MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-1 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F40.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172206544703^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F40.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	65.0	null		0.06	65.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null		0.02	61.0	1	1	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.06	56.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null		0.03	56.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.09	51.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	308-UNIMOD:4	0.04	51.0	2	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50.0	null		0.01	50.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.04	49.0	2	1	0
PRT	sp|Q15054|DPOD3_HUMAN	DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49.0	null	162-UNIMOD:35	0.07	49.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49.0	null		0.13	49.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	319-UNIMOD:35	0.11	48.0	2	2	2
PRT	sp|Q8IXB1-2|DJC10_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	864-UNIMOD:35	0.03	46.0	2	1	0
PRT	sp|P04179-3|SODM_HUMAN	Isoform 3 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.14	46.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	579-UNIMOD:35,582-UNIMOD:35	0.06	45.0	4	3	2
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	194-UNIMOD:35	0.02	45.0	2	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	2	2	2
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|O43837-3|IDH3B_HUMAN	Isoform C of Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	192-UNIMOD:35	0.08	44.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null	23-UNIMOD:4,30-UNIMOD:35	0.18	44.0	3	1	0
PRT	sp|Q13217|DNJC3_HUMAN	DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.09	44.0	2	2	2
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	785-UNIMOD:4	0.04	43.0	3	3	3
PRT	sp|Q9NV70|EXOC1_HUMAN	Exocyst complex component 1 OS=Homo sapiens OX=9606 GN=EXOC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null	61-UNIMOD:35	0.01	43.0	2	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	821-UNIMOD:4,230-UNIMOD:4	0.13	43.0	9	6	3
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	11-UNIMOD:4,17-UNIMOD:4,414-UNIMOD:4,416-UNIMOD:4	0.05	42.0	2	2	2
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	6	5	4
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	30-UNIMOD:35,179-UNIMOD:35	0.14	42.0	3	3	3
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	93-UNIMOD:4	0.05	42.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	3	2	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	396-UNIMOD:35	0.05	42.0	1	1	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q9Y5B6|PAXB1_HUMAN	PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q96GC9|VMP1_HUMAN	Vacuole membrane protein 1 OS=Homo sapiens OX=9606 GN=VMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	2	2	2
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	3	1	0
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	36-UNIMOD:4	0.09	40.0	1	1	1
PRT	sp|P09622-3|DLDH_HUMAN	Isoform 3 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	100-UNIMOD:35	0.03	40.0	3	1	0
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	948-UNIMOD:35,1197-UNIMOD:35	0.03	40.0	4	3	2
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	386-UNIMOD:35	0.01	40.0	2	1	0
PRT	sp|Q9BRV8|SIKE1_HUMAN	Suppressor of IKBKE 1 OS=Homo sapiens OX=9606 GN=SIKE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	305-UNIMOD:35,153-UNIMOD:35,44-UNIMOD:35,47-UNIMOD:35,217-UNIMOD:4	0.41	40.0	34	9	7
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	58-UNIMOD:4	0.15	39.0	2	2	2
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|Q8WVV9-5|HNRLL_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	216-UNIMOD:35	0.07	39.0	4	2	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	725-UNIMOD:4,726-UNIMOD:4	0.03	39.0	2	2	2
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	385-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null	106-UNIMOD:4	0.16	39.0	3	2	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	35-UNIMOD:4,46-UNIMOD:4	0.06	38.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.14	38.0	8	7	6
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.17	38.0	7	6	5
PRT	sp|Q12923-3|PTN13_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	432-UNIMOD:35	0.03	38.0	3	1	0
PRT	sp|Q9C0B7|TNG6_HUMAN	Transport and Golgi organization protein 6 homolog OS=Homo sapiens OX=9606 GN=TANGO6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	431-UNIMOD:35	0.04	37.0	1	1	1
PRT	sp|Q16629-3|SRSF7_HUMAN	Isoform 3 of Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	106-UNIMOD:4,109-UNIMOD:4,119-UNIMOD:4	0.13	37.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	88-UNIMOD:35	0.05	37.0	2	2	2
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.08	37.0	3	2	1
PRT	sp|O14744-4|ANM5_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	347-UNIMOD:4	0.05	37.0	2	1	0
PRT	sp|Q9Y371-3|SHLB1_HUMAN	Isoform 3 of Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.08	37.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	10-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	284-UNIMOD:35,289-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	171-UNIMOD:35	0.06	36.0	1	1	1
PRT	sp|P28799-2|GRN_HUMAN	Isoform 2 of Progranulin OS=Homo sapiens OX=9606 GN=GRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	164-UNIMOD:4,165-UNIMOD:4,171-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q96T51-2|RUFY1_HUMAN	Isoform 2 of RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	540-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	466-UNIMOD:35	0.10	35.0	6	5	4
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	1153-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	397-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	139-UNIMOD:4,39-UNIMOD:4	0.19	35.0	2	2	2
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	5	2	0
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.18	34.0	3	3	3
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	363-UNIMOD:35	0.09	34.0	2	2	2
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	196-UNIMOD:4	0.08	34.0	2	2	2
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	164-UNIMOD:35	0.08	34.0	5	2	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	2	1	0
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|O95782|AP2A1_HUMAN	AP-2 complex subunit alpha-1 OS=Homo sapiens OX=9606 GN=AP2A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q96Q89|KI20B_HUMAN	Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	4061-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	22-UNIMOD:35	0.04	33.0	4	2	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	648-UNIMOD:35	0.02	33.0	3	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	672-UNIMOD:35	0.02	33.0	3	2	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	202-UNIMOD:35	0.03	33.0	2	1	0
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	2	2
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	150-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q9Y597-2|KCTD3_HUMAN	Isoform 2 of BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	645-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	430-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|O75880|SCO1_HUMAN	Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	50-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|P42575-3|CASP2_HUMAN	Isoform 3 of Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	13-UNIMOD:4,15-UNIMOD:35	0.19	33.0	1	1	1
PRT	sp|Q13057|COASY_HUMAN	Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	903-UNIMOD:35,674-UNIMOD:35	0.01	33.0	3	2	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	171-UNIMOD:35,166-UNIMOD:35	0.04	33.0	5	2	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q96HC4-3|PDLI5_HUMAN	Isoform 3 of PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|O43172|PRP4_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	2	2	2
PRT	sp|P50995|ANX11_HUMAN	Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q15435|PP1R7_HUMAN	Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	443-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q96N67-7|DOCK7_HUMAN	Isoform 7 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	129-UNIMOD:4	0.16	32.0	1	1	1
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	2	2
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	205-UNIMOD:4	0.13	32.0	2	2	2
PRT	sp|P55347|PKNX1_HUMAN	Homeobox protein PKNOX1 OS=Homo sapiens OX=9606 GN=PKNOX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=H2AC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.11	32.0	1	1	0
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q96HN2|SAHH3_HUMAN	Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	3	3	3
PRT	sp|Q15004|PAF15_HUMAN	PCNA-associated factor OS=Homo sapiens OX=9606 GN=PCLAF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null	99-UNIMOD:4	0.15	32.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O96028-5|NSD2_HUMAN	Isoform 5 of Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9HD26-2|GOPC_HUMAN	Isoform 2 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9UNY4-2|TTF2_HUMAN	Isoform 2 of Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	0
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	179-UNIMOD:4,186-UNIMOD:35	0.14	31.0	2	2	2
PRT	sp|Q9NQW7-4|XPP1_HUMAN	Isoform 4 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P46020-2|KPB1_HUMAN	Isoform 2 of Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q6PJI9|WDR59_HUMAN	GATOR complex protein WDR59 OS=Homo sapiens OX=9606 GN=WDR59 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	76-UNIMOD:35	0.15	31.0	3	3	3
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	59-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	3256-UNIMOD:35,1241-UNIMOD:35	0.01	31.0	2	2	2
PRT	sp|Q96MF7|NSE2_HUMAN	E3 SUMO-protein ligase NSE2 OS=Homo sapiens OX=9606 GN=NSMCE2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	210-UNIMOD:4,215-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|O95169-3|NDUB8_HUMAN	Isoform 3 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q15776|ZKSC8_HUMAN	Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|Q9P0M9|RM27_HUMAN	39S ribosomal protein L27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	56-UNIMOD:35	0.12	30.0	2	1	0
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1691-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q2M389-2|WASC4_HUMAN	Isoform 2 of WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	213-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	504-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9NPA8-2|ENY2_HUMAN	Isoform 2 of Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	1	1	1
PRT	sp|Q7L5Y9-3|MAEA_HUMAN	Isoform 3 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9GZT8-3|NIF3L_HUMAN	Isoform 3 of NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q8IZP0-10|ABI1_HUMAN	Isoform 10 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	86-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q96AY3-2|FKB10_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	0
PRT	sp|Q9NVW2-2|RNF12_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RLIM OS=Homo sapiens OX=9606 GN=RLIM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9C0J8|WDR33_HUMAN	pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	2	2
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.16	30.0	3	3	3
PRT	sp|Q9BUQ8|DDX23_HUMAN	Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q8IUD2|RB6I2_HUMAN	ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.11	30.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	78-UNIMOD:35	0.21	30.0	1	1	1
PRT	sp|Q15397|PUM3_HUMAN	Pumilio homolog 3 OS=Homo sapiens OX=9606 GN=PUM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	556-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|Q9NVH0-2|EXD2_HUMAN	Isoform 2 of Exonuclease 3'-5' domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EXD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	100-UNIMOD:35,115-UNIMOD:4	0.33	29.0	4	3	2
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	178-UNIMOD:35	0.08	29.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	2	2
PRT	sp|Q5TBB1-2|RNH2B_HUMAN	Isoform 2 of Ribonuclease H2 subunit B OS=Homo sapiens OX=9606 GN=RNASEH2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|P56270-3|MAZ_HUMAN	Isoform 3 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	398-UNIMOD:4,401-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q13564-3|ULA1_HUMAN	Isoform 3 of NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	115-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|P61254|RL26_HUMAN	60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.19	29.0	3	2	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q6ZN18-3|AEBP2_HUMAN	Isoform 3 of Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q04727-2|TLE4_HUMAN	Isoform 2 of Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	361-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9NP79-2|VTA1_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens OX=9606 GN=VTA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	58-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|P84101|SERF2_HUMAN	Small EDRK-rich factor 2 OS=Homo sapiens OX=9606 GN=SERF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.20	29.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.09	29.0	8	8	8
