	sp|Q9Y4Y9|LSM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6094	18.832	3	1097.6015	1097.6015	S	K	25	34
PSM	RIHPELLAK	1076	sp|Q9P0M6|H2AW_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6636	19.782	3	1075.6502	1075.6502	P	K	108	117
PSM	RIHSLTHLDSVT	1077	sp|P46736-4|BRCC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7271	20.833	3	1377.7365	1377.7365	R	K	135	147
PSM	RIRDVINVFH	1078	sp|Q96S94-5|CCNL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8938	23.587	3	1267.7149	1267.7149	R	R	140	150
PSM	RIRQAEEQIEHLQ	1079	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7250	20.797	3	1648.8645	1648.8645	R	R	729	742
PSM	RIYPTFLHLHG	1080	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9246	24.373	3	1352.7353	1352.7353	I	K	217	228
PSM	RKDIEEHLQ	1081	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4682	16.592	3	1166.6044	1166.6044	D	R	182	191
PSM	RKGACASHVSTMASFL	1082	sp|Q9UJU6-6|DBNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4	ms_run[2]:scan=8873	23.45	3	1721.8341	1721.8341	V	K	93	109
PSM	RKGLFFEHDL	1083	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9077	23.911	3	1260.6615	1260.6615	P	R	184	194
PSM	RKGLFPFTHV	1084	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9097	23.961	3	1200.6768	1200.6768	G	K	282	292
PSM	RKHGVVPLATYM	1085	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8637	23.05	3	1370.7493	1370.7493	F	R	20	32
PSM	RKHSELSELNV	1086	sp|Q92783-2|STAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7531	21.239	2	1310.6943	1310.6943	D	K	352	363
PSM	RKIENIHIGE	1087	sp|O00203-3|AP3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6666	19.837	3	1207.6673	1207.6673	D	K	863	873
PSM	RKLYCANGHTFQA	1088	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4	ms_run[2]:scan=6788	20.061	3	1564.7569	1564.7569	W	K	133	146
PSM	RKNSSALHSLL	1089	sp|Q69YN4-3|VIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7496	21.179	3	1224.6939	1224.6939	L	K	1369	1380
PSM	RKTSYAQHQQV	1090	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3800	14.962	3	1344.6898	1344.6898	I	R	151	162
PSM	RKTVSLEHLQ	1091	sp|Q96SN8-3|CK5P2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6120	18.862	3	1209.683	1209.6830	S	R	1445	1455
PSM	RKYDEVLHMV	1092	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8645	23.062	3	1288.6598	1288.6598	N	R	606	616
PSM	RLDHKFDLMYA	1093	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=8549	22.896	3	1423.6918	1423.6918	A	K	355	366
PSM	RLHEDHLE	1094	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4349	16.043	2	1047.5098	1047.5098	A	R	204	212
PSM	RLKEIEHNLS	1095	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5681	18.125	3	1237.6779	1237.6779	N	K	115	125
PSM	RLKLHCTPGDGQ	1096	sp|Q6L8Q7-2|PDE12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4	ms_run[2]:scan=5019	17.103	3	1380.6932	1380.6932	L	R	245	257
PSM	RLKNYYEVH	1097	sp|O43663-3|PRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5888	18.454	3	1220.6302	1220.6302	V	K	299	308
PSM	RLLHQEKLE	1098	sp|Q01664|TFAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5470	17.803	3	1164.6615	1164.6615	V	R	205	214
PSM	RLRHGEDSTPQVLTEQQAT	1099	sp|Q96RT8-2|GCP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6714	19.933	3	2165.0825	2165.0825	S	K	603	622
PSM	RMRHVISYSLSPFEQ	1100	sp|O14949|QCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=9030	23.795	3	1864.9254	1864.9254	T	R	10	25
PSM	RPGIHHSLFGDV	1101	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8524	22.86	3	1333.6891	1333.6891	L	K	383	395
PSM	RPQNYLFGCEL	1102	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:4	ms_run[2]:scan=9941	27.256	2	1395.6605	1395.6605	L	K	13	24
PSM	RQHLYVDKNT	1103	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4569	16.41	3	1272.6575	1272.6575	S	K	47	57
PSM	RQKEIWHLL	1104	sp|O15111|IKKA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9265	24.425	3	1221.6982	1221.6982	K	K	646	655
PSM	RRGEAHLAVNDFELA	1105	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9042	23.825	3	1696.8645	1696.8645	F	R	358	373
PSM	RRHEAAVPPLAIPSA	1106	sp|Q6PJT7-10|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8571	22.934	3	1583.8896	1583.8896	E	K	108	123
PSM	RRLPDAHSDYA	1107	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5208	17.402	3	1299.632	1299.6320	Y	R	636	647
PSM	RRPEHGGPPELFYDETEA	1108	sp|O43709-2|BUD23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8856	23.423	3	2098.9708	2098.9708	G	R	6	24
PSM	RSFHTDKLGEY	1109	sp|O14647|CHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6919	20.281	3	1351.6521	1351.6521	Y	K	1763	1774
PSM	RSHSAHFFEFLT	1110	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9614	25.76	3	1477.7102	1477.7102	N	K	75	87
PSM	RSHTLSHASYL	1111	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6185	18.965	3	1270.6418	1270.6418	D	R	906	917
PSM	RSRGVDLHEQSQQN	1112	sp|P61020-2|RAB5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4036	15.29	3	1652.7979	1652.7979	G	K	154	168
PSM	RSRTHSTSSSLGSGESPFS	1113	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6891	20.241	3	1965.914	1965.9140	A	R	237	256
PSM	RVFHSYSPYDH	1114	sp|Q5VV42|CDKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6643	19.795	3	1406.6367	1406.6367	S	K	422	433
PSM	RVKELGHSTQQF	1115	sp|P56945-4|BCAR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5690	18.144	3	1428.7474	1428.7474	E	R	701	713
PSM	RVKIQDAH	1116	sp|O75083-3|WDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3726	14.879	2	965.54066	965.5407	T	R	427	435
PSM	RVMEHFIKLY	1117	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35	ms_run[2]:scan=8648	23.068	3	1350.7118	1350.7118	Q	K	261	271
PSM	RVTVKHLEEIVE	1118	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8443	22.736	3	1450.8144	1450.8144	S	K	1171	1183
PSM	RYKAPFHQL	1119	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7155	20.647	3	1158.6298	1158.6298	A	R	930	939
PSM	RYKNILPFDHT	1120	sp|Q06124-3|PTN11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8745	23.224	3	1402.7357	1402.7357	N	R	278	289
PSM	RYLHSCPESVK	1121	sp|Q5TFE4-2|NT5D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4	ms_run[2]:scan=4696	16.617	3	1374.6714	1374.6714	G	K	142	153
PSM	RYSDFHDLHE	1122	sp|Q9Y2I1-4|NISCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7041	20.465	3	1317.5738	1317.5738	H	K	49	59
PSM	RYYETHNVKN	1123	sp|Q13823|NOG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3849	15.019	3	1322.6367	1322.6367	V	R	697	707
PSM	KKHSQFIGYPITLYLE	1124	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10140	28.084931007466665	3	1936.048671	1936.045835	V	K	182	198
PSM	RAFHNEAQVNPER	1125	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4669	16.571344359733335	3	1566.764553	1566.765137	L	K	468	481
PSM	RHVFGQAVKNDQCYDDI	1126	sp|Q9ULV4|COR1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4	ms_run[1]:scan=7946	21.905763260266667	3	2065.951670	2063.948323	F	R	11	28
PSM	KQLPHFTSEHIK	1127	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6272	19.1142401296	4	1464.792051	1463.788498	L	R	1961	1973
PSM	RSPVVGFDPHHHM	1128	sp|Q04727|TLE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:35	ms_run[1]:scan=5944	18.534845989066664	3	1530.713618	1530.715016	G	R	418	431
PSM	RIKQHEGLATFY	1129	sp|Q6L8Q7|PDE12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8129	22.193765709866668	3	1462.777722	1461.772848	F	R	375	387
PSM	RHLLFQSHMAT	1130	sp|Q9P0V9|SEP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:35	ms_run[1]:scan=6494	19.518364608533332	3	1355.676261	1355.676839	A	K	8	19
PSM	KKLYTGPGLAIHCMQVH	1131	sp|O43670|ZN207_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4,14-UNIMOD:35	ms_run[1]:scan=7438	21.090249908266667	4	1968.007968	1968.007358	H	K	42	59
PSM	RYHGHSMSDPGVSY	1132	sp|P29803|ODPAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:35	ms_run[1]:scan=5122	17.255029474133334	3	1607.674571	1607.678690	Y	R	286	300
PSM	RHLQLAIRNDEELN	1133	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10360	29.046255964533334	3	1719.902962	1719.901630	P	K	82	96
PSM	RLHEDHLE	1134	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4334	16.020285666133333	2	1047.510216	1047.509757	A	R	204	212
PSM	RKLSEADNR	1135	sp|Q9UNL2|SSRG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3463	14.600999064533333	3	1087.576069	1087.573420	T	K	102	111
PSM	RKWPQQVVQK	1136	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5502	17.842771428533336	3	1295.746498	1295.746239	P	K	81	91
PSM	KKLVIKNF	1137	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6940	20.3116239008	2	988.643573	988.643337	S	R	41	49
PSM	KKLVIKNF	1138	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6926	20.290407373066667	2	988.643573	988.643337	S	R	41	49
PSM	KKLQFSLK	1139	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7254	20.801737303466666	2	990.622643	990.622602	D	K	86	94
PSM	KRNQKPEV	1140	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3582	14.728846252	2	997.567523	997.566878	A	R	93	101
PSM	KKLQDKIE	1141	sp|Q9UNF0|PACN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3991	15.209222174666667	2	1000.591922	1000.591696	L	K	188	196
PSM	RKQIDDLK	1142	sp|Q99700|ATX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4181	15.6392193144	2	1014.582564	1014.582194	H	K	791	799
PSM	RKLDNTKF	1143	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5022	17.105493353866667	2	1020.572594	1020.571629	V	R	173	181
PSM	RLKELKDQ	1144	sp|P61513|RL37A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3966	15.166495545866667	2	1028.598605	1028.597844	R	-	85	93
PSM	KKVSAQEVR	1145	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3522	14.665329906133334	2	1043.609207	1043.608743	D	K	63	72
PSM	KKKVVDPFS	1146	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6193	18.983297322400002	2	1046.612807	1046.612431	A	K	18	27
PSM	RKEIMLGLK	1147	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7397	21.024648283466668	3	1086.657180	1086.658335	R	R	521	530
PSM	KKKVSYVQL	1148	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6628	19.768221186666665	2	1091.670578	1091.670280	T	K	2178	2187
PSM	RRVEELVAK	1149	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5013	17.09435348	2	1098.653922	1098.650942	A	R	132	141
PSM	KKKEFEETA	1150	sp|O15392|BIRC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3918	15.090489614933334	2	1108.575518	1108.576440	N	K	120	129
PSM	RKAGIFQSVK	1151	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6064	18.784504837866667	3	1132.671157	1132.671677	M	-	66	76
PSM	KRYLTNKVD	1152	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4513	16.326568935466664	3	1135.635542	1135.634957	S	R	677	686
PSM	KRKDDEDSF	1153	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4290	15.915542833333335	2	1138.526722	1138.525467	K	R	406	415
PSM	RHLQLAIRNDEELN	1154	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10178	28.253194245066666	3	1719.902962	1719.901630	P	K	82	96
PSM	RKAFAGELEK	1155	sp|Q8TEV9|SMCR8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5390	17.674453792266668	3	1147.637463	1147.634957	N	K	188	198
PSM	KKLQLIKDY	1156	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7393	21.019579518666667	3	1147.696254	1147.696495	D	R	74	83
PSM	RRSAVPPGADK	1157	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4013	15.243434696266666	3	1152.636752	1152.636354	Y	K	128	139
PSM	KRITEAEKNE	1158	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3455	14.591628254133333	3	1216.641049	1216.641165	E	R	516	526
PSM	KKNPVKFEGGD	1159	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4414	16.149722221333334	3	1217.640359	1217.640437	D	R	611	622
PSM	RKLEEIEAKN	1160	sp|O75179|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4584	16.428028621866666	3	1228.677281	1228.677551	R	K	1497	1507