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	381-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|Q9UNZ5|L10K_HUMAN	Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	67-UNIMOD:35	0.17	29.0	1	1	1
PRT	sp|Q86Y37|CACL1_HUMAN	CDK2-associated and cullin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACUL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	362-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q66K14|TBC9B_HUMAN	TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	1079-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|Q9NUP7-2|TRM13_HUMAN	Isoform 2 of tRNA:m(4)X modification enzyme TRM13 homolog OS=Homo sapiens OX=9606 GN=TRMT13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	142-UNIMOD:35	0.14	28.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q86Y56|DAAF5_HUMAN	Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	841-UNIMOD:4	0.04	28.0	3	2	1
PRT	sp|Q8N201|INT1_HUMAN	Integrator complex subunit 1 OS=Homo sapiens OX=9606 GN=INTS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	611-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	1	1	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	106-UNIMOD:4	0.08	28.0	2	1	0
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	60-UNIMOD:35,63-UNIMOD:35	0.37	28.0	4	4	4
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	2	2	2
PRT	sp|P54646|AAPK2_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O60287|NPA1P_HUMAN	Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	888-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q96PM5-3|ZN363_HUMAN	Isoform 3 of RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RCHY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	164-UNIMOD:4	0.08	28.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q69YU5|BWNIN_HUMAN	Protein BRAWNIN OS=Homo sapiens OX=9606 GN=BRAWNIN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.20	28.0	1	1	1
PRT	sp|Q9UHD8|SEPT9_HUMAN	Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NP77|SSU72_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	84-UNIMOD:35	0.09	28.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q9Y5A9-2|YTHD2_HUMAN	Isoform 2 of YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q86VG3|IFTAP_HUMAN	Intraflagellar transport-associated protein OS=Homo sapiens OX=9606 GN=IFTAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q7Z624|CMKMT_HUMAN	Calmodulin-lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=CAMKMT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|O00764-2|PDXK_HUMAN	Isoform 2 of Pyridoxal kinase OS=Homo sapiens OX=9606 GN=PDXK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.12	27.0	3	2	1
PRT	sp|Q96AY3|FKB10_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	0
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96EX1|SIM12_HUMAN	Small integral membrane protein 12 OS=Homo sapiens OX=9606 GN=SMIM12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.20	27.0	1	1	1
PRT	sp|A4D1E9|GTPBA_HUMAN	GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.08	27.0	2	1	0
PRT	sp|Q9Y4P3|TBL2_HUMAN	Transducin beta-like protein 2 OS=Homo sapiens OX=9606 GN=TBL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	27-UNIMOD:35,74-UNIMOD:35,277-UNIMOD:35	0.09	26.0	5	3	2
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|Q8TCG1-2|CIP2A_HUMAN	Isoform 2 of Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	725-UNIMOD:35,728-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q9UPN9-2|TRI33_HUMAN	Isoform Beta of E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q96ER9|MITOK_HUMAN	Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9BWF3-3|RBM4_HUMAN	Isoform 3 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|Q6IA69|NADE_HUMAN	Glutamine-dependent NAD(+) synthetase OS=Homo sapiens OX=9606 GN=NADSYN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	650-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q9ULE6|PALD_HUMAN	Paladin OS=Homo sapiens OX=9606 GN=PALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q6P4F2|FDX2_HUMAN	Ferredoxin-2, mitochondrial OS=Homo sapiens OX=9606 GN=FDX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P15586-2|GNS_HUMAN	Isoform 2 of N-acetylglucosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GNS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|O75431-2|MTX2_HUMAN	Isoform 2 of Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|O00560-3|SDCB1_HUMAN	Isoform 3 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	195-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|Q9NWH9-3|SLTM_HUMAN	Isoform 2 of SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	3	3	3
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75688|PPM1B_HUMAN	Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|O15226|NKRF_HUMAN	NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	97-UNIMOD:35	0.13	26.0	3	1	0
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q9P2D1|CHD7_HUMAN	Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	2527-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	200-UNIMOD:35	0.04	26.0	2	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.15	25.0	1	1	1
PRT	sp|Q9NUM3-3|S39A9_HUMAN	Isoform 3 of Zinc transporter ZIP9 OS=Homo sapiens OX=9606 GN=SLC39A9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	2	2	2
PRT	sp|Q5VZL5-3|ZMYM4_HUMAN	Isoform 3 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q8TCC3-3|RM30_HUMAN	Isoform 3 of 39S ribosomal protein L30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9BYC5-2|FUT8_HUMAN	Isoform 2 of Alpha-(1,6)-fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9BYD3-2|RM04_HUMAN	Isoform 2 of 39S ribosomal protein L4, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O75319|DUS11_HUMAN	RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:35,208-UNIMOD:35	0.05	25.0	4	1	0
PRT	sp|Q15392-2|DHC24_HUMAN	Isoform 2 of Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	346-UNIMOD:35,350-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1180-UNIMOD:35	0.01	25.0	2	1	0
PRT	sp|Q15031|SYLM_HUMAN	Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	2	2	2
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	381-UNIMOD:4	0.02	25.0	2	2	2
PRT	sp|Q9Y6X3|SCC4_HUMAN	MAU2 chromatid cohesion factor homolog OS=Homo sapiens OX=9606 GN=MAU2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P30519|HMOX2_HUMAN	Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	101-UNIMOD:35	0.06	25.0	1	1	0
PRT	sp|O94991|SLIK5_HUMAN	SLIT and NTRK-like protein 5 OS=Homo sapiens OX=9606 GN=SLITRK5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	759-UNIMOD:35,760-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q8TAQ2|SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	39-UNIMOD:4	0.06	25.0	2	2	2
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O00203|AP3B1_HUMAN	AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	293-UNIMOD:35	0.01	25.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	541-UNIMOD:35	0.00	25.0	1	1	1
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	92-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q9Y5X3|SNX5_HUMAN	Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	379-UNIMOD:35	0.04	25.0	3	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	50-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	163-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	211-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1500-UNIMOD:35	0.02	25.0	2	2	2
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	73-UNIMOD:4,79-UNIMOD:35	0.13	25.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	29-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|P60953-1|CDC42_HUMAN	Isoform 1 of Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	105-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9H8V3-2|ECT2_HUMAN	Isoform 2 of Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	701-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|O75151|PHF2_HUMAN	Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P23378|GCSP_HUMAN	Glycine dehydrogenase (decarboxylating), mitochondrial OS=Homo sapiens OX=9606 GN=GLDC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1242-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P08397-4|HEM3_HUMAN	Isoform 4 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	2	2	2
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	759-UNIMOD:35	0.04	24.0	2	2	2
PRT	sp|Q9UKM7|MA1B1_HUMAN	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P61026|RAB10_HUMAN	Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	339-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|Q8NEY8-5|PPHLN_HUMAN	Isoform 5 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P30519-2|HMOX2_HUMAN	Isoform 2 of Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	0
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q8WV92|MITD1_HUMAN	MIT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MITD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	233-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P16989-3|YBOX3_HUMAN	Isoform 3 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	155-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|O43660-2|PLRG1_HUMAN	Isoform 2 of Pleiotropic regulator 1 OS=Homo sapiens OX=9606 GN=PLRG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|Q13564|ULA1_HUMAN	NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens OX=9606 GN=NAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O60869|EDF1_HUMAN	Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q96MU7|YTDC1_HUMAN	YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	3	1	0
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	175-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	110-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|Q9UNS1|TIM_HUMAN	Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	43-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q16181|SEPT7_HUMAN	Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	248-UNIMOD:4,249-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q8NBN7-2|RDH13_HUMAN	Isoform 2 of Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.12	23.0	2	2	2
PRT	sp|Q7Z6B0-2|CCD91_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 91 OS=Homo sapiens OX=9606 GN=CCDC91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|P51654-2|GPC3_HUMAN	Isoform 2 of Glypican-3 OS=Homo sapiens OX=9606 GN=GPC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P54098|DPOG1_HUMAN	DNA polymerase subunit gamma-1 OS=Homo sapiens OX=9606 GN=POLG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q5T0B9|ZN362_HUMAN	Zinc finger protein 362 OS=Homo sapiens OX=9606 GN=ZNF362 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y5B8-2|NDK7_HUMAN	Isoform 2 of Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|Q93050-1|VPP1_HUMAN	Isoform 2 of V-type proton ATPase 116 kDa subunit a1 OS=Homo sapiens OX=9606 GN=ATP6V0A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q53GS7-2|GLE1_HUMAN	Isoform 2 of Nucleoporin GLE1 OS=Homo sapiens OX=9606 GN=GLE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	184-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q9BW61|DDA1_HUMAN	DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	46-UNIMOD:35	0.04	23.0	2	1	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	175-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P32780|TF2H1_HUMAN	General transcription factor IIH subunit 1 OS=Homo sapiens OX=9606 GN=GTF2H1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q6ZRS2|SRCAP_HUMAN	Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y5A7|NUB1_HUMAN	NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	740-UNIMOD:35	0.03	23.0	3	2	1
PRT	sp|O43805|SSNA1_HUMAN	Sjoegren syndrome nuclear autoantigen 1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9HCD5|NCOA5_HUMAN	Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P35573|GDE_HUMAN	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	2	2
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	419-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q92599|SEPT8_HUMAN	Septin-8 OS=Homo sapiens OX=9606 GN=SEPTIN8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	441-UNIMOD:35,448-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	156-UNIMOD:35,157-UNIMOD:35	0.11	23.0	1	1	1
PRT	sp|P13995|MTDC_HUMAN	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	145-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	2	2	2
PRT	sp|Q9P2T1|GMPR2_HUMAN	GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	203-UNIMOD:35,205-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9UHA2|S18L2_HUMAN	SS18-like protein 2 OS=Homo sapiens OX=9606 GN=SS18L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	47-UNIMOD:4	0.21	22.0	1	1	1
PRT	sp|Q9Y2L5-2|TPPC8_HUMAN	Isoform 2 of Trafficking protein particle complex subunit 8 OS=Homo sapiens OX=9606 GN=TRAPPC8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	3	2	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	2	2	2
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	331-UNIMOD:4,337-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|P32780-2|TF2H1_HUMAN	Isoform 2 of General transcription factor IIH subunit 1 OS=Homo sapiens OX=9606 GN=GTF2H1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9HAU5|RENT2_HUMAN	Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	404-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|P51580|TPMT_HUMAN	Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	234-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O75817|POP7_HUMAN	Ribonuclease P protein subunit p20 OS=Homo sapiens OX=9606 GN=POP7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	171-UNIMOD:4	0.09	22.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.04	22.0	1	1	0
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P17010|ZFX_HUMAN	Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P62854|RS26_HUMAN	40S ribosomal protein S26 OS=Homo sapiens OX=9606 GN=RPS26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P09936|UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1617-UNIMOD:35	0.00	22.0	2	1	0
PRT	sp|Q13596|SNX1_HUMAN	Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9UHA3|RLP24_HUMAN	Probable ribosome biogenesis protein RLP24 OS=Homo sapiens OX=9606 GN=RSL24D1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	2	2	2
PRT	sp|P47897|SYQ_HUMAN	Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P50613|CDK7_HUMAN	Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P48444|COPD_HUMAN	Coatomer subunit delta OS=Homo sapiens OX=9606 GN=ARCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q9BTT0|AN32E_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	2	2	2
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	106-UNIMOD:4,108-UNIMOD:4	0.12	22.0	1	1	1
PRT	sp|A6NHR9|SMHD1_HUMAN	Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1856-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	964-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q6NXE6-2|ARMC6_HUMAN	Isoform 2 of Armadillo repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=ARMC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q6UVY6-2|MOXD1_HUMAN	Isoform 2 of DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y5X1|SNX9_HUMAN	Sorting nexin-9 OS=Homo sapiens OX=9606 GN=SNX9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	490-UNIMOD:35,492-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	403-UNIMOD:35	0.01	21.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	356-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	39-UNIMOD:4	0.15	21.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	36-UNIMOD:4,45-UNIMOD:4	0.33	21.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P51648|AL3A2_HUMAN	Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96G21|IMP4_HUMAN	U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens OX=9606 GN=IMP4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.00	21.0	1	1	0
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NPF5|DMAP1_HUMAN	DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	110-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	390-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9NZE8-2|RM35_HUMAN	Isoform 2 of 39S ribosomal protein L35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL35	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96IJ6|GMPPA_HUMAN	Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens OX=9606 GN=GMPPA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	814-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O75147-2|OBSL1_HUMAN	Isoform 2 of Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P05423|RPC4_HUMAN	DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	373-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P01889|HLAB_HUMAN	HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	283-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|P11277|SPTB1_HUMAN	Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	133-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	171-UNIMOD:35	0.01	21.0	1	1	0
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.00	21.0	1	1	0
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96P16|RPR1A_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P61088|UBE2N_HUMAN	Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens OX=9606 GN=UBE2N PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9Y597|KCTD3_HUMAN	BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P60510|PP4C_HUMAN	Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	17-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y2J2|E41L3_HUMAN	Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9NRC6|SPTN5_HUMAN	Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens OX=9606 GN=SPTBN5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.00	21.0	1	1	1
PRT	sp|P09493-5|TPM1_HUMAN	Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9H9J4|UBP42_HUMAN	Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:4,91-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9UPN4|CP131_HUMAN	Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	159-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	61-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9NPC8|SIX2_HUMAN	Homeobox protein SIX2 OS=Homo sapiens OX=9606 GN=SIX2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	797-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	204-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q6PI48|SYDM_HUMAN	Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|Q9HD20-2|AT131_HUMAN	Isoform B of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9H5K3|SG196_HUMAN	Protein O-mannose kinase OS=Homo sapiens OX=9606 GN=POMK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	407-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P15924-3|DESP_HUMAN	Isoform DSPIa of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	2	2	2
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	884-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O75934|SPF27_HUMAN	Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q96LB3|IFT74_HUMAN	Intraflagellar transport protein 74 homolog OS=Homo sapiens OX=9606 GN=IFT74 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	559-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q12907|LMAN2_HUMAN	Vesicular integral-membrane protein VIP36 OS=Homo sapiens OX=9606 GN=LMAN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q86TB9-2|PATL1_HUMAN	Isoform 2 of Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NX61-2|T161A_HUMAN	Isoform 2 of Transmembrane protein 161A OS=Homo sapiens OX=9606 GN=TMEM161A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O60313|OPA1_HUMAN	Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|Q9NVS2|RT18A_HUMAN	39S ribosomal protein S18a, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9H2K0|IF3M_HUMAN	Translation initiation factor IF-3, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	100-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|Q9BZM4|ULBP3_HUMAN	UL16-binding protein 3 OS=Homo sapiens OX=9606 GN=ULBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9Y3A2|UTP11_HUMAN	Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens OX=9606 GN=UTP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	0
PRT	sp|Q06481|APLP2_HUMAN	Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	525-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	338-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|O95865|DDAH2_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O95819|M4K4_HUMAN	Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.13	20.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P23258|TBG1_HUMAN	Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P42696|RBM34_HUMAN	RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|B1AJZ9|FHAD1_HUMAN	Forkhead-associated domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHAD1 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	31-UNIMOD:35	0.11	20.0	1	1	1
PRT	sp|Q9Y4K3|TRAF6_HUMAN	TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	155-UNIMOD:4,160-UNIMOD:35,162-UNIMOD:4,165-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P78310-7|CXAR_HUMAN	Isoform 7 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.25	19.0	1	1	1
PRT	sp|Q9BTC8-2|MTA3_HUMAN	Isoform 2 of Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9BRU9-2|UTP23_HUMAN	Isoform 2 of rRNA-processing protein UTP23 homolog OS=Homo sapiens OX=9606 GN=UTP23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	82-UNIMOD:4,87-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|P11279-2|LAMP1_HUMAN	Isoform 2 of Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UJX2|CDC23_HUMAN	Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q969X5-3|ERGI1_HUMAN	Isoform 3 of Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens OX=9606 GN=ERGIC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	60-UNIMOD:35,70-UNIMOD:4	0.14	19.0	1	1	1
PRT	sp|P40425|PBX2_HUMAN	Pre-B-cell leukemia transcription factor 2 OS=Homo sapiens OX=9606 GN=PBX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5JRA6-4|TGO1_HUMAN	Isoform 4 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	175-UNIMOD:35	0.00	19.0	1	1	1
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1129-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9Y3A2-2|UTP11_HUMAN	Isoform 2 of Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens OX=9606 GN=UTP11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8N543|OGFD1_HUMAN	Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9BYC9|RM20_HUMAN	39S ribosomal protein L20, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q5EBL8|PDZ11_HUMAN	PDZ domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PDZD11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q96BX8|MOB3A_HUMAN	MOB kinase activator 3A OS=Homo sapiens OX=9606 GN=MOB3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O75362|ZN217_HUMAN	Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	682-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	2	2
PRT	sp|Q7L0X0|TRIL_HUMAN	TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	588-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|B1AK53|ESPN_HUMAN	Espin OS=Homo sapiens OX=9606 GN=ESPN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q7Z3K3|POGZ_HUMAN	Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9H9Q2|CSN7B_HUMAN	COP9 signalosome complex subunit 7b OS=Homo sapiens OX=9606 GN=COPS7B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9UQ13|SHOC2_HUMAN	Leucine-rich repeat protein SHOC-2 OS=Homo sapiens OX=9606 GN=SHOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	305-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RNSSYVHGGVDASGKPQEAVYGQNDIHH	1	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	65		ms_run[2]:scan=5782	19.406	4	3021.4078	3021.4078	G	K	36	64
PSM	REQHQHSDLDSNQTHSSGTVTSSSSTANIDDLK	2	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61		ms_run[2]:scan=5795	19.44	5	3581.6215	3581.6215	S	K	1929	1962
PSM	KGHHLPSENLGKEPLDPDPSHSPSD	3	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=6277	20.612	4	2689.2732	2689.2732	G	K	99	124
PSM	KYSAHSSHVTNVSFTHNDSHLISTGG	4	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56		ms_run[2]:scan=6386	20.843	4	2782.3059	2782.3059	H	K	771	797
PSM	KQATYGYYLGNPAEFHDSSDHHTFK	5	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7195	22.907	4	2912.3154	2912.3154	Y	K	90	115
PSM	RVASASAGSCDVPSPFNHRPGSHLDSH	6	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	10-UNIMOD:4	ms_run[2]:scan=6319	20.704	4	2844.311	2844.3110	E	R	299	326
PSM	KKAEGAQNQGQKGEGAQNQG	7	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=3247	14.2580243032	3	2027.016311	2026.978043	G	K	500	520
PSM	RAISHEHSPSDLEAHFVPLVK	8	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49		ms_run[2]:scan=7337	23.259	5	2368.2288	2368.2288	L	R	113	134
PSM	KKFEQSHLHMSSETQANNELTTNGHGPPAS	9	sp|Q15054|DPOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49	10-UNIMOD:35	ms_run[1]:scan=5228	18.249747906933333	4	3292.511717	3292.516717	S	K	153	183
PSM	RKKVEEEDEEEEEEEEEEEEEEDE	10	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=5833	19.541949939733335	3	3082.196364	3082.190578	A	-	177	201
PSM	KSKSEEAHAEDSVMDHHF	11	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	14-UNIMOD:35	ms_run[2]:scan=5082	17.946	4	2098.9014	2098.9014	H	R	306	324
PSM	KLHPDKNPNNPNAHGDFL	12	sp|Q8IXB1-2|DJC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=5988	19.949	3	2026.9973	2026.9973	L	K	61	79
PSM	KEHDPVGQMVNNPKIHLAQSLH	13	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	9-UNIMOD:35	ms_run[2]:scan=6326	20.719	5	2507.2703	2507.2703	K	K	856	878