PSM	RKIKVSNTLES	1161	sp|P36543|VATE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5183	17.349360201333333	3	1273.736019	1273.735400	D	R	188	199
PSM	RKTDPRYTCQ	1162	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=3681	14.8329061088	3	1323.635436	1323.635368	L	R	351	361
PSM	RKLKELEVAEGG	1163	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6476	19.477627354133332	2	1327.749338	1327.745965	Q	K	66	78
PSM	RKFVMKPPQVV	1164	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:35	ms_run[1]:scan=6577	19.680124113066665	3	1343.774239	1343.774763	K	R	200	211
PSM	RKSSGFLNLIKS	1165	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8950	23.6102044432	3	1348.783464	1348.782684	S	R	1065	1077
PSM	KKSNGRPNETDI	1166	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4236	15.7877496248	2	1357.693634	1357.694992	P	K	1003	1015
PSM	KRAKEAAEQDVE	1167	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3616	14.7646335632	3	1372.696035	1372.694657	A	K	197	209
PSM	RKLQNIRDNVE	1168	sp|Q9H081|MIS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5268	17.497063413333333	3	1383.758500	1383.758261	S	K	186	197
PSM	RREFEVYGPIK	1169	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7974	21.9456400848	3	1392.749819	1392.751384	L	R	120	131
PSM	RIRVMLYPSRI	1170	sp|P18077|RL35A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8860	23.426924044266666	3	1402.822696	1402.823109	H	-	100	111
PSM	RRFDEDDDKSF	1171	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6458	19.443848361599997	3	1428.627219	1428.626972	D	R	1124	1135
PSM	KKKCTSNFLSPE	1172	sp|Q99523|SORT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:4	ms_run[1]:scan=6410	19.360690589599997	3	1437.728486	1437.728600	L	K	737	749
PSM	RKPKAEEDEILN	1173	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5442	17.757357442133333	3	1440.757558	1440.757258	D	R	570	582
PSM	RRAYDIAGSTKDV	1174	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6457	19.4427026448	3	1450.752111	1450.752841	V	K	241	254
PSM	RKAEEVQAWAQR	1175	sp|Q9BYN8|RT26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6282	19.13224831706667	3	1470.770476	1470.769160	A	K	141	153
PSM	RHYPVFENPKQG	1176	sp|P55265|DSRAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6463	19.4508381472	3	1470.737802	1470.736797	S	K	987	999
PSM	KRKASGPPVSELIT	1177	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7688	21.485924554933334	3	1481.856993	1481.856578	G	K	33	47
PSM	KRPKVEYSEEEL	1178	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6830	20.1264605848	3	1505.772841	1505.772573	S	K	553	565
PSM	KRKGDEVDGVDEVA	1179	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5720	18.1886795104	3	1515.753795	1515.752900	G	K	207	221
PSM	KKKELQELNELF	1180	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9371	24.80012560133333	3	1517.845920	1517.845344	D	K	74	86
PSM	KRALDKLDGTEING	1181	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6874	20.214037029866667	3	1528.820830	1528.820920	M	R	160	174
PSM	KRKTVTAMDVVYAL	1182	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9612	25.755010742933333	3	1593.891294	1593.891249	A	K	78	92
PSM	KRPKNFGIGQDIQP	1183	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7620	21.382606561600003	3	1596.875975	1596.873625	E	K	34	48
PSM	RKEKAQALEELTGF	1184	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9300	24.547672913600003	3	1618.869868	1618.867871	T	R	1822	1836
PSM	RKDDPRLSFT	1185	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7139	20.6247261592	3	1234.649465	1233.646585	F	R	1806	1816
PSM	KRKQFQLYEEPDT	1186	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7671	21.464097542933334	3	1680.848939	1680.847135	R	K	304	317
PSM	KKDEILDGQKSGDHL	1187	sp|Q15650|TRIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5905	18.476029897866667	3	1681.864714	1681.863514	F	K	88	103
PSM	KKRVEGPGSLGLEESGS	1188	sp|Q12972|PP1R8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6842	20.150150251733333	3	1728.903101	1728.900627	K	R	235	252
PSM	RRIILEAEKMDGAASQG	1189	sp|Q15382|RHEB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=6222	19.028220085866668	3	1859.954191	1859.952346	F	K	161	178
PSM	RKVKNSQSFFSGLFGGSS	1190	sp|P54920|SNAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9856	26.898353426933333	3	1931.988228	1931.985360	E	K	19	37
PSM	RKRDQEEEMDYAPDDVYDY	1191	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8957	23.625143618933336	3	2436.019438	2436.017584	K	K	271	290
PSM	KDKPHNIF	1192	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6061	18.781	2	997.53451	997.5345	L	K	140	148
PSM	KERHTQLEQMF	1193	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35	ms_run[2]:scan=6448	19.429	3	1461.7034	1461.7034	D	R	98	109
PSM	KHDTKLLILALE	1194	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9729	26.291	3	1392.8341	1392.8341	Y	R	833	845
PSM	KHILAKLE	1195	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5779	18.271	2	950.5913	950.5913	G	K	1134	1142
PSM	KHKDAAIYLVTSLAS	1196	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9544	25.438	2	1615.8934	1615.8934	W	K	369	384
PSM	KHKDLQQQLVDA	1197	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7238	20.776	3	1421.7627	1421.7627	F	K	328	340
PSM	KHKELFDELV	1198	sp|P55263-3|ADK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9251	24.392	3	1256.6765	1256.6765	D	K	61	71
PSM	KHKGYGFIEYE	1199	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8328	22.534	3	1369.6667	1369.6667	G	K	205	216
PSM	KHNLLLHL	1200	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8559	22.919	2	986.60253	986.6025	A	K	258	266
PSM	KHPFFLDDR	1201	sp|Q13510-3|ASAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8250	22.4	3	1173.5931	1173.5931	W	R	319	328
PSM	KHRAAEAAINIL	1202	sp|O75569-3|PRKRA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8258	22.413	3	1305.7517	1305.7517	A	K	63	75
PSM	KHRDYETATLSDI	1203	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8364	22.597	3	1547.758	1547.7580	L	K	218	231
PSM	KIENHEGVR	1204	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3547	14.694	3	1080.5676	1080.5676	S	R	255	264
PSM	KKAAVHYD	1205	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3636	14.784	2	930.49232	930.4923	L	R	133	141
PSM	KKHCDDSFTPQE	1206	sp|P36551|HEM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=5014	17.095	3	1490.646	1490.6460	V	K	370	382
PSM	KKHLFENS	1207	sp|Q8NBU5-2|ATAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4762	16.734	2	1001.5294	1001.5294	K	R	113	121
PSM	KKPFSQHV	1208	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4293	15.925	2	969.5396	969.5396	G	R	130	138
PSM	KKVIHPYS	1209	sp|Q96EY4|TMA16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3963	15.161	2	970.56	970.5600	E	R	14	22
PSM	KKYDAFLASESLI	1210	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9819	26.733	3	1483.7922	1483.7922	A	K	105	118
PSM	KLRFPAEDEFPDLSAHNNHMA	1211	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	20-UNIMOD:35	ms_run[2]:scan=9305	24.565	4	2454.1386	2454.1386	L	K	11	32
PSM	KNIEDVIAQGIG	1212	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9960	27.333	2	1255.6772	1255.6772	G	K	49	61
PSM	KNIHLNLDR	1213	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6302	19.16	3	1121.6305	1121.6305	I	R	99	108
PSM	KNSTKSWVGFSGGQHHTVCMDSEG	1214	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	19-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=6977	20.365	4	2651.1493	2651.1493	F	K	290	314
PSM	KPAATHHYLVVPK	1215	sp|Q9NQE9|HINT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5848	18.388	4	1459.83	1459.8300	I	K	78	91
PSM	KQRHDGAFLI	1216	sp|P62993|GRB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8106	22.163	3	1183.6462	1183.6462	S	R	76	86
PSM	KRGHFDYQSLLM	1217	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:35	ms_run[2]:scan=9011	23.745	3	1509.7398	1509.7398	E	R	196	208
PSM	KRLHGLDEEAEQ	1218	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4977	17.045	3	1423.7056	1423.7056	A	K	427	439
PSM	KRLQVGGFEHA	1219	sp|Q9HC21-2|TPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6771	20.032	3	1240.6677	1240.6677	K	R	185	196
PSM	KRSHFVLIAGEPL	1220	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9206	24.267	3	1465.8405	1465.8405	P	R	234	247
PSM	KSHAFSHV	1221	sp|Q9NR12-2|PDLI7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4277	15.884	2	911.46135	911.4613	C	-	416	424
PSM	KVRNHYNEEMSNL	1222	sp|P15924-3|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35	ms_run[2]:scan=4903	16.935	3	1648.7628	1648.7628	A	R	1194	1207
PSM	RAGGKHNDLDDVG	1223	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4470	16.241	3	1352.6433	1352.6433	I	K	77	90
PSM	RAKDHGLEVLGLV	1224	sp|Q96DE0-3|NUD16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9590	25.65	3	1405.8041	1405.8041	T	R	83	96
PSM	RALHHGIDLE	1225	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6149	18.908	3	1159.6098	1159.6098	E	K	341	351
PSM	RALQHSYLH	1226	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5073	17.176	3	1123.5887	1123.5887	F	K	288	297
PSM	RASPLFSQHTAADKH	1227	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5422	17.73	3	1664.8383	1664.8383	F	K	624	639
PSM	RATLEEHLR	1228	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5439	17.753	3	1123.6098	1123.6098	K	R	393	402
PSM	RCPTVRYHT	1229	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4	ms_run[2]:scan=4447	16.21	3	1188.5822	1188.5822	V	K	60	69
PSM	RDLVHSNK	1230	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3570	14.717	2	967.51993	967.5199	C	K	595	603
PSM	REREQQIEEH	1231	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3638	14.786	3	1352.6433	1352.6433	Y	R	226	236
PSM	RFHVEEEGKG	1232	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4745	16.715	3	1186.5731	1186.5731	L	K	95	105
PSM	RGFGHIGIAVPDVYSACK	1233	sp|Q04760-2|LGUL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:4	ms_run[2]:scan=9422	24.97	3	1945.9833	1945.9833	P	R	108	126
PSM	RGHNVAEVQK	1234	sp|O94813-3|SLIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3574	14.721	3	1136.6051	1136.6051	L	R	243	253
PSM	RGLLSSLDHTSIR	1235	sp|P08574|CY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8687	23.139	3	1453.8001	1453.8001	H	R	99	112
PSM	RHASPEDIK	1236	sp|O75190-3|DNJB6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3802	14.966	2	1051.5411	1051.5411	Q	K	12	21
PSM	RHDGKLWNLNNY	1237	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8994	23.702	3	1528.7535	1528.7535	Q	R	1459	1471
PSM	RHESVGHGEDFS	1238	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4559	16.396	3	1355.5854	1355.5854	D	K	585	597
PSM	RHHYEQQQEDLA	1239	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4646	16.539	3	1552.7019	1552.7019	L	R	1319	1331
PSM	RHLFTPADK	1240	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5430	17.741	3	1083.5825	1083.5825	R	R	340	349
PSM	RHLNPDTELK	1241	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5002	17.082	3	1221.6466	1221.6466	H	R	183	193
PSM	RHLYHSSQNELA	1242	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5058	17.155	3	1453.7062	1453.7062	T	K	2222	2234
PSM	RHLYICDYH	1243	sp|O75446|SAP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:4	ms_run[2]:scan=7207	20.736	3	1275.5819	1275.5819	A	K	107	116
PSM	RHMYHSLYL	1244	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35	ms_run[2]:scan=7612	21.37	2	1234.5917	1234.5917	D	K	117	126
PSM	RHPGDSKNYNECI	1245	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:4	ms_run[2]:scan=5363	17.641	3	1588.7052	1588.7052	E	R	124	137
PSM	RHPLKWLPVQESSTDD	1246	sp|Q9Y6A9|SPCS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8759	23.249	3	1906.9537	1906.9537	R	K	139	155
PSM	RHPLLHIQ	1247	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6578	19.682	2	1012.593	1012.5930	F	K	305	313