PSM	KHHAAYVNNLNVTEEKYQEALA	14	sp|P04179-3|SODM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=7225	22.973	4	2541.2612	2541.2612	S	K	53	75
PSM	KEMITMLHYDLLHHPYEPSGNK	15	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7186	22.887	4	2684.2727	2684.2727	K	K	577	599
PSM	RHHNQSTAINLNNPESQSMHLET	16	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	19-UNIMOD:35	ms_run[2]:scan=6219	20.486	4	2673.2314	2673.2314	Q	R	176	199
PSM	KQKLHTDDELNWLDHG	17	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7347	23.283	3	1947.9439	1947.9439	L	R	162	178
PSM	RASFNHFDKDHGGALGPEEF	18	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=7207	22.932	3	2230.0192	2230.0192	F	K	771	791
PSM	REILHNTEKEQHTEDTV	19	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=4626	17.068	3	2078.0029	2078.0029	K	K	259	276
PSM	RHLNLEYHSSMIADAVK	20	sp|O43837-3|IDH3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	11-UNIMOD:35	ms_run[2]:scan=6700	21.596	3	1998.9945	1998.9945	L	K	182	199
PSM	KKDVKGSYVSIHSSGF	21	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=6287	20.630571896266666	3	1737.904939	1737.904984	A	R	32	48
PSM	KRGQTCVVHYTGMLEDGK	22	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44	6-UNIMOD:4	ms_run[1]:scan=6455	21.008452660533333	4	2078.003783	2078.003729	P	K	18	36
PSM	RKKFDDGEDPLDAESQQGGGGNPFH	23	sp|Q13217|DNJC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=7055	22.536069752533333	4	2700.217729	2700.216435	M	R	455	480
PSM	REHGAFDAVKCTHWAEGG	24	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=6775	21.784	4	2026.9068	2026.9068	S	K	775	793
PSM	RKESAVKQETESLHGSSG	25	sp|Q9NV70|EXOC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=4151	16.085156474133335	3	1928.956009	1928.955182	P	K	448	466
PSM	RKFGFVDAQKEDMPPEHV	26	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43	13-UNIMOD:35	ms_run[1]:scan=6664	21.504168242133336	4	2145.032295	2145.031324	K	R	49	67
PSM	RRDSFDDRGPSLNPVLDYDHGS	27	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=7466	23.67234150293333	4	2517.163714	2517.163278	F	R	185	207
PSM	KEHDPVGQMVNNPKIHLAQSLH	28	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7073	22.583	5	2491.2754	2491.2754	K	K	856	878
PSM	KEMITMLHYDLLHHPYEPSGNK	29	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	6-UNIMOD:35	ms_run[2]:scan=7458	23.636	4	2668.2778	2668.2778	K	K	577	599
PSM	KGKHYYEVSCHDQGLC	30	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	10-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=5379	18.541	3	1979.8618	1979.8618	M	R	2	18
PSM	KKHEAFESDLAAHQD	31	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5236	18.267	3	1724.8118	1724.8118	L	R	435	450
PSM	KKHQLLEADISAHED	32	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6030	20.064	3	1732.8744	1732.8744	L	R	1678	1693
PSM	KLRFPAEDEFPDLSAHNNHMA	33	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=7614	24.315	4	2454.1386	2454.1386	L	K	11	32
PSM	RHHNQSTAINLNNPESQSMHLET	34	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6862	22.011	4	2657.2365	2657.2365	Q	R	176	199
PSM	RKYFDFLSSYSAVNQGHCHP	35	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	18-UNIMOD:4	ms_run[2]:scan=7798	25.178	4	2412.1069	2412.1069	G	K	76	96
PSM	RPQQHFLPNQAHQGDHY	36	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5566	18.915	3	2071.9725	2071.9725	P	R	351	368
PSM	RQHDQLEAQKLEYHQVIQQMEQ	37	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	20-UNIMOD:35	ms_run[2]:scan=6723	21.661	4	2794.3457	2794.3457	Q	K	377	399
PSM	RSHEVKAEGYEVAHGG	38	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=4437	16.725199669066665	3	1724.822787	1724.823046	I	R	425	441
PSM	KRGQTCVVHYTGMLEDGK	39	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	6-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=5663	19.127140377066667	4	2093.998703	2093.998644	P	K	18	36
PSM	RRQDDIKDESSEFSSHSN	40	sp|Q9Y5B6|PAXB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=5264	18.3216807736	3	2135.948717	2135.946802	Q	K	486	504
PSM	KEHHNGNFTDPSSVNEK	41	sp|Q96GC9|VMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4296	16.442	3	1938.882	1938.8820	N	K	17	34
PSM	KEHNGHITGIDWAPKSD	42	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6568	21.258	3	1903.9177	1903.9177	L	R	49	66
PSM	KKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHG	43	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=4306	16.458	5	3492.7664	3492.7664	A	K	34	66
PSM	RKSDNHSPAVVTTTVSSK	44	sp|O75179|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=4325	16.5028115888	3	1912.999353	1912.996653	S	K	1633	1651
PSM	KRQETKEAQLYAAQAHL	45	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=6539	21.189168224533333	3	1984.058503	1984.049023	F	K	530	547
PSM	KKKDQVTAQEIFQDNHEDGPTA	46	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=6731	21.683881804266665	4	2498.204512	2498.203745	A	K	543	565
PSM	KAAAHHYGAQCDKPN	47	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:4	ms_run[2]:scan=3445	14.59	3	1666.7634	1666.7634	L	K	26	41
PSM	KALLNNSHYYHMAHG	48	sp|P09622-3|DLDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	12-UNIMOD:35	ms_run[2]:scan=5018	17.794	3	1770.826	1770.8260	S	K	89	104
PSM	KKVIQYLAHVASSH	49	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6744	21.702	3	1579.8835	1579.8835	T	K	189	203
PSM	RHESGASIKIDEPLEGSED	50	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6804	21.85	3	2067.9709	2067.9709	I	R	390	409
PSM	RKLDQEMEQLNHHTTT	51	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35	ms_run[2]:scan=4394	16.638	3	1995.9432	1995.9432	L	R	380	396
PSM	RLREHDAAAESLVDQSAALH	52	sp|Q9BRV8|SIKE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=6825	21.909	3	2188.0985	2188.0985	E	R	18	38
PSM	RVAPEEHPVLLTEAPLNPKAN	53	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7369	23.341	3	2294.2383	2294.2383	L	R	95	116
PSM	RSRSHTSEGAHLDITPNSGAAGNSAGP	54	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=5752	19.339153577066668	4	2647.225433	2646.249467	T	K	361	388
PSM	KKAEVEGKDLPEHAVL	55	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=6250	20.553055729333334	3	1761.964665	1761.962499	Q	K	619	635
PSM	KKKLTQIQESQVTSHN	56	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=4391	16.63313154906667	3	1868.014054	1868.011575	E	K	249	265
PSM	KHLNEIDLFHCIDPNDSKH	57	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:4	ms_run[2]:scan=7550	24.04	5	2331.1066	2331.1066	F	K	48	67
PSM	KVHLDKAQQNNVEH	58	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=3708	14.989	3	1658.8489	1658.8489	I	K	155	169
PSM	RHDGYGSHGPLLPLPSRY	59	sp|Q8WVV9-5|HNRLL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7394	23.42	3	2021.0231	2021.0231	F	R	253	271
PSM	RHIPEAHQATLLDGKQG	60	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=5534	18.845	3	1869.9809	1869.9809	K	K	1364	1381
PSM	RHYNGEAYEDDEHHP	61	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=4262	16.368	3	1867.751	1867.7510	R	R	374	389
PSM	RKAAHEALGQFCCALH	62	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6643	21.447	3	1867.8934	1867.8934	V	K	714	730
PSM	RLQFHDVAGDIFHQQCK	63	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	16-UNIMOD:4	ms_run[2]:scan=7615	24.32	4	2098.0167	2098.0167	V	R	370	387
PSM	KDHLVTAYNHLFETK	64	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7277	23.10268686186667	3	1816.943340	1814.931534	N	R	56	71
PSM	KKHPDSSVNFAEFSK	65	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6490	21.08528344373333	3	1719.858327	1719.858034	K	K	29	44
PSM	KRGGEVLDSSHDDIKLE	66	sp|O76031|CLPX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6361	20.798633226133333	4	1896.955087	1896.954120	E	K	269	286
PSM	KRQETKEAQLYAAQAHL	67	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=6544	21.1985808	3	1984.058503	1984.049023	F	K	530	547
PSM	RKADGPPGPHDGGDRPSAEA	68	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=3747	15.028202508	3	1985.932669	1985.930364	R	R	783	803
PSM	KRGQTCVVHYTGMLEDGK	69	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	6-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=5499	18.775642531466666	4	2093.999084	2093.998644	P	K	18	36
PSM	KKCPSTHSEELHDCIQ	70	sp|P48507|GSH0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4514	16.864	3	1967.8829	1967.8829	R	K	33	49
PSM	KKHLEINPDHSIIETL	71	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7382	23.384	3	1886.0262	1886.0262	A	R	631	647
PSM	KLFVGGIKEDTEEHHL	72	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6940	22.206	4	1850.9527	1850.9527	K	R	113	129
PSM	KNTHCSSLPHYQKL	73	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:4	ms_run[2]:scan=5459	18.695	3	1711.8464	1711.8464	A	K	817	831
PSM	KSYHDLSQASLYPHR	74	sp|Q12923-3|PTN13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6352	20.78	3	1800.8907	1800.8907	S	K	968	983
PSM	RGKDHVVSDFSEHGSL	75	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6297	20.65	3	1768.8493	1768.8493	L	K	763	779
PSM	RHPDSHQLFIGNLPHEVD	76	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7444	23.582	4	2110.0344	2110.0344	V	K	335	353
PSM	RKDLYANTVLSGGTTMYPGIAD	77	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:35	ms_run[2]:scan=7788	25.132	3	2358.1526	2358.1526	I	R	290	312
PSM	RNPVHNGHALLMQDTH	78	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5461	18.698	3	1838.8958	1838.8958	L	K	421	437
PSM	RVASASAGSCDVPSPFNHRPGSHLDSH	79	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	10-UNIMOD:4	ms_run[2]:scan=6453	21.004	4	2844.311	2844.3110	E	R	299	326
PSM	KRGFGFVTFDDHDPVD	80	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7825	25.307216050933334	3	1851.863797	1850.858763	K	K	152	168
PSM	RKDLEGKIEEQQQTSHE	81	sp|Q9C0B7|TNG6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=4930	17.618416719466666	3	2054.004084	2054.002861	N	R	769	786
PSM	RKFGFVDAQKEDMPPEHV	82	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7017	22.4229645016	4	2129.037694	2129.036409	K	R	49	67
PSM	KKHALLEADVAAHQD	83	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5391	18.567	3	1644.8584	1644.8584	Q	R	718	733
PSM	KKTHQPSDEVGTSIEHP	84	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5077	17.929	3	1888.9279	1888.9279	P	R	750	767
PSM	KLFVGGIKEDTEEHHL	85	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6797	21.838	4	1850.9527	1850.9527	K	R	113	129
PSM	KTTHLIAKEEMIHNLQ	86	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=5962	19.88	3	1921.0091	1921.0091	N	-	421	437
PSM	RCYECGEKGHYAYDCH	87	sp|Q16629-3|SRSF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:4,5-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=4702	17.21	3	2103.7986	2103.7986	D	R	105	121
PSM	RHKLVSDGQALPEMEIHLQTNAE	88	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	14-UNIMOD:35	ms_run[2]:scan=7019	22.428	4	2631.3075	2631.3075	L	K	75	98
PSM	RHPGSFDVVHVKDANGNSFAT	89	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6885	22.064	4	2254.0879	2254.0879	E	R	200	221
PSM	RLHNFHQLSAPQPCFTFSHPN	90	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	14-UNIMOD:4	ms_run[2]:scan=7445	23.584	4	2534.2026	2534.2026	V	R	334	355
PSM	RLLLEGISSTHAHHL	91	sp|Q9Y371-3|SHLB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7123	22.724	3	1682.9216	1682.9216	T	R	110	125
PSM	KKVKELEEELQHL	92	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=7404	23.455288716	3	1621.904355	1621.903922	N	K	595	608
PSM	KKALAAAGYDVEKNNS	93	sp|Q02539|H11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5039	17.831198808533333	3	1677.868358	1677.868599	L	R	66	82
PSM	KRPPSAFFLFCSEHRP	94	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	11-UNIMOD:4	ms_run[1]:scan=7612	24.306066412533333	4	1974.990255	1974.988672	P	K	96	112
PSM	KKALEEETKNHEAQIQDM	95	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=5790	19.42377785653333	3	2141.046426	2141.042283	L	R	1180	1198
PSM	KKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHG	96	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=4253	16.345	5	3492.7664	3492.7664	A	K	34	66
PSM	KRHEMPPHIYAITDTAY	97	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:35	ms_run[2]:scan=6934	22.193	3	2057.9993	2057.9993	K	R	6	23
PSM	RHQEFVHMYNAQCDALHP	98	sp|Q9NS91|RAD18_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=6442	20.979	4	2267.9953	2267.9953	K	K	277	295
PSM	RVGHSTAHDEIIPMSIR	99	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:35	ms_run[2]:scan=6151	20.337	3	1933.9792	1933.9792	D	K	158	175
PSM	RVHCCPHGAFCDLVHT	100	sp|P28799-2|GRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:4,5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=6742	21.699	4	1964.8556	1964.8556	D	R	161	177
PSM	KKDENKLSSANGHEE	101	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=3463	14.609219874666667	3	1685.798851	1684.801642	Y	R	16	31
PSM	KKKEIIQDVTLHDLDVANA	102	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7554	24.057245058933333	4	2149.175352	2149.174283	H	R	230	249
PSM	KDLIHDVSFDFHGR	103	sp|Q96EE3|SEH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7613	24.309	4	1684.8322	1684.8322	H	R	12	26
PSM	KGHAWLKDDEATHC	104	sp|Q96T51-2|RUFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=5084	17.95	3	1666.7522	1666.7522	L	R	527	541
PSM	KKHEAFETDFTVH	105	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6521	21.152	3	1587.7682	1587.7682	L	K	1890	1903
PSM	KKHLEINPDHPIVETL	106	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7153	22.797	3	1882.0312	1882.0312	A	R	623	639
PSM	RDRTQIALSPNNHEVHIY	107	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6919	22.155	4	2162.0981	2162.0981	N	K	18	36
PSM	RLHLGSTPHNLTDANIHELA	108	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7325	23.227	4	2208.14	2208.1400	F	R	304	324
PSM	RNPVHNGHALLMQDTH	109	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35	ms_run[2]:scan=4717	17.249	4	1854.8907	1854.8907	L	K	421	437
PSM	KCHLLVEHETQKL	110	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:4	ms_run[1]:scan=5878	19.664919968266666	3	1633.869849	1633.861011	E	K	1152	1165
PSM	KRTGQPMIHIYLDKETG	111	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	7-UNIMOD:35	ms_run[1]:scan=6647	21.460456346133334	3	2002.032528	2002.030596	N	K	391	408
PSM	KKLTGIKHELQANCYEEV	112	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	14-UNIMOD:4	ms_run[1]:scan=6543	21.1962952144	3	2159.106515	2159.104489	K	K	126	144
PSM	KKFYPLEIDYGQDEEAVK	113	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7659	24.529104558133334	3	2171.082013	2171.078651	P	K	636	654
PSM	KGATYGKPVHHGVNQL	114	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4574	16.985	3	1704.906	1704.9060	P	K	77	93
PSM	KKLLETHIHNQGLAAIE	115	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6778	21.789	4	1914.0687	1914.0687	L	K	337	354
PSM	KMAVTFIGNSTAIQELFK	116	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=8691	29.059	3	2013.0605	2013.0605	L	R	362	380
PSM	KYHTINGHNCEVK	117	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:4	ms_run[2]:scan=3719	14.999	3	1598.7624	1598.7624	Q	K	187	200
PSM	RDVKPHNVMIDHQQ	118	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:35	ms_run[2]:scan=4020	15.579	3	1731.8475	1731.8475	H	K	156	170
PSM	RIINEPTAAAIAYGLDK	119	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7923	25.72	3	1814.989	1814.9890	L	K	171	188
PSM	RKLDQEMEQLNHHTTT	120	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6094	20.214	4	1979.9483	1979.9483	L	R	380	396
PSM	RLVIGDHKSTSHF	121	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5862	19.623	3	1495.7896	1495.7896	G	R	55	68
PSM	RTTGIVMDSGDGVTHTVPIYEGYALPHAIL	122	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35	ms_run[2]:scan=8429	27.876	4	3198.6019	3198.6019	G	R	147	177
PSM	RVKGHFGPINSVAFHPDG	123	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7008	22.394	3	1933.9911	1933.9911	G	K	280	298
PSM	RVSVADHSLHLSKA	124	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5714	19.25	4	1518.8267	1518.8267	S	K	66	80
PSM	KKDENKLSSANGHEE	125	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3482	14.630217658933333	3	1684.802345	1684.801642	Y	R	16	31
PSM	RKKGPGAGSALDDG	126	sp|O95782|AP2A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=3835	15.125031110933332	2	1327.684819	1327.684427	K	R	618	632
PSM	KKIVKEAHEPLAVADA	127	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5377	18.536596119466665	3	1717.974700	1717.972670	L	K	77	93
PSM	KKGSIHVSSAITEDQK	128	sp|Q96Q89|KI20B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4689	17.1817843512	3	1726.922402	1726.921363	A	K	847	863
PSM	KKRGAPPSSNIEDFHGLLP	129	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7559	24.078024201866665	4	2062.096879	2062.095973	E	K	268	287
PSM	KKRGAPPSSNIEDFHGLLP	130	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7653	24.4987150792	4	2062.096879	2062.095973	E	K	268	287
PSM	RKPSHTSAVSIAGKETLSSAA	131	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5741	19.310905733866665	4	2097.118915	2097.117831	N	K	91	112
PSM	KRKLAGANPAVITCDELLLGHE	132	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	14-UNIMOD:4	ms_run[1]:scan=7721	24.8172112144	4	2404.291578	2404.289664	A	K	4048	4070
PSM	KANIRNMSVIAHVDHG	133	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:35	ms_run[2]:scan=5059	17.885	3	1776.9053	1776.9053	K	K	16	32
PSM	KEHHFGSSGMTLHE	134	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:35	ms_run[2]:scan=4392	16.635	3	1611.71	1611.7100	V	R	639	653
PSM	KGHYTEGAELVDSVLDVV	135	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8909	30.063	3	1929.9684	1929.9684	A	R	103	121
PSM	KHLEMNPHFGSH	136	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5535	18.846	3	1432.667	1432.6670	Q	R	668	680
PSM	KIGEHMEEHGIKFI	137	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7162	22.82	4	1666.8501	1666.8501	N	R	197	211
PSM	KKIHEEFSEHALL	138	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6801	21.843	3	1579.8358	1579.8358	A	R	676	689
PSM	KSHLFFTAGKDH	139	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6012	20.012	2	1386.7044	1386.7044	P	K	644	656
PSM	KTHLSLSHQPDK	140	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3989	15.457	3	1389.7365	1389.7365	A	K	909	921
PSM	RDCQLNAHKDHQYQFLEDAV	141	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:4	ms_run[2]:scan=7433	23.557	4	2486.1397	2486.1397	C	R	148	168
PSM	RESNSSLQLQHHDTTHEAATYGSMRPY	142	sp|Q9Y597-2|KCTD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	24-UNIMOD:35	ms_run[2]:scan=5957	19.869	5	3131.4115	3131.4115	L	R	622	649
PSM	RHIEHMESDELGLQK	143	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:35	ms_run[2]:scan=5009	17.781	4	1836.8788	1836.8788	L	K	425	440
PSM	RHIGKPLLGGPFSLTTHTGE	144	sp|O75880|SCO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7455	23.626	4	2117.1382	2117.1382	Q	R	129	149
PSM	RHIPEAHQATLLDGKQG	145	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5510	18.793	4	1869.9809	1869.9809	K	K	1364	1381
PSM	RHPLVPNQGDHSAHLP	146	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5863	19.625	3	1773.9023	1773.9023	A	R	335	351
PSM	RHQADACHAYQIIH	147	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4	ms_run[2]:scan=5598	18.989	4	1718.806	1718.8060	Y	R	44	58
PSM	RILGVCGMHPHHQETL	148	sp|P42575-3|CASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=5650	19.102	3	1899.9196	1899.9196	R	K	8	24
PSM	RLKGLGAFVIDSDHLGH	149	sp|Q13057|COASY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7717	24.801	4	1833.985	1833.9850	Q	R	377	394
PSM	RLNFSHGTHEYHAETI	150	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6389	20.848	4	1910.9024	1910.9024	A	K	73	89
PSM	RNPHAAKDSSDPNELYVNH	151	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4941	17.637	4	2163.0093	2163.0093	T	K	148	167
PSM	RQLMHSGHPSEKEI	152	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35	ms_run[2]:scan=3912	15.253	3	1663.81	1663.8100	A	K	900	914
PSM	RSVSHGSNHTQKPDEQ	153	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3303	14.393	3	1805.8405	1805.8405	K	R	680	696
PSM	RTKLHQLSGSDQLESTAHS	154	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5276	18.344	4	2094.0454	2094.0454	E	R	176	195
PSM	RWATHGEPSPVNSHPQRSD	155	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4806	17.398	4	2157.01	2157.0100	T	K	95	114
PSM	RYTEFYHVPTHSDASK	156	sp|Q96HC4-3|PDLI5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6202	20.455	4	1936.9068	1936.9068	E	K	123	139
PSM	KKPHIYYGSLEEKE	157	sp|O43172|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5875	19.654740806666666	3	1719.884943	1719.883186	V	R	26	40
PSM	KKTLEEAIRSDTSGHFQ	158	sp|P50995|ANX11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7157	22.806834647733336	4	1945.986433	1945.985754	F	R	319	336
PSM	KKHSSGIVADLSEQSLKDGEE	159	sp|Q15435|PP1R7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=7018	22.4252684144	3	2256.130302	2256.123370	G	R	33	54
PSM	RKGHEENGDVVTEPQVAEKNEANG	160	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=4905	17.5699713288	4	2606.233433	2606.232085	P	R	24	48
PSM	KEGIPALDNFLDKL	161	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8919	30.114	3	1571.8559	1571.8559	L	-	845	859
PSM	KIGEHMEEHGIKFI	162	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35	ms_run[2]:scan=6702	21.601	4	1682.845	1682.8450	N	R	197	211
PSM	KKGHVSSHDEQQVEAGAVQL	163	sp|Q92667-2|AKAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6067	20.157	3	2146.0767	2146.0767	R	R	29	49
PSM	KKHLEINPDHPIVETL	164	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7151	22.794	4	1882.0312	1882.0312	A	R	623	639
PSM	KKHQALQAEIAGHEP	165	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5667	19.135	3	1655.8744	1655.8744	L	R	824	839
PSM	KSMTEAEQQQLIDDHFLFD	166	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35	ms_run[2]:scan=8375	27.649	3	2310.0474	2310.0474	L	K	177	196
PSM	RDVKPHNVMIDHQQ	167	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=3996	15.487	3	1731.8475	1731.8475	H	K	156	170
PSM	RHAQVHAGGPAPHPCP	168	sp|Q8NAF0|ZN579_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:4	ms_run[2]:scan=3926	15.284	3	1687.8114	1687.8114	A	R	429	445
PSM	RHKELFALHPSPDEEEPIE	169	sp|Q96N67-7|DOCK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7220	22.963	4	2272.1124	2272.1124	N	R	231	250
PSM	RHPHDIIDDINSGAVECPAS	170	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=7512	23.866	3	2202.0124	2202.0124	G	-	113	133
PSM	RVLVHRPHGPELDADPYDPGEEDPAQS	171	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6932	22.188	4	2995.406	2995.4060	C	R	402	429
PSM	RVPTANVSVVDLTCRLE	172	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:4	ms_run[2]:scan=8026	26.151	3	1928.0149	1928.0149	F	K	192	209
PSM	RSWLFQHIGHPYPTEDEK	173	sp|P55347|PKNX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7541	23.996799694666667	4	2239.080565	2239.081051	M	K	275	293
PSM	RHLQLAIRNDEELN	174	sp|Q96QV6|H2A1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6746	21.70620660213333	3	1719.902824	1719.901630	P	K	82	96
PSM	KKEFLHAQEEVK	175	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4653	17.114713761333334	3	1484.798681	1484.798728	L	R	69	81
PSM	RLAGSALTDKHSDKS	176	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=3911	15.251276031466666	3	1584.821384	1584.821983	Q	-	1530	1545
PSM	KKIKGIVEESVTGVH	177	sp|Q96HN2|SAHH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6088	20.200270534399998	3	1622.935791	1622.935556	F	R	327	342
PSM	RKNEPIIKVSDHSN	178	sp|O94979|SC31A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4543	16.9305546112	4	1635.871161	1635.869268	L	R	199	213
PSM	RRKEIDLLLGQTDDT	179	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=7565	24.104317756	3	1771.943807	1771.942827	E	R	153	168
PSM	RKACPLQPDHTNDEKE	180	sp|Q15004|PAF15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:4	ms_run[1]:scan=3758	15.039835857066667	3	1936.906074	1936.906124	K	-	96	112
PSM	KFDEHDGPVRGIDFH	181	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6891	22.075	3	1767.8329	1767.8329	D	K	46	61
PSM	KGIGHTTGKPLHF	182	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5588	18.968	3	1391.7674	1391.7674	E	K	56	69
PSM	KGRPAPGFHHGDGPGNAVQEIMIPAS	183	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	22-UNIMOD:35	ms_run[2]:scan=7091	22.642	4	2655.2976	2655.2976	E	K	170	196
PSM	KHAFSGGRDTIEEH	184	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4332	16.531	4	1582.7488	1582.7488	N	R	333	347
PSM	KHRDEVVAEHPDASGEEIEELL	185	sp|O96028-5|NSD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7759	24.995	4	2501.2034	2501.2034	Q	R	466	488
PSM	KHTLQQHQETPK	186	sp|Q7Z417-2|NUFP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3427	14.568	3	1473.7688	1473.7688	Q	K	78	90
PSM	KKHFTILDAPGH	187	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6226	20.502	3	1362.7408	1362.7408	E	K	151	163
PSM	KKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHG	188	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4446	16.74	5	3492.7664	3492.7664	A	K	34	66
PSM	KLDDLHTLYHK	189	sp|Q9HD26-2|GOPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6334	20.734	3	1381.7354	1381.7354	S	K	441	452
PSM	KSQHASETFHHSSNWL	190	sp|Q9UNY4-2|TTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6452	21	4	1894.8711	1894.8711	N	R	107	123
PSM	KVYQNHVQHLISEK	191	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5396	18.578	4	1721.9213	1721.9213	E	R	412	426
PSM	RHHYEQQQEDLA	192	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4326	16.507	2	1552.7019	1552.7019	L	R	1319	1331
PSM	RHLQLAIRNDEELN	193	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6763	21.749	3	1719.9016	1719.9016	P	K	82	96
PSM	RQLFHPEQLITGKEDAANNYA	194	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7651	24.492	4	2414.1979	2414.1979	Y	R	84	105
PSM	RSAGHHLIPVKENLVD	195	sp|Q9NQW7-4|XPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6534	21.178	3	1783.9693	1783.9693	L	K	180	196
PSM	RYLDHLLAHTAPHP	196	sp|P46020-2|KPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7239	23.007	4	1639.8583	1639.8583	A	K	662	676
PSM	KTLHTEDTDHQHTASHGEEEAL	197	sp|Q6PJI9|WDR59_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4370	16.593357029333333	4	2486.114580	2485.110573	E	K	347	369
PSM	KTLSKEEETKK	198	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3301	14.3897629704	3	1319.729363	1319.729646	I	-	186	197
PSM	KKVMELLVHLNK	199	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:35	ms_run[1]:scan=6392	20.8534226192	3	1466.864219	1466.864306	R	R	56	68