PSM	RHQGTFTDEKS	1248	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3792	14.956	3	1304.6109	1304.6109	K	K	190	201
PSM	RHYSIKVVPVGAS	1249	sp|Q9NQ55-2|SSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7476	21.148	3	1411.7936	1411.7936	F	R	195	208
PSM	RIAHLVKEL	1250	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7305	20.881	3	1077.6659	1077.6659	A	R	912	921
PSM	RIHETNLK	1251	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3863	15.033	2	1009.5669	1009.5669	A	K	693	701
PSM	RIHMVYSK	1252	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=3867	15.038	2	1048.5488	1048.5488	K	R	131	139
PSM	RIHVPKPLD	1253	sp|Q7Z4H8-3|PLGT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7064	20.497	3	1073.6346	1073.6346	V	R	30	39
PSM	RITPRHLQLAI	1254	sp|Q71UI9-2|H2AV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8607	23.014	3	1316.8041	1316.8041	K	R	81	92
PSM	RKDLVDYITTHY	1255	sp|O75439|MPPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9680	26.061	3	1522.778	1522.7780	S	K	223	235
PSM	RKEWVLDCH	1256	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=7436	21.088	3	1241.5975	1241.5975	V	R	382	391
PSM	RKGPILLHDNA	1257	sp|Q53H47-3|SETMR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5952	18.546	3	1232.699	1232.6990	N	R	441	452
PSM	RKHPSSPECLVSAQ	1258	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:4	ms_run[2]:scan=6203	18.996	3	1594.7886	1594.7886	N	K	72	86
PSM	RKHSEEAEFTPPL	1259	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8242	22.387	3	1539.7682	1539.7682	K	K	313	326
PSM	RKLHELTVMQD	1260	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:35	ms_run[2]:scan=5547	17.921	2	1384.7133	1384.7133	S	R	763	774
PSM	RKLMQLQHE	1261	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5648	18.08	3	1181.6339	1181.6339	S	K	147	156
PSM	RKPDHVPISSEDE	1262	sp|A0AVT1-2|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4996	17.075	3	1507.7267	1507.7267	A	R	335	348
PSM	RKSHEAEVL	1263	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4612	16.484	2	1067.5724	1067.5724	R	K	61	70
PSM	RKVACIGAWHPA	1264	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4	ms_run[2]:scan=7435	21.086	3	1364.7136	1364.7136	L	R	249	261
PSM	RLHDSLAIER	1265	sp|Q15005|SPCS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6382	19.318	3	1208.6626	1208.6626	S	K	214	224
PSM	RLHLAIPTR	1266	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7944	21.902	3	1075.6614	1075.6614	N	R	243	252
PSM	RLHQLDAEKE	1267	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4557	16.393	3	1237.6415	1237.6415	A	R	1059	1069
PSM	RLHTFGNPFKLD	1268	sp|Q9UL03-3|INT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9252	24.393	3	1443.7623	1443.7623	R	K	598	610
PSM	RLKCLLHIV	1269	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=8808	23.33	3	1150.7009	1150.7009	P	R	736	745
PSM	RLKSVVGNLH	1270	sp|P46087-3|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6063	18.783	3	1121.6669	1121.6669	E	R	417	427
PSM	RLPHALHIPL	1271	sp|O95396|MOCS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9098	23.963	3	1165.7084	1165.7084	C	K	366	376
PSM	RLRVDFADTEH	1272	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7644	21.424	3	1357.6739	1357.6739	R	R	477	488
PSM	RLVHAQHFPY	1273	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7462	21.127	3	1266.6622	1266.6622	H	R	570	580
PSM	RMKLLQFCENH	1274	sp|Q13111-2|CAF1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=8649	23.069	3	1474.7173	1474.7173	G	R	556	567
PSM	RMQNHFGAVRSEE	1275	sp|Q7Z3B4-2|NUP54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35	ms_run[2]:scan=4883	16.902	3	1575.7212	1575.7212	I	R	223	236
PSM	RNKLDHYAII	1276	sp|P62750|RL23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8055	22.065	3	1241.6881	1241.6881	R	K	68	78
PSM	RPHALTVHSY	1277	sp|Q9BZL6|KPCD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5835	18.367	3	1179.6149	1179.6149	I	R	137	147
PSM	RQGCHQYVIHNN	1278	sp|P06213-2|INSR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=4418	16.156	3	1524.7004	1524.7004	R	K	298	310
PSM	RQIHKFEELN	1279	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6130	18.873	3	1312.6888	1312.6888	I	R	497	507
PSM	RRDEAGHFLWPGFGENA	1280	sp|Q16822-3|PCKGM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9794	26.614	3	1957.9183	1957.9183	F	R	402	419
PSM	RRMEELHNQEMQ	1281	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=3591	14.737	3	1631.7144	1631.7144	L	K	547	559
PSM	RRPDSTWHSAEVIQS	1282	sp|Q9H7Z6|KAT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7209	20.738	3	1767.8652	1767.8652	C	R	64	79
PSM	RSAHAVKISIEGN	1283	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6253	19.087	3	1380.7474	1380.7474	S	K	478	491
PSM	RTAHSLFK	1284	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5227	17.432	2	958.53485	958.5348	L	R	151	159
PSM	RTNHEDSDKDHSFLTNDELAVLPVV	1285	sp|Q12923-3|PTN13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10014	27.564	4	2850.3784	2850.3784	E	K	2141	2166
PSM	RTRHPDLPFPEIT	1286	sp|Q9P0W2|HM20B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9286	24.502	3	1577.8314	1577.8314	I	K	89	102
PSM	RVAPEEHPVLLTEAPLNP	1287	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9467	25.134	3	1981.0633	1981.0633	L	K	95	113
PSM	RVHHEPQLSD	1288	sp|O43852-9|CALU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4114	15.462	3	1216.5949	1216.5949	D	K	27	37
PSM	RVKGGGHVAQIYAI	1289	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7809	21.675	3	1467.831	1467.8310	V	R	71	85
PSM	RVKVFGWVH	1290	sp|O43776-2|SYNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8805	23.324	3	1126.64	1126.6400	Q	R	127	136
PSM	RVPDHHPC	1291	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=3471	14.611	2	1016.461	1016.4610	K	-	481	489
PSM	RWEAERDDWLHN	1292	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8659	23.091	3	1625.7335	1625.7335	L	R	1014	1026
PSM	RWHQVETTPLREE	1293	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7021	20.435	3	1679.838	1679.8380	Q	K	601	614
PSM	RYSDKHNCPYDY	1294	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:4	ms_run[2]:scan=5869	18.42	3	1616.6678	1616.6678	H	K	179	191
PSM	KKHSQFIGYPITLYLE	1295	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10060	27.7499747704	3	1936.048671	1936.045835	V	K	182	198
PSM	KHRDYETATLSDI	1296	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8102	22.155269966666665	3	1547.758011	1547.757986	L	K	437	450
PSM	KHILAKLE	1297	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5762	18.247099988533332	2	950.591389	950.591302	G	K	1158	1166
PSM	RKPDHVPISSEDE	1298	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4964	17.031347835200002	3	1507.728547	1507.726686	A	R	809	822
PSM	RPHKANAEEMT	1299	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:35	ms_run[1]:scan=3301	14.399358744533334	3	1298.604582	1298.603734	Y	K	55	66
PSM	KHRPSEADEEELA	1300	sp|O14617|AP3D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4894	16.921027564266666	3	1509.691519	1509.705950	P	R	654	667
PSM	RPDHLNSHV	1301	sp|P56270|MAZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4167	15.606188430666666	3	1073.536410	1073.536640	S	R	348	357
PSM	KDKLESEMEDAYHEHQANLL	1302	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9531	25.3783529176	3	2400.113669	2399.106340	A	R	516	536
PSM	RHRDGGEALVSPDGTVTEAP	1303	sp|Q96HN2|SAHH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7585	21.327767112	3	2063.004191	2063.003195	Q	R	97	117
PSM	RARLLTEIHGGAGGPSG	1304	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7294	20.8662223872	3	1648.867565	1647.880501	A	R	147	164
PSM	KPKIHGSGHVEEPASPLAAYQ	1305	sp|Q12955|ANK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7444	21.097258221866664	4	2215.139871	2215.138566	L	K	4284	4305
PSM	KKVGFNPK	1306	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3985	15.195618116266667	2	916.548974	916.549437	L	K	246	254
PSM	KKVGFNPK	1307	sp|P15170|ERF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4001	15.226144980800001	2	916.548974	916.549437	L	K	246	254
PSM	KKVKTPQP	1308	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3619	14.766693838133333	2	924.575751	924.575652	A	K	176	184
PSM	RKLQIGVK	1309	sp|P26885|FKBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5231	17.4374907632	2	940.618491	940.618185	K	K	29	37
PSM	KKLVEKFG	1310	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5271	17.499911338133334	2	947.580446	947.580403	L	K	467	475
PSM	KKNPLKNL	1311	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5382	17.663997775200002	2	953.602741	953.602201	L	R	315	323
PSM	KKKAQEDL	1312	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3712	14.860551484266667	2	958.545165	958.544745	K	-	498	506
PSM	KKLEDIRT	1313	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4711	16.654937874933335	2	1001.587196	1001.586945	S	R	1206	1214
PSM	RKYDTPKT	1314	sp|P43308|SSRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3698	14.846764336533333	2	1007.540180	1007.539994	K	K	173	181
PSM	KKKQTNYL	1315	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4592	16.4410140288	2	1021.592119	1021.592030	G	R	4441	4449
PSM	KKFKDPNAP	1316	sp|B2RPK0|HGB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3990	15.208336745333334	2	1043.577004	1043.576380	K	K	87	96
PSM	RKYAQAIKA	1317	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4460	16.227928035466665	2	1047.619414	1047.618913	E	K	371	380
PSM	KKMGGIKGLF	1318	sp|P61011|SRP54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8417	22.692433306133335	3	1077.636585	1077.636872	V	K	432	442
PSM	RKTPAQPQR	1319	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3334	14.441335606933334	3	1080.616776	1080.615225	S	R	111	120
PSM	RKEWLTNFMEDR	1320	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9477	25.16599816	3	1623.782768	1623.782761	D	R	661	673
PSM	RKLTPKEAF	1321	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5784	18.27947683893333	3	1088.634170	1088.634229	G	R	718	727
PSM	KRLVIQDKN	1322	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4241	15.808720501066666	3	1112.666948	1112.666592	R	K	34	43
PSM	RKDKETGGIL	1323	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5447	17.764732328266668	3	1115.630292	1115.629872	K	R	287	297
PSM	RKIKAAVEDP	1324	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4429	16.183519954666668	3	1125.650025	1125.650607	L	R	437	447
PSM	KKWQDEDGK	1325	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3703	14.85295388	3	1132.551524	1132.551287	C	K	135	144
PSM	KKYGLKPPTL	1326	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7623	21.388250150933334	3	1143.701529	1143.701580	A	-	599	609
PSM	KKVKNVGIFL	1327	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8472	22.7846970272	3	1144.733183	1144.733215	K	K	423	433
PSM	RKSDFFINK	1328	sp|Q5GLZ8|HERC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7019	20.431968981333334	3	1153.624358	1153.624393	P	R	26	35
PSM	KKDGADFAKW	1329	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7664	21.4536851712	3	1164.592857	1164.592758	Y	R	139	149
PSM	RKLIKDGLII	1330	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8626	23.036220381066666	3	1168.774648	1167.770329	I	R	42	52
PSM	KKDQYFLDK	1331	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6379	19.3128991872	3	1183.624129	1183.623724	A	K	105	114
PSM	KRDPSKQYGL	1332	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5507	17.8515151384	3	1190.641495	1190.640771	Y	K	248	258
PSM	RKCLEELQK	1333	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=4800	16.7870973448	3	1204.647558	1202.644142	L	R	161	170
PSM	RKLDNKDLFG	1334	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7342	20.9410761672	3	1204.655747	1204.656421	A	K	148	158