PSM	KKILYEGTHLDPER	200	sp|Q5RI15|COX20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=5861	19.620447222133336	4	1697.909759	1697.910070	K	K	97	111
PSM	KKKVMSQEIQEQLH	201	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	5-UNIMOD:35	ms_run[1]:scan=4533	16.904950605066666	3	1740.921685	1740.919255	E	K	3252	3266
PSM	KKAYCPQIGCSHTDIR	202	sp|Q96MF7|NSE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	5-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=5163	18.11705508053333	4	1932.930107	1932.929836	K	K	206	222
PSM	RGGDPSKEPERVVHYEI	203	sp|O95169-3|NDUB8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6561	21.242824139466666	4	1966.986761	1966.986088	E	-	139	156
PSM	KKKMQAHIQDLEEQLDEEEGA	204	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:35	ms_run[1]:scan=7152	22.795586775733334	4	2484.182641	2484.180233	E	R	945	966
PSM	RKKNGPLEVAGAAVSAGHGLPA	205	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=7141	22.774570513333334	3	2099.161332	2099.159970	L	K	249	271
PSM	KAFLASPEYVNLPINGNGKQ	206	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7962	25.885	3	2159.1375	2159.1375	L	-	191	211
PSM	KAFSHSSHLIGHQ	207	sp|Q15776|ZKSC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4500	16.841	3	1447.732	1447.7320	G	R	441	454
PSM	KDVGAQILLHSHK	208	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6078	20.182	3	1444.815	1444.8150	A	K	205	218
PSM	KEHHFGSSGMTLHE	209	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5546	18.872	3	1595.7151	1595.7151	V	R	639	653
PSM	KHFYTFTNEHH	210	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5410	18.607	3	1459.6633	1459.6633	E	R	118	129
PSM	KHLEINPDHSIIETL	211	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7685	24.653	3	1757.9312	1757.9312	K	R	632	647
PSM	KHLEMNPHFGSH	212	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=4211	16.24	3	1448.6619	1448.6619	Q	R	668	680
PSM	KKMEGHYVHAGNIIATQ	213	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=5372	18.527	4	1911.9625	1911.9625	I	R	54	71
PSM	KRVSALNSVHCEHVEDEGES	214	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=5173	18.137	4	2281.0393	2281.0393	Y	R	1681	1701
PSM	KSPDDPSRYISPDQLADLY	215	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8392	27.717	3	2179.0433	2179.0433	F	K	169	188
PSM	KSVHHNPSKFGIQEE	216	sp|Q2M389-2|WASC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4945	17.643	3	1735.8642	1735.8642	L	K	225	240
PSM	KVGHSIRHPDVEVDGFSEL	217	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7409	23.474	3	2120.0651	2120.0651	W	R	59	78
PSM	RAISHEHSPSDLEAHFVPLVK	218	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7350	23.289	3	2368.2288	2368.2288	L	R	113	134
PSM	RCTAGTLHNLSHH	219	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=4294	16.439	3	1502.7161	1502.7161	A	R	212	225
PSM	RDLLHNEDRHDDYFQE	220	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6856	21.995	4	2100.9249	2100.9249	H	R	430	446
PSM	RHGAVCHTGAPDATLHTVHPDSVSSSYSS	221	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=5964	19.887	4	3032.3795	3032.3795	P	R	499	528
PSM	RHLAPDHLLQICH	222	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:4	ms_run[2]:scan=6880	22.052	4	1608.8307	1608.8307	Y	R	68	81
PSM	RIRTFLAQHASL	223	sp|Q9NPA8-2|ENY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7160	22.813	2	1411.8048	1411.8048	Q	-	85	97
PSM	RKHFSQAEGSQLDEV	224	sp|Q7L5Y9-3|MAEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5938	19.825	3	1729.8384	1729.8384	A	R	181	196
PSM	RPIHPSKAPNYPTEGNH	225	sp|Q9GZT8-3|NIF3L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4531	16.9	4	1913.9496	1913.9496	S	R	151	168
PSM	RRMESSINHISQTVDIH	226	sp|Q8IZP0-10|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35	ms_run[2]:scan=6197	20.443	4	2038.0014	2038.0014	L	K	84	101
PSM	RRQLIVPPHLAHGESGA	227	sp|Q96AY3-2|FKB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6314	20.69	4	1837.0071	1837.0071	E	R	224	241
PSM	RSHHSISSQTFEHPLVNETEGSS	228	sp|Q9NVW2-2|RNF12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6617	21.379	4	2565.1844	2565.1844	R	R	100	123
PSM	RSHILEQHPHTLDLSPSE	229	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6657	21.484	4	2095.0447	2095.0447	A	K	107	125
PSM	RSSSLDGEHHDGYH	230	sp|Q9C0J8|WDR33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3680	14.957	3	1595.6713	1595.6713	G	R	1276	1290
PSM	KKILEVHIDKGM	231	sp|P31689|DNJA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:35	ms_run[1]:scan=5554	18.88946069253333	3	1425.802614	1425.801371	E	K	205	217
PSM	RRYLESLGEEQR	232	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6116	20.26955183333333	3	1534.786225	1534.785204	R	K	188	200
PSM	RKTVTAMDVVYALK	233	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7830	25.3303888272	3	1593.892598	1593.891249	K	R	79	93
PSM	RRPAVVYIGSAGKPHE	234	sp|Q9BUQ8|DDX23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5476	18.72553645413333	4	1735.947159	1735.948187	L	R	622	638
PSM	RRPLILQLVHVSQEDK	235	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7702	24.736230245599998	4	1930.111917	1930.111229	T	R	60	76
PSM	KKRGFGFVTFDDHDPVD	236	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7662	24.545175275466665	3	1978.957849	1978.953726	G	K	151	168
PSM	RKKNGPLEVAGAAVSAGHGLPA	237	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7101	22.664985545866667	4	2099.160951	2099.159970	L	K	249	271
PSM	RRREDNLNDSSQQLQDSL	238	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6816	21.886624007466665	3	2173.050450	2173.047185	A	R	815	833
PSM	RKSEHLSVRPQTALEENETQ	239	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5866	19.633251582133333	4	2351.184426	2351.182950	S	K	149	169
PSM	KKHISQISVAEDDDESLLGHLMIVGK	240	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	22-UNIMOD:35	ms_run[1]:scan=7907	25.655770012266665	4	2877.494309	2877.490609	P	K	57	83
PSM	KEAVIKHSLVH	241	sp|Q15397|PUM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4311	16.467	3	1259.735	1259.7350	Q	K	319	330
PSM	KGRPGPVAGHHQMP	242	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=3576	14.798	3	1483.7466	1483.7467	P	R	544	558
PSM	KHLPQQWSVDHNHQ	243	sp|Q9NVH0-2|EXD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5138	18.059	3	1752.8444	1752.8444	P	K	468	482
PSM	KHRNDHLTSTTSSPGVIVPESSEN	244	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6019	20.03	4	2591.2576	2591.2576	R	K	52	76
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	245	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35,25-UNIMOD:4	ms_run[2]:scan=8032	26.174	3	2806.3167	2806.3167	L	K	91	118
PSM	KHVVFGHVKEGMDVV	246	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=5986	19.945	3	1695.8767	1695.8767	G	K	167	182
PSM	KKHHLQPENPGPGGAAPSLEQN	247	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5436	18.66	4	2305.1563	2305.1563	K	R	387	409
PSM	KLLHHVTEEKGNPEIDN	248	sp|Q5TBB1-2|RNH2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5110	17.998	3	1972.0014	1972.0014	E	K	136	153
PSM	KRGFAFVTFDDHDSVD	249	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7781	25.097	3	1854.8537	1854.8537	K	K	145	161
PSM	KSRPLANGHPILNNNH	250	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4662	17.131	3	1780.9445	1780.9445	A	R	361	377
PSM	KSVPLGHTHHLA	251	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4178	16.172	3	1295.7099	1295.7099	L	K	445	457
PSM	KTFHHVYSGKDLIAQA	252	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6554	21.227	3	1813.9475	1813.9475	A	R	147	163
PSM	KVHSQGPHHVCELCN	253	sp|P56270-3|MAZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4047	15.693	3	1800.8148	1800.8148	M	K	388	403
PSM	RDLAQYDAAHHEEFK	254	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5796	19.442	4	1828.8493	1828.8493	T	R	163	178
PSM	REHFQSYDLDHMEK	255	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=5567	18.918	4	1849.8053	1849.8053	L	K	104	118
PSM	REKANGTTVHVGIHPS	256	sp|P61254|RL26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4675	17.154	3	1701.8911	1701.8911	Q	K	87	103
PSM	RLAQHITYVHQHS	257	sp|P33993-3|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4761	17.321	3	1588.8223	1588.8223	L	R	356	369
PSM	RPHDFFDAQTLDAIRH	258	sp|Q6ZN18-3|AEBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7667	24.568	4	1937.9496	1937.9496	P	R	177	193
PSM	RPRHQGVMVGMGQ	259	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:35	ms_run[2]:scan=4464	16.778	3	1467.7187	1467.7187	G	K	37	50
PSM	RSKVDEAVAVLQAHHA	260	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7234	22.997	3	1729.9224	1729.9224	L	K	600	616
PSM	RSPVVGFDPHHHM	261	sp|Q04727-2|TLE4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=5383	18.55	3	1530.715	1530.7150	G	R	349	362
PSM	RSVTVVEDDEDEDGDDLLHHHHVSGS	262	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6660	21.49	4	2898.2652	2898.2652	V	R	545	571
PSM	RWKATYIHNCL	263	sp|Q9NP79-2|VTA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:4	ms_run[2]:scan=6875	22.043	3	1460.7347	1460.7347	A	K	88	99
PSM	VKLDIHTLAHHL	264	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7478	23.723	3	1395.7987	1395.7987	M	K	2	14
PSM	KHLNEIDLFHCID	265	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	11-UNIMOD:4	ms_run[1]:scan=7864	25.478158806666666	3	1652.7987	1652.7976	F	P	48	61
PSM	RRDDGLSAAAR	266	sp|P84101|SERF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3875	15.193030692799999	3	1186.617218	1186.616682	K	K	26	37
PSM	RRGADDDRPSW	267	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5423	18.630622705866664	2	1329.618354	1329.617410	S	R	979	990
PSM	RRTAQEVETYR	268	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4346	16.553621649066667	3	1407.722108	1407.721875	A	R	67	78
PSM	RRAPFDLFENR	269	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7611	24.302389445866666	3	1419.737239	1419.737131	P	K	345	356
PSM	KKLMTHVDKAEGTTY	270	sp|O14617|AP3D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	4-UNIMOD:35	ms_run[1]:scan=4269	16.382135309866666	3	1736.877125	1736.876721	V	R	378	393
PSM	KKIEHDVVMKASSSLP	271	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35	ms_run[1]:scan=5998	19.9776907808	3	1783.954135	1783.950220	R	K	59	75
PSM	RRKDSAIQQQVANLQM	272	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:35	ms_run[1]:scan=6475	21.054302391733334	3	1900.990249	1900.990128	M	K	1226	1242
PSM	KRTGQPMIHIYLDKETG	273	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7010	22.400412278133334	4	1986.036685	1986.035681	N	K	391	408
PSM	RKRAGDELAYNSSSACASS	274	sp|Q86Y37|CACL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	16-UNIMOD:4	ms_run[1]:scan=4885	17.537417323466666	3	2028.930033	2028.928316	S	R	347	366
PSM	RKHPPVESGDTPKDPAVIS	275	sp|Q9Y6K1|DNM3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5217	18.2247189104	3	2030.065512	2029.059253	K	K	55	74
PSM	RKPRDCATEEDEPPAPELHQDAA	276	sp|Q66K14|TBC9B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:4	ms_run[1]:scan=5595	18.9827974592	4	2631.201946	2631.198343	G	R	1074	1097
PSM	KALLNNSHYYHMAHG	277	sp|P09622-3|DLDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5934	19.815	4	1754.8311	1754.8311	S	K	89	104
PSM	KARDHGLLIYHIPQVEP	278	sp|Q9Y676|RT18B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7679	24.626	3	1985.0847	1985.0847	Q	R	156	173
PSM	KARDPHSGHFVAL	279	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5818	19.493	3	1433.7528	1433.7528	Y	K	22	35
PSM	KDHIMSHPALHDALNDPKNGDSAT	280	sp|Q9NUP7-2|TRM13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35	ms_run[2]:scan=5346	18.471	4	2599.2085	2599.2085	L	K	138	162
PSM	KEHHFGSSGMTLHE	281	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=4378	16.611	3	1611.71	1611.7100	V	R	639	653
PSM	KGTVSFHSHSDH	282	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3650	14.928	3	1337.6113	1337.6113	P	R	384	396
PSM	KHIYYITGETKDQVANSAFVE	283	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7331	23.242	3	2412.1961	2412.1961	Q	R	489	510
PSM	KHRSATYCEQLLQHVQAVPATQ	284	sp|Q86Y56|DAAF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=7448	23.594	4	2564.2918	2564.2918	H	-	834	856
PSM	KLAPKDYVHCLH	285	sp|Q8N201|INT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=6198	20.444	3	1479.7657	1479.7657	S	K	602	614
PSM	KLEHEISHLK	286	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4535	16.91	2	1232.6877	1232.6877	E	K	843	853
PSM	KPLAHHIPVEKICE	287	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:4	ms_run[2]:scan=5858	19.612	3	1669.8974	1669.8974	S	K	94	108
PSM	KQVHPDTGISS	288	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4010	15.543	2	1167.5884	1167.5884	L	K	47	58
PSM	KRTSSAQVEGGVHSLHSYE	289	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5619	19.033	4	2071.0083	2071.0083	E	K	492	511
PSM	KVHLVGIDIFTGK	290	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7960	25.874	3	1425.8344	1425.8344	A	K	55	68
PSM	KVKIGEHQLTGH	291	sp|P54646|AAPK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4741	17.285	3	1345.7466	1345.7466	G	K	29	41
PSM	REPALGPHGPSRH	292	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3954	15.366	3	1409.7276	1409.7276	P	K	602	615
PSM	REVPEYLHHVNK	293	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5114	18.008	3	1519.7896	1519.7896	E	R	212	224