PSM	RKKMMEIMT	1335	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35,5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3717	14.866882794133334	2	1214.582433	1214.582136	I	R	165	174
PSM	RKASQLVGIEK	1336	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5601	18.00174961946667	3	1227.730900	1227.729920	K	K	181	192
PSM	KRTQPPPKLPVGPSH	1337	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5601	18.00174961946667	4	1637.937074	1637.936559	S	K	33	48
PSM	RKNITNDIRT	1338	sp|Q12789|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5020	17.103865968533334	3	1231.689081	1229.684033	E	K	120	130
PSM	KKIDKYTEVL	1339	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7314	20.892074144266665	3	1235.712476	1235.712539	E	K	187	197
PSM	KKAKEDFLVY	1340	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8260	22.415968277066668	3	1239.686206	1239.686324	H	K	83	93
PSM	RKLSQMILDK	1341	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:35	ms_run[1]:scan=5947	18.538933542133336	3	1246.706687	1246.706743	E	K	363	373
PSM	RKFEEETVKS	1342	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4374	16.0812247536	3	1251.646614	1251.645916	Q	K	274	284
PSM	RKWPQQVVQK	1343	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5635	18.063532453333334	3	1297.757803	1295.746239	P	K	81	91
PSM	RKPFPDFVYK	1344	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8773	23.272539895466664	3	1295.703976	1295.702643	P	R	471	481
PSM	RKEVPKQQAAY	1345	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3943	15.127820607733334	3	1316.719717	1316.720084	G	R	119	130
PSM	RKEWVTPKEF	1346	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8051	22.059268559733333	3	1318.704320	1318.703371	N	R	330	340
PSM	RKIYQSVKNEG	1347	sp|Q14527|HLTF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4237	15.793101669066667	2	1321.720310	1320.714999	E	R	675	686
PSM	RKKVPVSVNLLS	1348	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7952	21.91527775386667	3	1338.834723	1338.834720	Q	K	176	188
PSM	RKMVDQLFCK	1349	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7020	20.433806456533333	3	1339.671478	1339.674063	L	K	467	477
PSM	RRAGDLLEDSPK	1350	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6248	19.081307130133332	3	1355.714500	1355.715727	K	R	156	168
PSM	RKNMQLTAGSKL	1351	sp|O75934|SPF27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=5135	17.27167740186667	3	1361.746150	1361.744919	Q	R	167	179
PSM	KKKPLFITTDSS	1352	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6757	20.011298743466668	3	1363.771291	1363.771117	A	K	688	700
PSM	RKTETRVEEAF	1353	sp|Q9ULI0|ATD2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6328	19.2127083152	3	1364.705142	1364.704828	A	R	1102	1113
PSM	RKKVCDIAAELA	1354	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=7999	21.979985712533335	3	1372.749515	1372.749670	M	R	106	118
PSM	RRLEVLDSTKSS	1355	sp|P0C7P4|UCRIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5995	18.6290037712	3	1389.756680	1389.757592	Y	R	101	113
PSM	RKENQWCEEK	1356	sp|P63208|SKP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4	ms_run[1]:scan=4355	16.0497707504	3	1405.641053	1405.640848	V	-	154	164
PSM	KRKSDGIYIINL	1357	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9372	24.802415167466666	3	1418.824861	1418.824549	Y	K	40	52
PSM	RKKAVLFCLSED	1358	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=8716	23.17875066	3	1464.776802	1464.775885	K	K	32	44
PSM	KREQAEEERYF	1359	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6775	20.041400637866666	3	1483.706040	1483.705556	G	R	49	60
PSM	RKVQTILEKLEQ	1360	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8844	23.397557809866665	3	1483.875276	1483.872228	V	K	485	497
PSM	RRPEGASNESERD	1361	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3327	14.4330713432	3	1501.686997	1501.686946	L	-	365	378
PSM	RKAEEKYEVLEN	1362	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6162	18.926510089866667	3	1506.772795	1506.767822	Q	K	767	779
PSM	KKGKVPVTYLELLS	1363	sp|Q9NR46|SHLB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9603	25.711077760000002	3	1573.946415	1573.944330	N	-	382	396
PSM	RREIGILTTNKNTS	1364	sp|Q8IZP0|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6447	19.427848457866666	3	1601.885585	1601.884918	A	R	106	120
PSM	RRFSDQFPLPLKE	1365	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9309	24.577391529866667	3	1631.879889	1631.878376	W	R	878	891
PSM	KKKELVNNLGEIYQ	1366	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8166	22.250617311200003	3	1674.933219	1674.930471	S	K	327	341
PSM	RKRDAEDDGEEEDD	1367	sp|Q9BTT0|AN32E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3390	14.517218405066666	3	1677.672022	1677.671415	K	-	255	269
PSM	KKKNPEVPVNFAEFS	1368	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9119	24.01003714746667	3	1733.920349	1732.914821	H	K	28	43
PSM	KRKDADVEDEDTEEA	1369	sp|O60306|AQR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3958	15.156430883466667	3	1748.771780	1748.770067	K	K	760	775
PSM	RRSECNMCNTPKYA	1370	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=5089	17.198132040533334	3	1785.771636	1785.770893	A	K	81	95
PSM	RKQEAEWKE	1371	sp|P09496|CLCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4412	16.1463451464	2	1202.604723	1202.604386	S	K	129	138
PSM	KKRLVQSPNSYFMDV	1372	sp|Q71UM5|RS27L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9063	23.875506499999997	3	1810.941538	1810.939990	K	K	21	36
PSM	RKTGYSFVNCK	1373	sp|P43897|EFTS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=5931	18.514308893066666	3	1358.674910	1358.676505	R	K	55	66
PSM	KRKIQVLQQQADDAEE	1374	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6265	19.102571513066668	3	1897.987284	1897.985754	V	R	11	27
PSM	RKDVGRPNFEEGGPTSVG	1375	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6942	20.315059460533334	3	1900.935465	1900.939138	G	R	174	192
PSM	RRQFEDEKANWEAQQ	1376	sp|Q16181|SEPT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6773	20.037679943199997	3	1933.903754	1933.903087	K	R	401	416
PSM	KKALEEETKNHEAQIQDM	1377	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6514	19.555612165866666	4	2141.043449	2141.042283	L	R	1180	1198
PSM	RRKEDPALPTQVPLQYNEL	1378	sp|O14578|CTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9488	25.206110208	3	2266.213437	2266.206980	S	K	1243	1262
PSM	KKYEDICPSTHNMDVPNIK	1379	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=7582	21.324565149066665	4	2304.088848	2304.087853	G	R	67	86
PSM	KAGFAGDDAPRAVFPSIVG	1380	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9747	26.39	3	1873.9686	1873.9686	C	R	18	37
PSM	KAKYHGNVMLL	1381	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=7127	20.608	3	1288.6962	1288.6962	P	R	2436	2447
PSM	KCHEFLIFEDR	1382	sp|P11172-4|UMPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=9292	24.522	3	1492.7133	1492.7133	A	K	125	136
PSM	KDHHFDMINI	1383	sp|Q9P032|NDUF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9204	24.26	3	1268.5972	1268.5972	P	K	97	107
PSM	KDKSHFTD	1384	sp|P62495-2|ERF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3677	14.827	2	976.46141	976.4614	E	K	319	327
PSM	KFHPIQGH	1385	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4491	16.288	2	962.50863	962.5086	V	R	159	167
PSM	KFLPHKYDV	1386	sp|Q9UIG0-2|BAZ1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7063	20.496	3	1145.6233	1145.6233	P	K	216	225
PSM	KGPVREGDVLTLLESE	1387	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10086	27.855	3	1740.9258	1740.9258	V	R	47	63
PSM	KGREYGYASLH	1388	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5974	18.596	3	1279.6309	1279.6309	G	K	677	688
PSM	KHFFINICH	1389	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4	ms_run[2]:scan=8565	22.925	3	1214.6019	1214.6019	K	R	512	521
PSM	KHHIPVVD	1390	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5473	17.806	2	943.52395	943.5240	K	R	67	75
PSM	KHKELQQQLVDA	1391	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6435	19.406	3	1435.7783	1435.7783	F	K	163	175
PSM	KHKSETDTSLI	1392	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5896	18.463	3	1257.6565	1257.6565	M	R	152	163
PSM	KHPHVANP	1393	sp|Q5JVF3-3|PCID2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3571	14.719	2	898.47733	898.4773	F	R	32	40
PSM	KHSLSGRPL	1394	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4594	16.443	2	993.57196	993.5720	N	K	134	143
PSM	KHVVFGHV	1395	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5843	18.383	2	921.51847	921.5185	G	K	167	175
PSM	KILESHQFSPHNHP	1396	sp|Q15475|SIX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5901	18.471	3	1669.8325	1669.8325	Y	K	68	82
PSM	KIRFANHSVNPNCYA	1397	sp|Q92800-5|EZH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:4	ms_run[2]:scan=7629	21.397	3	1789.8682	1789.8682	N	K	545	560
PSM	KKDDEENYLDLFSH	1398	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9740	26.347	3	1751.8002	1751.8002	S	K	138	152
PSM	KKDWLFAPHY	1399	sp|Q15008-3|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9171	24.167	3	1303.6713	1303.6713	M	R	244	254
PSM	KKHLEDEL	1400	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5535	17.898	2	1010.5397	1010.5397	R	-	165	173
PSM	KKHLELYD	1401	sp|Q8TED0-2|UTP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5986	18.618	2	1044.5604	1044.5604	A	R	168	176
PSM	KKHPDSSVNFAEFS	1402	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8392	22.651	3	1591.7631	1591.7631	K	K	29	43
PSM	KKPHTLLQ	1403	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4743	16.711	2	963.58655	963.5866	V	R	378	386
PSM	KLKHLNLGMN	1404	sp|Q15404-2|RSU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=5844	18.384	3	1182.6543	1182.6543	Q	R	34	44
PSM	KLRDLHPDLEGQL	1405	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8639	23.053	3	1532.8311	1532.8311	G	K	265	278
PSM	KLRHVGSNLCLDS	1406	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:4	ms_run[2]:scan=6935	20.302	3	1497.7722	1497.7722	S	R	530	543
PSM	KPKHLLSG	1407	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4164	15.6	2	878.53379	878.5338	M	K	501	509
PSM	KPVHHGVNQL	1408	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4296	15.93	3	1127.62	1127.6200	G	K	83	93
PSM	KPVTYEEAHAPHYIAH	1409	sp|Q96EL2|RT24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6332	19.219	4	1861.9111	1861.9111	D	R	49	65
PSM	KQFGAQVHR	1410	sp|Q8NFW8-2|NEUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4054	15.319	3	1069.5781	1069.5781	A	R	102	111
PSM	KQFHDSKI	1411	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4315	15.977	2	1001.5294	1001.5294	V	K	143	151
PSM	KQKHVLCAYCYE	1412	sp|Q9BYC8|RM32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7003	20.411	3	1597.7381	1597.7381	L	K	117	129
PSM	KQVHPDTGISS	1413	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4257	15.843	2	1167.5884	1167.5884	L	K	47	58
PSM	KRHEGSSSESVPPGTTIS	1414	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4893	16.918	3	1854.9072	1854.9072	E	R	16	34
PSM	KRYQEALHLGSQLL	1415	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9220	24.3	3	1654.9155	1654.9155	T	R	141	155
PSM	KSHLNLDDR	1416	sp|Q5SY16|NOL9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4768	16.742	3	1096.5625	1096.5625	L	R	200	209
PSM	KSKHGSIEADF	1417	sp|Q9NV66-2|TYW1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6685	19.878	3	1217.6041	1217.6041	V	R	219	230
PSM	KSRGAHLASADEL	1418	sp|O60279|SUSD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5908	18.481	3	1353.7001	1353.7001	C	R	62	75
PSM	KSSVHQPGSHYCQGCAYK	1419	sp|Q9P021|CRIPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4334	16.02	4	2092.9207	2092.9207	C	K	62	80
PSM	KTKIYHPNIDE	1420	sp|P68036-2|UB2L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5855	18.397	3	1356.7038	1356.7038	F	K	39	50
PSM	KTKIYHPNIDE	1421	sp|P68036-2|UB2L3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5863	18.411	3	1356.7038	1356.7038	F	K	39	50
PSM	KTRTYHSVGDSVL	1422	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6776	20.044	3	1461.7576	1461.7576	L	R	89	102
PSM	KVRAWGPGLHGGIVG	1423	sp|O75369-4|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8367	22.604	2	1502.847	1502.8470	Q	R	551	566
PSM	KWVNPHKL	1424	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6212	19.009	2	1020.5869	1020.5869	Y	-	508	516
PSM	RAFDHVLHL	1425	sp|Q9H6R4-3|NOL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8854	23.418	3	1106.5985	1106.5985	I	R	468	477
PSM	RAGVHIKLPNLG	1426	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8651	23.073	3	1273.7619	1273.7619	L	K	292	304
PSM	RAIGDHFYK	1427	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5911	18.484	3	1105.5669	1105.5669	S	R	398	407
PSM	RAQLAPHAPHPSHP	1428	sp|Q9P246-3|STIM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4774	16.75	4	1514.7855	1514.7855	Q	R	528	542
PSM	RCAHGQEELNEWLDR	1429	sp|Q9UGR2|Z3H7B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=8962	23.64	3	1911.8646	1911.8646	C	R	908	923
PSM	RCKELGITALHI	1430	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=9125	24.03	3	1409.7813	1409.7813	Q	K	84	96
PSM	REEIHEYR	1431	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4230	15.774	3	1130.5469	1130.5469	S	R	309	317
PSM	REGFTWKGHE	1432	sp|Q15334|L2GL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6953	20.332	3	1245.5891	1245.5891	D	R	563	573
PSM	REHFQHVAAPYIA	1433	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7889	21.798	3	1537.779	1537.7790	Y	K	186	199
PSM	REHIEKLE	1434	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4662	16.558	2	1052.5615	1052.5615	L	R	73	81
PSM	REHIKVQQLMA	1435	sp|Q04637-3|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=6371	19.289	3	1367.7344	1367.7344	H	K	975	986
PSM	REHQEALHQQ	1436	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3526	14.671	3	1274.6116	1274.6116	L	R	428	438
PSM	REKILNHLSTL	1437	sp|Q12899|TRI26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8218	22.355	3	1322.767	1322.7670	H	R	146	157
PSM	RERIVGWYHTGP	1438	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8089	22.118	3	1469.7528	1469.7528	A	K	88	100
PSM	RFYGKNSSYVHGGLDSNG	1439	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6762	20.019	3	1956.9078	1956.9078	H	K	32	50
PSM	RGTHMQHAYDFY	1440	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7788	21.633	3	1524.6568	1524.6568	L	K	194	206
PSM	RGYFEYIEENKYS	1441	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9378	24.823	3	1696.7733	1696.7733	G	R	236	249
PSM	RHDSPEDVK	1442	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3509	14.652	3	1081.5152	1081.5152	N	R	454	463
PSM	RHGYMGHLT	1443	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:35	ms_run[2]:scan=4038	15.293	2	1086.5029	1086.5029	R	R	403	412
PSM	RHHGPPGPTFF	1444	sp|Q9BRK4|LZTS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8287	22.465	3	1248.6152	1248.6152	P	R	46	57
PSM	RHLPNLQTH	1445	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5622	18.033	3	1114.5996	1114.5996	S	K	45	54
PSM	RHLTGEFEK	1446	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5007	17.088	3	1115.5724	1115.5724	K	K	29	38
PSM	RHSQYHVDGSLE	1447	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5658	18.093	3	1426.6589	1426.6589	I	K	104	116
PSM	RHSSHGSDVSLSQIL	1448	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8949	23.609	3	1621.8172	1621.8172	D	K	1483	1498
PSM	RHVPTHFSQQNSS	1449	sp|Q6ZN18-3|AEBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4525	16.342	3	1523.7229	1523.7229	A	K	131	144
PSM	RHVTSRDLISNSP	1450	sp|P19387|RPB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6237	19.065	3	1480.7746	1480.7746	T	R	113	126
PSM	RIASHSHV	1451	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3548	14.696	2	905.48315	905.4831	Q	K	14	22
PSM	RIHIVMKSD	1452	sp|Q9Y4Y9|LSM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=4502	16.312	3	1113.5965	1113.5965	S	K	25	34
PSM	RIIPRHLQLAI	1453	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9019	23.766	3	1328.8405	1328.8405	T	R	78	89
PSM	RILMEHIH	1454	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6487	19.503	3	1047.5648	1047.5648	K	K	136	144
PSM	RILNHSVDK	1455	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4020	15.254	3	1080.604	1080.6040	H	K	626	635
PSM	RITNHIHV	1456	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5657	18.092	2	988.55665	988.5566	D	R	276	284
PSM	RKAHEILPNLVCCSA	1457	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8636	23.05	3	1766.892	1766.8920	C	K	64	79
PSM	RKATHDEAINVL	1458	sp|O75970-5|MPDZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7221	20.752	3	1365.7365	1365.7365	L	R	1653	1665
PSM	RKDGNASGTTLLEALDCILPPT	1459	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:4	ms_run[2]:scan=10610	30.127	3	2341.1948	2341.1948	T	R	218	240
PSM	RKDHPFGFVAVPT	1460	sp|P63279|UBC9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9108	23.988	3	1469.7779	1469.7779	W	K	17	30
PSM	RKDLQHPNEFI	1461	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7767	21.601	3	1395.7259	1395.7259	Y	R	106	117
PSM	RKGICEYHE	1462	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:4	ms_run[2]:scan=4393	16.109	3	1190.5502	1190.5502	L	K	84	93
PSM	RKGNNESYHYA	1463	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4172	15.622	2	1337.6113	1337.6113	P	R	553	564
PSM	RKICTYFH	1464	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4	ms_run[2]:scan=6700	19.905	3	1123.5597	1123.5597	M	R	707	715
PSM	RKNGGLGHMNIALLSDLT	1465	sp|P30048-2|PRDX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9928	27.203	3	1909.0204	1909.0204	P	K	130	148
PSM	RKPALELLHYL	1466	sp|P51398-2|RT29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9825	26.762	3	1351.7976	1351.7976	V	K	61	72
PSM	RKPDHVPISSEDE	1467	sp|A0AVT1-2|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5055	17.153	3	1507.7267	1507.7267	A	R	335	348
PSM	RKQGLDNVH	1468	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3754	14.908	3	1065.5679	1065.5679	S	K	494	503
PSM	RKQLGLPHQ	1469	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5163	17.317	3	1075.6251	1075.6251	E	R	772	781
PSM	RKSAISDHL	1470	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5354	17.629	2	1025.5618	1025.5618	V	K	54	63
PSM	RKSNVESALSHGL	1471	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7677	21.471	3	1396.7423	1396.7423	K	K	362	375
PSM	RLHGGKDAASP	1472	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3531	14.676	3	1107.5785	1107.5785	T	R	809	820
PSM	RLHTGEKPY	1473	sp|Q9P0L1|ZKSC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4262	15.852	3	1099.5774	1099.5774	Q	K	627	636
PSM	RLHTGIKPY	1474	sp|Q96N58|ZN578_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5684	18.132	3	1083.6189	1083.6189	R	K	363	372
PSM	RLKAALHDQLN	1475	sp|O75971-2|SNPC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5749	18.23	3	1277.7204	1277.7204	L	R	17	28
PSM	RLKLEPHEGLLL	1476	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9258	24.407	3	1416.8453	1416.8453	E	R	512	524
PSM	RLKMEGHEAME	1477	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35	ms_run[2]:scan=4385	16.097	3	1345.6119	1345.6119	K	R	31	42
PSM	RLKSHFQAQLQQEM	1478	sp|Q96CN9|GCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:35	ms_run[2]:scan=6662	19.83	3	1758.8835	1758.8835	A	R	329	343
PSM	RLPKDDVHA	1479	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4539	16.363	2	1049.5618	1049.5618	S	K	1883	1892
PSM	RMHSLLIKNL	1480	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8619	23.028	3	1223.7172	1223.7172	D	K	431	441
PSM	RNGHVLLTVR	1481	sp|Q5TCQ9-3|MAGI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6287	19.138	3	1163.6887	1163.6887	A	R	798	808
PSM	RNKVLNHFSIMQQ	1482	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35	ms_run[2]:scan=7482	21.157	3	1629.8409	1629.8409	R	R	167	180
PSM	RPHCVPDYH	1483	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4	ms_run[2]:scan=4680	16.59	3	1179.5244	1179.5244	N	K	489	498
PSM	RPMHVKMDE	1484	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=3306	14.405	3	1173.5271	1173.5271	D	R	233	242
PSM	RQKHEIESLYT	1485	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6779	20.047	3	1402.7205	1402.7205	S	K	1686	1697
PSM	RQRDISHSIVLPAAVSSAHPVP	1486	sp|Q6UB28|MAP12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9005	23.729	4	2336.2713	2336.2713	R	K	44	66
PSM	RQTVRSHGVLGLY	1487	sp|P53007|TXTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8269	22.431	3	1484.8212	1484.8212	V	R	72	85
PSM	RRLITVALH	1488	sp|Q8N6R0-1|EFNMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7540	21.255	3	1077.6771	1077.6771	F	R	175	184
PSM	RSHVVREDLNP	1489	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5333	17.584	2	1320.6898	1320.6898	F	R	688	699
PSM	RSKENHADLGIFV	1490	sp|Q8TEW0-5|PARD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8923	23.556	3	1484.7736	1484.7736	N	K	552	565
PSM	RSRTHSTSSSLGSGESPFS	1491	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6889	20.238	4	1965.914	1965.9140	A	R	237	256
PSM	RSVHKVEPIT	1492	sp|P25787|PSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4526	16.344	3	1164.6615	1164.6615	E	K	60	70
PSM	RTKGLWGPVHELG	1493	sp|Q9Y4C2-2|TCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8594	22.984	3	1448.7888	1448.7888	I	R	748	761
PSM	RTREGNDLYHEMIESGVINL	1494	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10221	28.439	3	2345.1434	2345.1434	E	K	239	259
PSM	RTVRGMLPH	1495	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6126	18.868	3	1065.5866	1065.5866	W	K	82	91
PSM	RVHMFEAHSDYI	1496	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:35	ms_run[2]:scan=7441	21.094	3	1519.6878	1519.6878	E	R	62	74
PSM	RVHTGEKPY	1497	sp|Q86WZ6-2|ZN227_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3880	15.051	3	1085.5618	1085.5618	R	K	377	386
PSM	RVKLGHTDILVGV	1498	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9014	23.753	3	1405.8405	1405.8405	A	K	50	63
PSM	RVRAISAANLHL	1499	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8543	22.887	3	1319.7786	1319.7786	W	R	2074	2086
PSM	RYIHAAGIIH	1500	sp|P53778|MK12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6694	19.895	3	1149.6407	1149.6407	L	R	142	152
PSM	RYIPFTHGK	1501	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6445	19.424	3	1117.6033	1117.6033	Y	R	173	182
PSM	KKHSQFIGYPITLFVE	1502	sp|Q58FG0|HS905_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10271	28.654510410133334	3	1906.038377	1906.035270	V	K	38	54
PSM	RDTSFEQHVLWHTGG	1503	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=8830	23.371857772266665	3	1769.8522	1768.8272	S	K	1724	1739
PSM	KDHLVTAYNHLFETK	1504	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8344	22.5569193752	4	1815.917361	1814.931534	N	R	56	71
PSM	RKCCNHPYLINGAEE	1505	sp|Q8TD26|CHD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=6663	19.8319062744	3	1860.838245	1859.840687	L	K	742	757
PSM	RKGLFFEHDL	1506	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9061	23.869060857066664	3	1260.661459	1260.661507	P	R	184	194
PSM	KPKIHGSGHVEEPASPLAAYQ	1507	sp|Q12955|ANK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7483	21.1587785696	4	2215.139871	2215.138566	L	K	4284	4305
PSM	RSLFVHKVDP	1508	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6965	20.350586281333335	3	1196.667007	1196.666592	F	R	45	55
PSM	RSLFVHKVDP	1509	sp|Q9BPW8|NIPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6901	20.256886743733332	3	1196.667007	1196.666592	F	R	45	55
PSM	KHVVFIAQR	1510	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5909	18.482594362133334	3	1096.649799	1096.650548	G	R	90	99