PSM	RGFGFVTFDDHDPVD	294	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8262	27.151	3	1722.7638	1722.7638	K	K	153	168
PSM	RLPSLLHTPSSHK	295	sp|O60287|NPA1P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6258	20.573	3	1471.8259	1471.8259	D	R	1344	1357
PSM	RLVIGDHKSTSHF	296	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5664	19.129	4	1495.7896	1495.7896	G	R	55	68
PSM	RQIVRDPGAHSLGHMSADT	297	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:35	ms_run[2]:scan=4765	17.326	4	2062.9967	2062.9967	L	R	874	893
PSM	RRWQPPEFLLVHDSGPDH	298	sp|P18583-2|SON_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7828	25.323	4	2185.0817	2185.0817	K	R	2064	2082
PSM	RVDAVHLLKDHVG	299	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6958	22.252	2	1457.8103	1457.8103	L	R	328	341
PSM	RVVAHVLPCGHLLH	300	sp|Q96PM5-3|ZN363_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=6670	21.515	4	1606.8878	1606.8878	S	R	156	170
PSM	KKLEDGPKFL	301	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6639	21.437633220533332	2	1173.676439	1173.675760	G	K	385	395
PSM	RKLKELEVAEGG	302	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5766	19.370548936	2	1327.747539	1327.745965	Q	K	66	78
PSM	KKKEEEATEWQH	303	sp|P35241|RADI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4061	15.752049787733334	3	1541.749823	1541.747421	K	K	436	448
PSM	KHKPQVSQQEELK	304	sp|Q69YU5|BWNIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3687	14.964476331466667	3	1577.852756	1577.852555	R	-	59	72
PSM	RRTEITIVKPQESAH	305	sp|Q9UHD8|SEPT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5256	18.307260092533333	4	1763.962914	1763.964231	P	R	148	163
PSM	RVDAVHLLKDHVG	306	sp|Q9NTZ6|RBM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6947	22.219017673066666	3	1459.816376	1457.810296	L	R	328	341
PSM	RKDKELYTQNGILHMLD	307	sp|Q9NP77|SSU72_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	15-UNIMOD:35	ms_run[1]:scan=7164	22.8262826424	4	2089.061035	2089.062625	L	R	70	87
PSM	KGAGVHSGERPPHSLSSNA	308	sp|Q147X3-2|NAA30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4120	15.985	3	1886.9347	1886.9347	T	R	91	110
PSM	KGRPGPVAGHHQMP	309	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:35	ms_run[2]:scan=3574	14.792	2	1483.7466	1483.7467	P	R	544	558
PSM	KHTTSIFDDFSHYEK	310	sp|Q9Y5A9-2|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7588	24.2	4	1853.8584	1853.8584	Y	R	498	513
PSM	KPVLPHKVAHF	311	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5758	19.351	3	1271.7503	1271.7503	L	K	444	455
PSM	KQLPHFTSEHIK	312	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5560	18.901	3	1463.7885	1463.7885	L	R	1961	1973
PSM	KTHHNDTELIR	313	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4100	15.905	2	1362.7004	1362.7004	I	K	290	301
PSM	KVTHKNEADDYHL	314	sp|Q86VG3|IFTAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5042	17.84	3	1568.7583	1568.7583	A	R	68	81
PSM	RHENYDEHISNFHS	315	sp|Q7Z624|CMKMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5579	18.944	3	1783.7663	1783.7663	Q	K	284	298
PSM	RHTEMIHNYMEHLE	316	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=5912	19.756	4	1854.8141	1854.8141	Q	R	162	176
PSM	RKIHSQEEAL	317	sp|O00764-2|PDXK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4212	16.243	2	1209.6466	1209.6466	G	R	132	142
PSM	RKLHYNEGLNI	318	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6632	21.418	2	1355.731	1355.7310	R	K	144	155
PSM	RKQSLGELIGTLNAA	319	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8085	26.39	3	1569.8839	1569.8839	G	K	18	33
PSM	RRQLIVPPHLAHGESGA	320	sp|Q96AY3|FKB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6294	20.6432634144	4	1837.007723	1837.007098	E	R	451	468
PSM	KTFHHVYSGKDLIAQA	321	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6515	21.140918528266663	3	1813.948548	1813.947518	A	R	215	231
PSM	KVGHSIRHPDVEVDGFSEL	322	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7403	23.453615826133333	4	2120.066278	2120.065067	W	R	59	78
PSM	RKGGPDDRGF	323	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4134	16.034041773600002	3	1103.547037	1103.547205	F	R	129	139
PSM	RRYQEIEEDR	324	sp|Q9Y3X0|CCDC9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4515	16.8658154672	3	1392.672952	1392.674590	I	K	33	43
PSM	KKFYPLEIDYGQDEEAVK	325	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7650	24.4863130888	4	2171.083096	2171.078651	P	K	636	654
PSM	RKLDELLGKDHTQVVSL	326	sp|Q96EX1|SIM12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7533	23.959345809333335	4	1950.091224	1950.089825	D	K	56	73
PSM	RKSLDEQANQENDALHK	327	sp|A4D1E9|GTPBA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4603	17.026937325333332	4	1994.978920	1994.976980	I	K	340	357
PSM	KKTTHFVEGGDAGNREDQIN	328	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4734	17.275546225866666	4	2215.061710	2215.061773	K	R	222	242
PSM	KEKPQQHNFTH	329	sp|Q9Y4P3|TBL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3558	14.73	2	1392.6898	1392.6898	R	R	69	80
PSM	KETVRDYEHQFHL	330	sp|Q15276-2|RABE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7297	23.154	4	1700.8271	1700.8271	M	R	122	135
PSM	KHAEMVHTGLKLE	331	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5968	19.899	4	1491.7868	1491.7868	Q	R	70	83
PSM	KHAEMVHTGLKLE	332	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5974	19.916	4	1491.7868	1491.7868	Q	R	70	83
PSM	KHHLDLGHNSQAYEALTQIPDSS	333	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7556	24.064	4	2560.2306	2560.2306	F	R	1006	1029
PSM	KHKELAPYDENWFYT	334	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7848	25.413	3	1939.9105	1939.9105	A	R	41	56
PSM	KHLEINPDHPIVETL	335	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7496	23.798	3	1753.9363	1753.9363	K	R	624	639
PSM	KHLNEIDLFHCIDPNDS	336	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:4	ms_run[2]:scan=8089	26.408	3	2065.9527	2065.9527	F	K	48	65
PSM	KHSHMIAMIHSLSGG	337	sp|Q8TCG1-2|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5061	17.889	3	1636.7814	1636.7814	N	K	721	736
PSM	KKHQALQAEIAGHEP	338	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5495	18.767	3	1655.8744	1655.8744	L	R	824	839
PSM	KKHSQHYQIPDDFVADV	339	sp|Q9UPN9-2|TRI33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7524	23.918	3	2025.9908	2025.9908	Q	R	1012	1029
PSM	KRPEEVALGLHH	340	sp|Q96ER9|MITOK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5620	19.036	3	1384.7575	1384.7575	E	R	47	59
PSM	KTAAEDAIRNLHHY	341	sp|Q9BWF3-3|RBM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6532	21.174	4	1637.8274	1637.8274	D	K	45	59
PSM	RAVGRLEAVSHTSDMH	342	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35	ms_run[2]:scan=4618	17.056	3	1780.8639	1780.8639	E	R	13	29
PSM	RDVKPHNVMIDHQQ	343	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4667	17.139	3	1715.8526	1715.8526	H	K	156	170
PSM	REHFQSYDLDHMEK	344	sp|Q13564-3|ULA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6458	21.014	4	1833.8104	1833.8104	L	K	104	118
PSM	RHKMTTLTPAYHAENYSPEDN	345	sp|Q6IA69|NADE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=5856	19.606	4	2490.1234	2490.1234	N	R	647	668
PSM	RHSVSIHSFQSTSLHNS	346	sp|Q9ULE6|PALD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6059	20.137	4	1922.9347	1922.9347	S	K	30	47
PSM	RNFYVDGHVPKPH	347	sp|Q6P4F2|FDX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6016	20.024	3	1564.7899	1564.7899	T	-	174	187
PSM	RNKNFNIHGTN	348	sp|P15586-2|GNS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4341	16.547	3	1313.6589	1313.6589	P	K	235	246
PSM	RRIEQHYFED	349	sp|O75431-2|MTX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5936	19.819	2	1391.6582	1391.6582	C	R	237	247
PSM	RTITMHKDSTGHVGFIF	350	sp|O00560-3|SDCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=7312	23.195	4	1961.9782	1961.9782	E	K	191	208
PSM	RTVIIHDRPDITHP	351	sp|Q9NWH9-3|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6103	20.241	4	1668.906	1668.9060	R	R	423	437
PSM	RTVKDAHSIHGTNPQYLVE	352	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6220	20.488	4	2164.1025	2164.1025	N	K	4	23
PSM	RVAPEEHPVLLTEAPLNP	353	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7779	25.09	3	1981.0633	1981.0633	L	K	95	113
PSM	RYRHDENILESEPIVY	354	sp|Q96F86|EDC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7673	24.597	3	2032.0014	2032.0014	T	R	243	259
PSM	KKDSELDKHLES	355	sp|O75688|PPM1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4183	16.18327208133333	3	1427.725557	1427.725623	V	R	307	319
PSM	RRGESMQPNR	356	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3494	14.6448904536	3	1229.604675	1229.604737	S	R	224	234
PSM	RRKEDLLDQL	357	sp|O15226|NKRF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7402	23.4499283512	2	1284.715863	1284.714999	K	K	664	674
PSM	KKPISLGHPGSLK	358	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4933	17.622847925866665	3	1360.819358	1360.819070	L	K	518	531
PSM	RKREELSNVLAAM	359	sp|Q9Y3U8|RL36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7609	24.297003999466664	3	1515.819187	1515.819146	K	R	85	98
PSM	KKSTLRDQINSDH	360	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4169	16.140039246933334	3	1540.797180	1540.795768	T	R	29	42
PSM	KRDREEDEEDAYE	361	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4315	16.475226378133335	3	1682.702592	1682.701987	K	R	430	443
PSM	RKRGVDYNAEIPFE	362	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7228	22.9783502	3	1692.859790	1692.858369	K	K	204	218
PSM	RKNVEGLDLLFMSHK	363	sp|Q9P2D1|CHD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:35	ms_run[1]:scan=7591	24.209917049066668	4	1801.950511	1801.950889	R	R	2516	2531
PSM	RRKEDLLDQL	364	sp|O15226|NKRF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7397	23.434642982933333	2	1284.715863	1284.714999	K	K	664	674
PSM	RRKNQDEESQEAPELL	365	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6503	21.119720975733333	3	1940.955868	1940.955182	C	K	587	603
PSM	KRRGDALIEMESEQDVQ	366	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=5969	19.9027996296	3	2018.973827	2018.969118	G	K	191	208
PSM	KKSKEEYQQTWYHEGPNSL	367	sp|O43172|PRP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6858	21.99918995706667	3	2351.120675	2351.118225	S	K	156	175
PSM	KANIRNMSVIAHVDHG	368	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=5067	17.9	2	1776.9053	1776.9053	K	K	16	32
PSM	KEKLEATINELV	369	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7813	25.25	2	1385.7766	1385.7766	N	-	74	86
PSM	KHAEMVHTGLKLE	370	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=5127	18.034	4	1507.7817	1507.7817	Q	R	70	83
PSM	KHHQASETHNVIASD	371	sp|Q9NUM3-3|S39A9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3750	15.031	3	1672.7917	1672.7917	G	K	70	85
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	372	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	25-UNIMOD:4	ms_run[2]:scan=8382	27.679	3	2790.3218	2790.3218	L	K	91	118
PSM	KIGIMPGHIHK	373	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=4686	17.178	3	1245.7016	1245.7016	C	K	182	193
PSM	KKHAAYAWPFY	374	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7765	25.025	2	1380.6979	1380.6979	S	K	325	336
PSM	KKYDAFLASESLI	375	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8170	26.755	2	1483.7922	1483.7922	A	K	105	118
PSM	KNAVIRHEVNYQNVVH	376	sp|Q5VZL5-3|ZMYM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5804	19.459	4	1919.0126	1919.0126	Q	K	125	141
PSM	KQEYDESGPSIVH	377	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5920	19.781	3	1487.6892	1487.6892	S	R	359	372
PSM	KVSEHSGGRDLDSLH	378	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4488	16.818	4	1635.7965	1635.7965	K	R	299	314
PSM	KYGGDPQNPHKLHIVT	379	sp|Q8TCC3-3|RM30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5756	19.346	3	1802.9428	1802.9428	E	R	55	71
PSM	RAKHLAEEYGE	380	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4469	16.785	2	1301.6364	1301.6364	K	R	413	424
PSM	RALQHSYLHKDEGNPE	381	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4520	16.876	4	1892.9129	1892.9129	F	-	288	304
PSM	RHADEFLLDLGHHE	382	sp|Q9BYC5-2|FUT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7577	24.15	4	1687.8067	1687.8067	Q	R	147	161
PSM	RHGSIRSPLW	383	sp|Q9BYD3-2|RM04_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6907	22.119	3	1207.6574	1207.6574	A	R	137	147
PSM	RHHLPPPGPPGEDYSH	384	sp|O75319|DUS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5034	17.822	3	1791.8441	1791.8441	Q	R	323	339
PSM	RIIIRGHDE	385	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4453	16.754	3	1107.6149	1107.6149	K	R	3737	3746
PSM	RKGLFFEHDL	386	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7522	23.912	3	1260.6615	1260.6615	P	R	184	194
PSM	RKHIMGQNVADYM	387	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=4708	17.227	3	1593.7392	1593.7392	H	R	196	209
PSM	RKHIMGQNVADYM	388	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=5751	19.337	3	1577.7443	1577.7443	H	R	196	209
PSM	RKLYEQHHVVQDMLVPM	389	sp|Q15392-2|DHC24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=6332	20.73	3	2154.0714	2154.0714	L	K	334	351