PSM	RKVLGEKG	1511	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3615	14.764019365333333	2	885.539990	885.539600	V	K	255	263
PSM	KKKLGLTQ	1512	sp|Q00325|MPCP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4097	15.4224147928	2	914.591478	914.591302	L	-	355	363
PSM	KKLKETLA	1513	sp|Q8NCA5|FA98A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4212	15.715810513333334	2	929.590679	929.590967	E	K	173	181
PSM	KKPKFELG	1514	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6159	18.92151216426667	2	945.565151	945.564753	L	K	219	227
PSM	KKKINLEL	1515	sp|Q9BTT0|AN32E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7281	20.847070648800003	2	984.633288	984.633166	M	R	4	12
PSM	KKKITDVLA	1516	sp|Q9BQ75|CMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6315	19.1877418344	2	1014.644249	1014.643731	R	K	75	84
PSM	RKVIPKDY	1517	sp|P10644|KAP0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4782	16.763111875466667	2	1017.597775	1017.597115	V	K	115	123
PSM	RKLDDTKF	1518	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5698	18.15337973946667	2	1021.556260	1021.555644	L	R	163	171
PSM	KKKDEEFQ	1519	sp|Q9HC07|TM165_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3761	14.916238676266666	2	1050.538043	1050.534575	L	R	198	206
PSM	RKLLPPSEK	1520	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6493	19.51661658826667	3	1066.649951	1066.649879	A	R	630	639
PSM	RKLLPPSEK	1521	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4482	16.262946724533332	3	1066.650764	1066.649879	A	R	630	639
PSM	RKGVITVKDG	1522	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4251	15.833540970400001	3	1071.640342	1071.640043	G	K	195	205
PSM	RKTKAATILT	1523	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4866	16.8816133072	3	1101.685231	1101.686993	F	K	485	495
PSM	RKSEDDEKL	1524	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3879	15.050383584799999	3	1118.556515	1118.556767	S	K	166	175
PSM	KKSFLEDIR	1525	sp|P52209|6PGD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8033	22.025825039999997	3	1134.639746	1134.639708	D	K	316	325
PSM	RKQLDKEQV	1526	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3905	15.076368956533335	3	1142.640421	1142.640771	A	R	28	37
PSM	RKVEKIDDF	1527	sp|P04818|TYSY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6501	19.536137469333333	3	1148.619375	1148.618973	L	K	283	292
PSM	RRSAVPPGADK	1528	sp|P46783|RS10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3561	14.708846284	2	1152.639012	1152.636354	Y	K	128	139
PSM	KKKVLLGVGDP	1529	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6712	19.929060152533335	3	1152.722717	1152.723044	K	K	88	99
PSM	RKTTPKEPTE	1530	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3482	14.625253245333333	3	1185.636361	1185.635351	R	K	325	335
PSM	RKPMTTKDLL	1531	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7053	20.480316717066668	3	1201.684464	1201.685278	T	K	465	475
PSM	KKKDGGAQLLF	1532	sp|Q9NW15|ANO10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8313	22.5067405152	3	1203.697889	1203.697558	A	R	42	53
PSM	RKFEQMKQD	1533	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4000	15.225199616266668	3	1208.597120	1208.597192	K	R	278	287
PSM	RLLEVQGSRPG	1534	sp|P62136|PP1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5448	17.767020202399998	3	1212.692170	1210.678219	G	K	15	26
PSM	KKGKLDDYQE	1535	sp|Q14444|CAPR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4246	15.819211844533333	3	1222.619715	1222.619367	K	R	71	81
PSM	KRAQSEAEKLA	1536	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4119	15.473707884266666	2	1229.673669	1229.672800	R	K	380	391
PSM	RKIVDQIRPD	1537	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5445	17.761630530133335	3	1238.710787	1238.709519	I	R	340	350
PSM	RKPKSQETPAT	1538	sp|P09012|SNRPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3336	14.444262552	3	1241.673636	1241.672800	K	K	111	122
PSM	RKQKGAETELV	1539	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4920	16.9617546672	3	1257.702929	1257.704100	A	R	19	30
PSM	KKGRSAINEVVT	1540	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5367	17.644687314666665	3	1300.747543	1300.746299	K	R	11	23
PSM	RKGIVCNLCGK	1541	sp|Q9NUD5|ZCHC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=5606	18.009061950133333	3	1303.682826	1303.685296	C	R	367	378
PSM	KKKEGETVEPY	1542	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4624	16.502751229066668	3	1306.674693	1306.676882	T	K	264	275
PSM	RKLFTDLFDR	1543	sp|Q9Y6M4|KC1G3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9468	25.139129443199998	3	1309.714365	1309.714270	L	K	305	315
PSM	KPKPIDVQVITHHMQ	1544	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:35	ms_run[1]:scan=6930	20.296047125066664	4	1785.956512	1785.955975	L	R	359	374
PSM	RKLLEEEEKNA	1545	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5269	17.498048656533335	3	1357.719669	1357.720144	K	R	751	762
PSM	RKLQFFCDPR	1546	sp|Q53H12|AGK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=8300	22.486596987200002	3	1365.697819	1365.697575	P	K	402	412
PSM	RKKELDEEESI	1547	sp|Q96EK5|KBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5677	18.120123895733332	3	1374.699513	1374.699074	L	R	348	359
PSM	KRVEPLRNELQ	1548	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5942	18.53309400186667	3	1380.783507	1380.783747	L	K	3407	3418
PSM	RRGTTVYLCEK	1549	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:4	ms_run[1]:scan=5463	17.793846708266663	3	1381.713732	1381.713619	A	R	525	536
PSM	RKLGNLVKNTLE	1550	sp|Q5VW32|BROX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7459	21.123041510666667	3	1383.817700	1383.819798	F	K	310	322
PSM	KRATWETILDGK	1551	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9229	24.320664110666666	3	1416.772440	1416.772514	K	R	330	342
PSM	RGEPHVTR	1552	sp|P67775|PP2AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3565	14.711727468800001	2	951.509598	950.504612	R	R	295	303
PSM	KKKNVIQSVLQAI	1553	sp|Q7L576|CYFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10013	27.5584072704	3	1467.914314	1467.913699	K	R	502	515
PSM	RKLDEKGSLQWD	1554	sp|Q9H857|NT5D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7535	21.246807357066665	3	1473.759275	1473.757592	F	R	312	324
PSM	KKRDITVLDLGCG	1555	sp|O43148|MCES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=8672	23.109517827466668	3	1473.800968	1473.797348	K	K	195	208
PSM	RHDWNSLLSHDP	1556	sp|Q8IWF2|FXRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8788	23.297260425599998	3	1475.678341	1475.690575	L	R	96	108
PSM	RRESVNLGKSEGF	1557	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7007	20.41656293786667	3	1477.761247	1477.763740	G	K	371	384
PSM	RKVVKLFNEVQE	1558	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7870	21.765624629066668	3	1487.847229	1487.846013	I	K	900	912
PSM	KKKNCTYTQVQT	1559	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4	ms_run[1]:scan=4155	15.573388494133333	3	1497.759937	1497.760963	C	R	267	279
PSM	KRALEKLDGTEVNG	1560	sp|Q08170|SRSF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5944	18.534845989066664	3	1528.821471	1528.820920	M	R	154	168
PSM	RRYDDPEVQKDI	1561	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6723	19.9479991784	3	1532.757539	1532.758320	G	K	126	138
PSM	KRKQNDVFGEAEQ	1562	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5819	18.338980957866667	3	1547.770633	1547.769219	M	-	435	448
PSM	RKFNLDATELSIR	1563	sp|O43752|STX6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8965	23.64612950613333	3	1561.860413	1561.857640	P	K	76	89
PSM	KKYHNVGLS	1564	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4492	16.290621426666668	2	1044.572103	1044.571629	E	K	242	251
PSM	RKREDDDDDDDDDDDYDNL	1565	sp|Q16594|TAF9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6978	20.3668547456	3	2357.865588	2357.863980	K	-	246	265
PSM	RKIKETVDQVEEL	1566	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7941	21.896773743733334	3	1585.867998	1585.867536	L	R	3206	3219
PSM	KKRTVTAAGAENIQQ	1567	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4483	16.263732054133335	3	1613.888747	1613.884918	G	K	1237	1252
PSM	KKKELVNNLAEIYG	1568	sp|Q9NZN3|EHD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8762	23.254896007466666	3	1617.910303	1617.909007	N	R	327	341
PSM	KRKQELAETLANLE	1569	sp|Q9HAF1|EAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8888	23.4754739592	3	1641.906161	1641.904984	V	R	24	38
PSM	KRSRDPPASASQVTGI	1570	sp|P26358-2|DNMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6325	19.208872949866667	3	1668.893150	1668.890731	A	R	148	164
PSM	RRDAGGGAGAAGRDELVS	1571	sp|Q6P2P2|ANM9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5203	17.395045196	3	1713.850786	1713.850657	S	R	9	27
PSM	KRRLDECEEAFQGT	1572	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=6711	19.928153561600002	3	1737.811803	1737.810432	K	K	86	100
PSM	RKIEEVRDAMENEM	1573	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8133	22.197834232800002	3	1748.818250	1748.818554	D	R	466	480
PSM	RKGTDVPKWISIMTE	1574	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9814	26.7094400144	3	1759.930598	1759.929091	K	R	205	220
PSM	KRFQANPEANWGPRP	1575	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7796	21.6470921624	3	1766.899826	1766.896485	L	R	549	564
PSM	RREEDAEKAVIDLNN	1576	sp|Q01081|U2AF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7580	21.322213142400003	3	1770.890075	1770.886040	F	R	118	133
PSM	RRCFPGSEEICSSSK	1577	sp|Q14191|WRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=6569	19.654193002133333	3	1798.808220	1798.809052	K	R	1372	1387
PSM	RRGDYDDPKVCANEF	1578	sp|Q12789|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=7636	21.406470834133334	3	1840.817082	1840.816246	N	K	1353	1368
PSM	RKCCNHPYLINGAEE	1579	sp|Q8TD26|CHD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=6727	19.95379717333333	3	1860.838245	1859.840687	L	K	742	757
PSM	KKRLAETQEEISAEVAA	1580	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7520	21.21913261386667	3	1871.996951	1871.995256	A	K	105	122
PSM	KRKGEGGTDPELEGELDS	1581	sp|Q9UJX6|ANC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7026	20.442987577333334	3	1915.905803	1915.912314	S	R	188	206
PSM	KKKANLQYYA	1582	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5517	17.870985841333333	2	1225.682828	1225.681908	A	-	430	440
PSM	RKGHEENGDVVTEPQVAEKNEANG	1583	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5444	17.759890742933333	4	2606.233191	2606.232085	P	R	24	48
PSM	KCINHLH	1584	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:4	ms_run[2]:scan=3646	14.792	2	920.46506	920.4651	T	K	393	400
PSM	KDWEMHVHF	1585	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9155	24.121	3	1227.5495	1227.5495	L	K	110	119
PSM	KERHDAIF	1586	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6369	19.286	2	1014.5247	1014.5247	E	R	71	79
PSM	KEVLIKHQQLSDLH	1587	sp|P78332|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6707	19.921	3	1686.9417	1686.9417	N	K	967	981
PSM	KFHHTFSTEIA	1588	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7204	20.732	3	1316.6513	1316.6513	Y	K	335	346
PSM	KGIRHEVININL	1589	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8801	23.319	3	1404.8201	1404.8201	A	K	45	57
PSM	KGKGVGHEFQ	1590	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4226	15.762	2	1085.5618	1085.5618	H	K	699	709
PSM	KHELIEFR	1591	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7561	21.29	3	1070.5873	1070.5873	E	R	1501	1509
PSM	KHIEEVR	1592	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3635	14.782	2	909.50321	909.5032	D	K	128	135
PSM	KHKADSLDCS	1593	sp|Q14692|BMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4	ms_run[2]:scan=3649	14.796	2	1159.5292	1159.5292	C	R	726	736
PSM	KHKSIEEIV	1594	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7018	20.43	3	1081.6132	1081.6132	Q	R	188	197
PSM	KHNQRPTF	1595	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4565	16.403	2	1026.5359	1026.5359	R	R	92	100
PSM	KHPFIRDQPNE	1596	sp|O95819|M4K4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5195	17.376	3	1379.6946	1379.6946	L	R	285	296
PSM	KHRAQVIYT	1597	sp|P62851|RS25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4798	16.783	2	1114.6247	1114.6247	S	R	102	111
PSM	KHRPDLLDFESL	1598	sp|O15020-2|SPTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9787	26.58	3	1468.7674	1468.7674	H	K	217	229
PSM	KHVVFIAQR	1599	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5920	18.496	3	1096.6505	1096.6505	G	R	90	99
PSM	KIDTIEIITD	1600	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9518	25.328	2	1159.6336	1159.6336	G	R	125	135
PSM	KIHLDEKSF	1601	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7472	21.144	3	1115.5975	1115.5975	E	R	286	295
PSM	KIPIRSWHDIE	1602	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8444	22.738	3	1392.7514	1392.7514	L	K	309	320
PSM	KIPVRHLYT	1603	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6072	18.798	3	1125.6659	1125.6659	E	K	324	333
PSM	KIRPHIATL	1604	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6754	20.007	2	1047.6553	1047.6553	H	R	1119	1128
PSM	KIRSQAIHQL	1605	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5632	18.059	3	1192.704	1192.7040	Y	K	78	88
PSM	KKGFVLH	1606	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5176	17.336	2	827.50176	827.5018	W	K	299	306
PSM	KKHEDSAIP	1607	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4275	15.88	2	1023.5349	1023.5349	L	R	756	765
PSM	KKHGVYNPN	1608	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3682	14.833	2	1055.5512	1055.5512	F	K	156	165
PSM	KKHLLIGVSSD	1609	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7006	20.414	3	1195.6925	1195.6925	K	R	89	100
PSM	KLNGGRHVQGIL	1610	sp|P62308|RUXG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6852	20.172	3	1290.7521	1290.7521	L	R	20	32
PSM	KLRDFLLEH	1611	sp|Q9P2W9|STX18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8946	23.602	3	1169.6557	1169.6557	G	R	62	71
PSM	KLWCHVHL	1612	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=8301	22.488	3	1091.5699	1091.5699	P	K	335	343
PSM	KQLQAAAAHWQQHQQH	1613	sp|P49750-3|YLPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5567	17.95	4	1908.9456	1908.9456	L	R	381	397
PSM	KTAHKNGSTL	1614	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3528	14.673	2	1055.5724	1055.5724	A	K	430	440
PSM	KVHSVAWSCDGR	1615	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:4	ms_run[2]:scan=5879	18.441	3	1400.6619	1400.6619	A	R	57	69
PSM	KVRAWGPGLHGGIVG	1616	sp|O75369-4|FLNB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8353	22.571	3	1502.847	1502.8470	Q	R	551	566
PSM	KWQNVHFH	1617	sp|Q13557-8|KCC2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6881	20.224	3	1094.541	1094.5410	G	R	461	469
PSM	KYHIIHADIY	1618	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8019	22.007	3	1271.6663	1271.6663	D	R	335	345
PSM	KYPHVEDYR	1619	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5918	18.492	3	1205.5829	1205.5829	A	R	195	204
PSM	RARFEELNADLF	1620	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9762	26.464	3	1479.747	1479.7470	T	R	299	311
PSM	RCQHLQAEK	1621	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:4	ms_run[2]:scan=3495	14.639	3	1168.5771	1168.5771	E	K	930	939
PSM	RDKHLEFSSL	1622	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8268	22.427	3	1230.6357	1230.6357	A	R	1635	1645
PSM	REKLHGTVVEG	1623	sp|O43251-3|RFOX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4511	16.323	3	1223.6622	1223.6622	A	R	149	160
PSM	RGGADVNIRHSG	1624	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3897	15.067	3	1237.6276	1237.6276	R	R	201	213
PSM	RGHFPFTHV	1625	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8053	22.063	3	1096.5566	1096.5566	K	R	283	292
PSM	RGIHPIRIADGYEQAA	1626	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8136	22.202	3	1765.9224	1765.9224	D	R	33	49
PSM	RGTHSLDIKW	1627	sp|Q9UHQ1-4|NARF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8593	22.978	3	1211.6411	1211.6411	E	-	388	398
PSM	RGTLSAELTAAHFGGGGGLLHK	1628	sp|P78316|NOP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9209	24.273	4	2149.1392	2149.1392	D	K	153	175
PSM	RHAEPGFSLK	1629	sp|Q99640-2|PMYT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6482	19.49	3	1140.604	1140.6040	F	R	33	43
PSM	RHAEPSRVGELFQ	1630	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7988	21.965	3	1524.7797	1524.7797	Q	R	132	145
PSM	RHAPFLALH	1631	sp|Q9BWE0|REPI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7816	21.686	3	1060.593	1060.5930	F	R	95	104
PSM	RHDNIKPSDEVY	1632	sp|Q86UA1|PRP39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5773	18.263	3	1471.7056	1471.7056	K	R	141	153
PSM	RHDWDYCEH	1633	sp|P17568|NDUB7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=6204	18.998	3	1316.4993	1316.4993	E	R	84	93
PSM	RHGSFVNKPT	1634	sp|P29353-2|SHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4126	15.496	2	1141.5992	1141.5992	T	R	26	36
PSM	RHIGPGDKDQ	1635	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3589	14.734	2	1121.5578	1121.5578	R	R	66	76
PSM	RHKMGEEVIPL	1636	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=7657	21.446	3	1323.6969	1323.6969	E	R	366	377
PSM	RHLAEHSPYYEAM	1637	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	13-UNIMOD:35	ms_run[2]:scan=5955	18.549	3	1618.7198	1618.7198	N	K	452	465
PSM	RHLTHENVQ	1638	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3613	14.76	3	1132.5738	1132.5738	Q	R	338	347
PSM	RHMGLFDHAA	1639	sp|P50213-2|IDH3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:35	ms_run[2]:scan=6381	19.317	3	1169.54	1169.5400	L	R	238	248
PSM	RHMQNSEIIR	1640	sp|Q8N3U4-2|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:35	ms_run[2]:scan=4218	15.737	3	1298.6514	1298.6514	F	K	137	147
PSM	RHPTGGSFIRPN	1641	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5597	17.994	2	1337.6953	1337.6953	C	K	62	74
PSM	RHQVKDLLDLI	1642	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=10096	27.897	3	1348.7827	1348.7827	L	K	503	514
PSM	RHTAFVIPK	1643	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7025	20.441	3	1067.624	1067.6240	L	K	50	59
PSM	RHVMLPKDIA	1644	sp|P61024|CKS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=7050	20.476	3	1194.6543	1194.6543	Y	K	20	30
PSM	RIFTHHLC	1645	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=5758	18.242	3	1082.5444	1082.5444	A	R	877	885
PSM	RKAEALHNIWLG	1646	sp|Q9BPX7|CG025_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8840	23.39	3	1406.7783	1406.7783	G	R	122	134
PSM	RKDHNIPGELE	1647	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5887	18.454	3	1306.663	1306.6630	G	R	205	216
PSM	RKEGIIHTLIVDN	1648	sp|Q9NVQ4|FAIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8657	23.089	3	1506.8518	1506.8518	K	R	159	172
PSM	RKESYSVYVY	1649	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8296	22.481	2	1292.6401	1292.6401	S	K	34	44
PSM	RKFLEHLSGAG	1650	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6929	20.294	3	1213.6568	1213.6568	L	K	14	25
PSM	RKIHLFDIDVPG	1651	sp|Q9NQR4|NIT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9802	26.654	3	1408.7827	1408.7827	Y	K	111	123
PSM	RKSDLGVHL	1652	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7017	20.427	2	1023.5825	1023.5825	A	R	120	129
PSM	RKVQSATHF	1653	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4370	16.076	3	1072.5778	1072.5778	V	K	347	356
PSM	RKYSSVHTIE	1654	sp|Q9UHQ4|BAP29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4710	16.653	3	1218.6357	1218.6357	V	K	71	81
PSM	RLDHKFDLMYA	1655	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9144	24.084	3	1407.6969	1407.6969	A	K	355	366
PSM	RLFHNTPGH	1656	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4813	16.803	3	1077.5468	1077.5468	V	R	397	406
PSM	RLIKHEMT	1657	sp|Q9Y5U8|MPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:35	ms_run[2]:scan=3659	14.807	2	1042.5593	1042.5594	G	K	97	105
PSM	RLVTGHHLWAS	1658	sp|Q96SN8-3|CK5P2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7525	21.228	3	1275.6836	1275.6836	S	K	1670	1681
PSM	RPHKATAEEMT	1659	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:35	ms_run[2]:scan=3329	14.437	3	1285.6085	1285.6085	Y	K	26	37
PSM	RPMHVKMDE	1660	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4660	16.554	3	1141.5372	1141.5372	D	R	233	242
PSM	RPRHQGVMVGMGQ	1661	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4363	16.063	3	1483.7136	1483.7136	G	K	37	50
PSM	RPRHQGVMVGMGQ	1662	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4846	16.854	3	1483.7136	1483.7136	G	K	37	50
PSM	RQHHDEYEDEI	1663	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6216	19.016	3	1469.6171	1469.6171	L	R	1091	1102
PSM	RQKASIHEAWTDG	1664	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6269	19.11	3	1497.7324	1497.7324	F	K	400	413
PSM	RQPDRHPPEDF	1665	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5854	18.396	3	1392.6535	1392.6535	F	R	548	559
PSM	RQPLTVEHMYEDISQDHVK	1666	sp|Q9NT62-2|ATG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9191	24.22	3	2324.1219	2324.1219	Q	K	224	243
PSM	RQRNGVMPSHFS	1667	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:35	ms_run[2]:scan=4382	16.093	3	1430.6837	1430.6837	G	R	82	94
PSM	RQSVTNSIKAGLTDQVSHHA	1668	sp|Q8NHH9-3|ATLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8002	21.984	5	2148.1036	2148.1036	I	R	388	408
PSM	RQVHLTHFELEGL	1669	sp|Q9Y2K7-2|KDM2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9356	24.75	3	1577.8314	1577.8314	D	R	143	156
PSM	RQWHNDCFNCK	1670	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5778	18.27	3	1563.6459	1563.6460	E	K	242	253
PSM	RRLEAFEHPNVV	1671	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7986	21.963	3	1465.779	1465.7790	L	R	61	73
PSM	RRLLSLDPSHE	1672	sp|O15460-2|P4HA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7733	21.555	3	1321.7102	1321.7102	T	R	231	242
PSM	RRLSTLILHGGGTVC	1673	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	15-UNIMOD:4	ms_run[2]:scan=8332	22.539	3	1638.8988	1638.8988	K	R	40	55
PSM	RRPEYTPIHLS	1674	sp|P53805-4|RCAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7514	21.21	3	1367.731	1367.7310	T	-	107	118
PSM	RRVDFHDVQDYADNI	1675	sp|Q969Q5|RAB24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9377	24.819	3	1861.8707	1861.8707	R	K	132	147
PSM	RSHHSLASSL	1676	sp|Q92997-2|DVL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5638	18.067	3	1093.5629	1093.5629	H	R	618	628
PSM	RSHSAHFFEFLT	1677	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9704	26.173	3	1477.7102	1477.7102	N	K	75	87
PSM	RSQHLLHLQQQQ	1678	sp|P47974|TISD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6124	18.866	3	1514.8066	1514.8066	D	K	130	142
PSM	RSRESHGCPEVTVINE	1679	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=6526	19.574	3	1868.8799	1868.8799	H	R	37	53
PSM	RTHTGERPF	1680	sp|P52747-2|ZN143_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4714	16.658	3	1099.5523	1099.5523	I	K	288	297
PSM	RTHYDPPR	1681	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3770	14.928	2	1040.5152	1040.5152	V	K	192	200
PSM	RTKAAHGFDWEEE	1682	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7766	21.6	3	1574.7114	1574.7114	A	R	153	166
PSM	RTKEVFHFSQAE	1683	sp|Q7L5Y9-4|MAEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7438	21.09	3	1477.7314	1477.7314	P	K	312	324
PSM	RTNGKEPELLEPIPYEFMA	1684	sp|P46778|RL21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	18-UNIMOD:35	ms_run[2]:scan=10064	27.768	3	2249.1038	2249.1038	V	-	142	161
PSM	RTVRGMLPH	1685	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=4350	16.044	3	1081.5815	1081.5815	W	K	82	91
PSM	RTVRGMLPH	1686	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:35	ms_run[2]:scan=4568	16.408	3	1081.5815	1081.5815	W	K	82	91
PSM	RVKLAEH	1687	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3796	14.959	2	851.49774	851.4977	E	K	975	982
PSM	RVQNHDNPKWEA	1688	sp|O75027-3|ABCB7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5210	17.406	3	1492.7171	1492.7171	S	K	671	683
PSM	RYELLEHK	1689	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6440	19.412	3	1086.5822	1086.5822	K	K	525	533
PSM	RYHAVLQH	1690	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4517	16.332	2	1022.541	1022.5410	S	R	208	216
PSM	RYIPLHLHA	1691	sp|Q96CM3-2|RUSD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7880	21.781	3	1118.6349	1118.6349	A	R	285	294
PSM	RYKATGLHF	1692	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7491	21.171	3	1091.5876	1091.5876	T	R	102	111
PSM	RYNHPKPNLLYQ	1693	sp|Q5T3I0-2|GPTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7179	20.682	3	1541.8103	1541.8103	T	K	50	62
PSM	RYTCHVQHEGLP	1694	sp|P01889|HLAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=6128	18.872	3	1495.699	1495.6990	Q	K	280	292
PSM	KIFVGGIKEDTEEHHL	1695	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=11268	32.55356578053333	3	1851.952782	1850.952663	K	R	106	122
PSM	KRGFGFVTFDDHD	1696	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=9297	24.5378521216	3	1539.7108	1539.7101	K	P	152	165
PSM	RQHEAEEGVR	1697	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=3443	14.580001378666667	3	1210.5912	1209.5842	R	R	2695	2705
PSM	REKANGTTVHVGIHPS	1698	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5506	17.850081873066664	4	1702.874603	1701.891066	Q	K	87	103
PSM	KHRPDLLDFESL	1699	sp|O15020|SPTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9771	26.506827126666668	3	1468.768922	1468.767428	H	K	217	229
PSM	KYPHVEDYR	1700	sp|P61289|PSME3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5930	18.513231753333333	3	1205.582809	1205.582922	A	R	195	204
PSM	KIRIFDLG	1701	sp|Q96L21|RL10L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9554	25.4839167992	2	960.576013	960.575652	A	R	30	38
PSM	KVKSHWLGPNYT	1702	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7494	21.1769743616	3	1429.753354	1428.751384	H	K	810	822
PSM	KSRPLANGHPILNNNH	1703	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5476	17.808878064266665	3	1781.927527	1780.944498	A	R	361	377
PSM	RKTTPQELK	1704	sp|O15091|MRPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3719	14.869568145333334	3	1099.633451	1099.634957	Y	R	384	393
PSM	KKVIKEV	1705	sp|O60884|DNJA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3858	15.028573628266667	2	842.558563	842.558939	G	K	208	215
PSM	KKKEPIE	1706	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3508	14.650998815733335	2	870.520173	870.517468	R	K	97	104
PSM	KKGKNVTL	1707	sp|P55209|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4031	15.2827302512	2	886.560166	886.560002	W	K	263	271
PSM	RKEIDIK	1708	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4229	15.771802016533334	2	900.539605	900.539266	G	K	190	197
PSM	KKVKTPQP	1709	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3563	14.710254642133332	2	924.575751	924.575652	A	K	176	184
PSM	RKQLATKAA	1710	sp|P68431|H31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3426	14.562555845333332	2	985.602889	985.603263	P	R	18	27
PSM	RKLNDLIK	1711	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6412	19.3631534432	2	998.623902	998.623664	L	R	292	300
PSM	KKKELTLLG	1712	sp|Q00059|TFAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7276	20.839253676	2	1028.659838	1028.659381	T	K	145	154
PSM	KTLPWGPKR	1713	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6491	19.51371045786667	3	1081.639077	1081.639649	P	-	1260	1269
PSM	RKEIEERE	1714	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3549	14.697640304266667	3	1087.564595	1087.562186	C	K	159	167
PSM	RKNGFVVLKG	1715	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6743	19.987976340266666	3	1116.676963	1116.676763	L	R	26	36
PSM	RREEFVSIK	1716	sp|O43663|PRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6461	19.447773451733333	3	1162.645629	1162.645856	S	R	170	179
PSM	KKTKFENLC	1717	sp|Q58FG0|HS905_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:4	ms_run[1]:scan=5326	17.574446120266668	3	1166.611898	1166.611779	E	K	249	258
PSM	RKKMMEIMT	1718	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	4-UNIMOD:35	ms_run[1]:scan=5437	17.750634749066666	3	1182.591645	1182.592306	I	R	165	174
PSM	RKQEAEWKE	1719	sp|P09496|CLCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4416	16.153701417066667	3	1202.604879	1202.604386	S	K	129	138
PSM	RKTTVLDVMR	1720	sp|P23258|TBG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7541	21.257823899733335	3	1217.689939	1217.691426	V	R	286	296
PSM	RKIKEGVEEAA	1721	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4009	15.236146979733332	3	1228.677813	1228.677551	G	K	143	154
PSM	RKEELTGVRF	1722	sp|O60287|NPA1P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7739	21.561794794133334	3	1233.683429	1233.682970	A	K	26	36
PSM	RRGLAPNTPGKA	1723	sp|O43663|PRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4093	15.4160813608	3	1236.705292	1236.705103	K	R	474	486
PSM	KKPFKLSGLSF	1724	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9175	24.176733706133334	3	1250.739274	1250.738694	F	K	95	106
PSM	KKKWNLDELP	1725	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8700	23.1563738528	3	1269.708615	1269.708122	V	K	43	53
PSM	KKFDDFQKDL	1726	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8112	22.17146775573333	3	1282.656202	1282.655752	Q	K	1131	1141
PSM	RRDFAPPGQQK	1727	sp|Q9BVC6|TM109_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4668	16.569940425066665	3	1298.685025	1298.684367	S	R	36	47
PSM	RRAEVLALPFK	1728	sp|Q9NV88|INT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8978	23.674262097333333	3	1298.783164	1298.782290	Y	R	500	511
PSM	RKLDEKENLSA	1729	sp|Q9UBT2|SAE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4770	16.744937080533333	3	1301.697243	1301.693929	K	K	612	623
PSM	RKLFTDLFDR	1730	sp|Q9Y6M4|KC1G3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9494	25.233537124266665	3	1309.714365	1309.714270	L	K	305	315
PSM	RRHEAAVPPLAIPSARPE	1731	sp|Q6PJT7|ZC3HE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8587	22.96298545013333	3	1967.123369	1966.086077	E	K	108	126
PSM	KKREGELTVAQG	1732	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4549	16.377612524	3	1314.725643	1314.725563	A	R	136	148
PSM	RKVDWLTEKM	1733	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:35	ms_run[1]:scan=7337	20.935496952	3	1320.686445	1320.686007	K	R	288	298
PSM	RKPKLPEVQQAT	1734	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5854	18.395880325066667	3	1393.804538	1393.804148	L	K	1126	1138
PSM	RKPKEDEVEASE	1735	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3714	14.864282700533332	3	1415.690012	1415.689238	F	K	314	326
PSM	RKLTPQGQRDLD	1736	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4897	16.926108711999998	3	1425.771536	1425.768825	G	R	121	133
PSM	KKRLGLPGDEVDN	1737	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6456	19.440419252799998	3	1439.774628	1439.773242	G	K	2702	2715
PSM	RKAEEVQAWAQR	1738	sp|Q9BYN8|RT26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6337	19.2270644528	3	1470.770476	1470.769160	A	K	141	153
PSM	RKMKDTDSEEEI	1739	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=4243	15.811220476533332	3	1495.682737	1495.682438	A	R	75	87
PSM	RRSGNGNKPPSTDL	1740	sp|P51153|RAB13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4469	16.2386382752	3	1497.767997	1497.764802	G	K	176	190
PSM	RKKNLSPGAVESDV	1741	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6313	19.184298105333333	3	1498.810308	1498.810356	L	R	168	182
PSM	RRIFQEPTEPKT	1742	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6591	19.702069578933333	3	1500.803937	1500.804876	A	K	49	61
PSM	KRRPEPIIPVTQP	1743	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7602	21.356135719466668	3	1529.904906	1529.904197	A	R	520	533
PSM	KKYAGLLEK	1744	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5828	18.354951591733332	2	1048.629400	1048.628081	D	K	45	54
PSM	RKDPNKLVLCEVF	1745	sp|P15104|GLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4	ms_run[1]:scan=9527	25.36316555333333	3	1616.875747	1616.870848	F	K	90	103
PSM	RRDAGGPRPESPVPAG	1746	sp|Q9BVG9|PTSS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5212	17.410009928533334	3	1617.833911	1617.833551	E	R	6	22
PSM	RTKPQGDQDTGKEADDGCALGGR	1747	sp|O75127|PTCD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	18-UNIMOD:4	ms_run[1]:scan=4324	16.004583912799998	3	2431.115622	2431.114613	F	-	678	701
PSM	RKKQEQLTPGVVYV	1748	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8063	22.078747744	3	1643.936509	1643.935891	Q	R	36	50
PSM	KRKELSQNTDESGLNDEAIA	1749	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6878	20.220303973066667	4	2217.093423	2217.087319	S	K	185	205
PSM	RKSGYSLNFSEGDGR	1750	sp|Q9UIF9|BAZ2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7557	21.2837448952	3	1671.793063	1671.796497	K	R	1745	1760
PSM	RKEKEEADLLLEQQ	1751	sp|O43896|KIF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8014	21.999677293599998	3	1727.907679	1727.905378	Y	R	655	669
PSM	RKIKEGMDMNYIIQ	1752	sp|Q9UHR5|S30BP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:35	ms_run[1]:scan=7583	21.325452528533333	3	1753.886208	1753.885512	E	R	141	155
PSM	KRPKEEEWDPEYTP	1753	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7971	21.94224219546667	3	1802.847788	1802.847529	Q	K	828	842
PSM	RRKEEPPQPQLANGAL	1754	sp|Q9BUV8|RCAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7403	21.037119191200002	3	1802.974597	1802.975130	G	K	5	21
PSM	RRLTPTEVKDYLAAIA	1755	sp|P25787|PSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9917	27.157720296533334	3	1816.023807	1816.020683	F	-	219	235
PSM	RRFELYFQGPSSNKP	1756	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8882	23.465367754133336	3	1824.934835	1824.927117	M	R	132	147
PSM	KIFVGGIKEDTEEHHL	1757	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9947	27.281552879733333	3	1851.958330	1850.952663	K	R	106	122
PSM	RRQTFITLEKFDGSEN	1758	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9036	23.8081235952	3	1939.976566	1939.975189	S	R	1217	1233
PSM	KHKELAPYDENWFYT	1759	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9783	26.562395052533336	3	1939.910852	1939.910464	A	R	41	56
PSM	KKYEGGRELSDFISYLQ	1760	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=10063	27.762707957866667	3	2032.030656	2032.026556	P	R	465	482
PSM	KRDRTQQYDDLIDEFM	1761	sp|P23368|MAOM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:35	ms_run[1]:scan=9647	25.904220255733332	3	2087.960036	2087.958219	Q	K	224	240
PSM	KRKGFSEGLWEIENNPTV	1762	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9519	25.331217705866667	3	2103.080108	2103.074903	N	K	78	96
PSM	RKAGPAKEQEPMPTVDSHEP	1763	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:35	ms_run[1]:scan=4661	16.555876325333333	4	2219.065039	2219.064081	A	R	146	166
PSM	KKLTQTSGETTHTDKVPGGED	1764	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4222	15.7486643912	4	2228.093451	2228.092070	L	K	1408	1429
PSM	KHKGYGFIEYE	1765	sp|Q9UHX1|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8338	22.549698928533335	2	1369.667468	1369.666652	G	K	265	276