PSM	RKPLTTSGFHHSEEGTSSSGS	390	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4292	16.437	4	2188.0145	2188.0145	E	K	462	483
PSM	RKSYMIPENEFHH	391	sp|Q8NI27|THOC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6471	21.043	4	1686.7937	1686.7937	S	K	1176	1189
PSM	RLHNFHQLSAPQPCFTFSHPN	392	sp|O14744-4|ANM5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4	ms_run[2]:scan=7442	23.579	5	2534.2026	2534.2026	V	R	334	355
PSM	RLLHGHSSL	393	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4762	17.323	2	1018.5672	1018.5672	H	K	319	328
PSM	RRAEQEAQAPHWW	394	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7317	23.208	3	1663.7968	1663.7968	R	R	59	72
PSM	RSKVDEAVAVLQAHHA	395	sp|Q13310-2|PABP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7256	23.038	4	1729.9224	1729.9224	L	K	600	616
PSM	RSRFEQFCHL	396	sp|O14654|IRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=7005	22.387	3	1378.6564	1378.6564	R	R	374	384
PSM	RTHLQLGSVLYHHT	397	sp|Q9Y6X3|SCC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6962	22.265	4	1660.8798	1660.8798	A	K	66	80
PSM	RVINEPTAAALAYGLDKSED	398	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7904	25.644	3	2132.075	2132.0750	L	K	218	238
PSM	RCRDDSFFGETSHNYH	399	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:4	ms_run[1]:scan=6633	21.41957723706667	4	2027.818246	2026.834021	E	K	229	245
PSM	RNKDHPAFAPLYFPMELH	400	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:35	ms_run[1]:scan=7894	25.604024511466665	4	2198.074055	2198.073130	E	R	87	105
PSM	KVKTPAGHVYEYIPHPLGHMC	401	sp|O94991|SLIK5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	20-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=7079	22.602815124000003	4	2450.207811	2449.203492	P	K	740	761
PSM	RKKDGGPNV	402	sp|Q8TAQ2|SMRC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3505	14.656784308266667	2	969.535846	969.535578	V	K	4	13
PSM	RRLGGGLGGTR	403	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4256	16.354158558399998	3	1098.636107	1098.637023	P	R	190	201
PSM	RKAKMTDFD	404	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4696	17.195898981333336	2	1110.550156	1110.549179	E	R	100	109
PSM	KRVRDALTAE	405	sp|Q9HB71|CYBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4355	16.56565103253333	2	1157.652469	1157.651670	R	K	23	33
PSM	RKWGLGPKASQ	406	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5315	18.410876293333335	3	1226.688253	1226.688390	P	K	378	389
PSM	RRALELEQER	407	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5102	17.981730938400002	3	1298.705751	1298.705497	T	K	370	380
PSM	KKRFDTEEEF	408	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5995	19.970061680533334	2	1327.643044	1327.640831	S	K	277	287
PSM	KKKPYTMDPDH	409	sp|O00203|AP3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=3420	14.560178515733332	3	1374.662517	1374.660186	K	R	287	298
PSM	RKLDELYGTWR	410	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7279	23.109143216533333	3	1435.758404	1435.757198	F	K	258	269
PSM	KTVTAMDVVYALK	411	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8215	26.950834313866668	3	1437.795810	1437.790138	R	R	80	93
PSM	RKSLVMHTPPVLK	412	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:35	ms_run[1]:scan=5247	18.290456064	4	1520.887895	1520.886104	K	K	536	549
PSM	KRRLDECEEAFQGT	413	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=5917	19.770361122666667	3	1737.810848	1737.810432	K	K	86	100
PSM	RKNLIEMSELEIKHA	414	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=7095	22.651844285866666	4	1825.971823	1825.972019	F	R	373	388
PSM	RRKTDFFIGGEEGMAE	415	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:35	ms_run[1]:scan=6984	22.331815084000002	3	1857.869899	1857.867947	L	K	37	53
PSM	KKGMWSEGNGSHTIRDL	416	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:35	ms_run[1]:scan=6182	20.4056004536	4	1930.932789	1930.931945	A	K	160	177
PSM	KRRGDALIEMESEQDVQ	417	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:35	ms_run[1]:scan=5987	19.946376338133334	3	2018.973827	2018.969118	G	K	191	208
PSM	RRKTSDFNTFLAQEGCT	418	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	16-UNIMOD:4	ms_run[1]:scan=7335	23.255427840533333	3	2029.965573	2029.963973	C	K	196	213
PSM	KKSKGESDDFHMDFDSAVAP	419	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:35	ms_run[1]:scan=6783	21.80525371626667	4	2225.986284	2225.989913	S	R	1489	1509
PSM	RKLALQWHPDNFQNEEEK	420	sp|Q13217|DNJC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7119	22.7137956552	4	2281.125203	2281.123979	Y	K	415	433
PSM	KKYEDICPSTHNMDVPNIK	421	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=6142	20.316759332533334	4	2304.090432	2304.087853	G	R	67	86
PSM	RKLALQLHPDRNPDDPQAQE	422	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6305	20.664315482933333	4	2340.195057	2340.193455	Y	K	46	66
PSM	KALSDHHIYLEGTLL	423	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7815	25.26	3	1708.9148	1708.9148	Y	K	215	230
PSM	KAMGIMNSFVNDIFE	424	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8672	28.961	2	1746.7957	1746.7957	S	R	58	73
PSM	KANIRNMSVIAHVDHG	425	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6357	20.793	4	1760.9104	1760.9104	K	K	16	32
PSM	KAYHEQLSVAEITNACFEPANQMV	426	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:4,23-UNIMOD:35	ms_run[2]:scan=8070	26.332	3	2765.2789	2765.2789	E	K	164	188
PSM	KDVHMPKHPELAD	427	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=4160	16.113	3	1531.7453	1531.7453	K	K	25	38
PSM	KEKWVPEITHHCP	428	sp|P60953-1|CDC42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4	ms_run[2]:scan=6274	20.604	4	1659.8191	1659.8191	V	K	94	107
PSM	KFHHTIGGS	429	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3841	15.134	2	982.49846	982.4985	H	R	179	188
PSM	KFSVTHHYLVQESTDKEG	430	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6230	20.511	4	2104.0225	2104.0225	F	K	27	45
PSM	KHIHLMPLSQIK	431	sp|Q9H8V3-2|ECT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=6339	20.745	3	1459.8333	1459.8333	L	K	696	708
PSM	KHLLEAFKGSH	432	sp|O75151|PHF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5691	19.199	3	1265.6881	1265.6881	G	K	375	386
PSM	KKHLAPFLPNHPVISL	433	sp|P23378|GCSP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7769	25.043	3	1810.0618	1810.0618	V	K	773	789
PSM	KKYHNVGLS	434	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4234	16.305	2	1044.5716	1044.5716	E	K	223	232
PSM	KPHMHTDSNHSSIAIQ	435	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=4094	15.878	3	1817.8479	1817.8479	E	R	1239	1255
PSM	KRENPHDAVVFHP	436	sp|P08397-4|HEM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5732	19.289	4	1544.7848	1544.7848	C	K	98	111
PSM	KRHLTGEFE	437	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4860	17.497	2	1115.5724	1115.5724	V	K	28	37
PSM	KRHSVVAGGGGGEG	438	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3495	14.646	3	1266.6429	1266.6429	H	R	960	974
PSM	KTRHSSNPPLESHVGWVMDS	439	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	18-UNIMOD:35	ms_run[2]:scan=6570	21.262	4	2279.0753	2279.0753	R	R	742	762
PSM	KVTQHIHGLSGK	440	sp|Q9UKM7|MA1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4074	15.803	3	1303.7361	1303.7361	E	K	423	435
PSM	REHGIRFFETSA	441	sp|P61026|RAB10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7196	22.908	3	1448.7161	1448.7161	A	K	142	154
PSM	REKANGTTVHVGIHPS	442	sp|P61254|RL26_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4669	17.142	3	1701.8911	1701.8911	Q	K	87	103
PSM	RGYLGPPHQGPPMHHVPGHES	443	sp|P33240-2|CSTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=4884	17.536	4	2302.0814	2302.0814	P	R	327	348
PSM	RHTEMIHNYMEHLE	444	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=6615	21.374	4	1854.8141	1854.8141	Q	R	162	176
PSM	RHTEMIHNYMEHLE	445	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5108	17.994	3	1870.8091	1870.8091	Q	R	162	176
PSM	RKHIMGQNVADYM	446	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=6403	20.878	3	1577.7443	1577.7443	H	R	196	209
PSM	RKHIMGQNVADYM	447	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6983	22.33	3	1561.7494	1561.7494	H	R	196	209
PSM	RKSFYSSHYA	448	sp|Q8NEY8-5|PPHLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5157	18.105	3	1244.5938	1244.5938	R	R	60	70
PSM	RLHNTIVEINNHKL	449	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6558	21.235	4	1699.9482	1699.9482	K	K	886	900
PSM	RNKDHPAFAPLYFPMELH	450	sp|P30519-2|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8297	27.299	4	2182.0782	2182.0782	E	R	58	76
PSM	RNPVHNGHALLMQDTH	451	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5455	18.689	4	1838.8958	1838.8958	L	K	421	437
PSM	RNTAHEWIR	452	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5207	18.206	3	1181.6054	1181.6054	A	K	333	342
PSM	RPCHETTVDIFHK	453	sp|Q8WV92|MITD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=6098	20.224	4	1638.7937	1638.7937	L	K	231	244
PSM	RPRHQGVMVGMGQ	454	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=5302	18.39	3	1483.7136	1483.7136	G	K	37	50
PSM	RPRHQGVMVGMGQ	455	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5278	18.347	3	1451.7238	1451.7238	G	K	37	50
PSM	RRFPPYHVGQTFD	456	sp|P16989-3|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6831	21.924	3	1618.8005	1618.8005	Q	R	235	248
PSM	RTALHHAAFSGHGEMV	457	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:35	ms_run[2]:scan=5019	17.795	3	1735.8213	1735.8213	G	K	141	157
PSM	RTKASVHTLSGHTNAVATV	458	sp|O43660-2|PLRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5195	18.187	3	1949.0443	1949.0443	V	R	309	328
PSM	RYKATGLHF	459	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6482	21.068	3	1091.5876	1091.5876	T	R	102	111
PSM	KDVGAQILLHSHK	460	sp|Q96KP4|CNDP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6059	20.137108461333334	3	1444.816193	1444.815047	A	K	289	302
PSM	REHFQSYDLDHMEK	461	sp|Q13564|ULA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6484	21.074479530933335	4	1833.811050	1833.810432	L	K	193	207
PSM	KGKSDHYWVVGIHENPQQL	462	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7338	23.260898248533334	4	2235.126667	2234.123251	C	R	669	688
PSM	RKKGPTAAQA	463	sp|O60869|EDF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3336	14.446612809066666	2	1026.594006	1026.593427	L	K	13	23
PSM	RRTQAVVSGR	464	sp|Q96MU7|YTDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3523	14.676284313066667	3	1128.647220	1128.647588	L	R	665	675
PSM	RRTQAVVSGR	465	sp|Q96MU7|YTDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3517	14.669327877866667	3	1128.647220	1128.647588	L	R	665	675
PSM	KKRSNSEVEDVGPTSHN	466	sp|Q13206|DDX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3803	15.0862791816	3	1883.917746	1882.913317	M	R	826	843
PSM	RRNTLIKDTM	467	sp|O43592|XPOT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:35	ms_run[1]:scan=4163	16.119732865866666	3	1262.675094	1262.676505	A	R	166	176
PSM	RDVKPHNVMIDHQQ	468	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:35	ms_run[1]:scan=3969	15.403581262133335	4	1731.847415	1731.847487	H	K	156	170
PSM	RKNLIEMSELEIKHA	469	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:35	ms_run[1]:scan=7083	22.614802825866665	4	1825.971823	1825.972019	F	R	373	388
PSM	RKKVCDIAAELA	470	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4	ms_run[1]:scan=6848	21.967738037333334	2	1372.750384	1372.749670	M	R	106	118
PSM	KFAPKGPEEDHKA	471	sp|Q9BRT2|UQCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3790	15.072679325066668	4	1452.736499	1452.736128	E	-	114	127
PSM	KKRYQIEDDEDD	472	sp|Q9UNS1|TIM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4616	17.049518389866666	2	1552.702143	1552.700531	K	-	1197	1209
PSM	KKGNMDEAHIDQVR	473	sp|Q1ED39|KNOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:35	ms_run[1]:scan=3862	15.172118202399998	4	1655.804490	1655.804953	E	R	318	332
PSM	RKASAHSIVECDPVR	474	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:4	ms_run[1]:scan=5051	17.867077841866667	3	1723.882047	1723.878787	E	K	33	48
PSM	RKNLIEMSELEIKHA	475	sp|Q9Y5X3|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7536	23.970577319466667	4	1809.976819	1809.977104	F	R	373	388
PSM	RRQFEDEKANWEAQQ	476	sp|Q16181|SEPT7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5991	19.960822124266667	3	1933.905202	1933.903087	K	R	401	416
PSM	RKKDASDDLDDLNFFNQ	477	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8155	26.69268813653333	3	2039.958031	2039.954848	T	K	62	79
PSM	KKHSQFIGYPITLFVEKE	478	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8162	26.721225467733333	4	2163.175228	2163.172827	V	R	208	226
PSM	KKHSQFIGYPITLYLEKE	479	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8090	26.413214988266667	4	2193.185985	2193.183391	V	R	203	221
PSM	KRYTIYSPKDGQPCMDHD	480	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:4	ms_run[1]:scan=6061	20.1420939816	4	2209.987983	2209.988473	G	R	235	253
PSM	KAFVDFLSDEIKEE	481	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8530	28.322	3	1668.8247	1668.8247	D	R	80	94
PSM	KALLNNSHYYHMAHG	482	sp|P09622-3|DLDH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5923	19.789	3	1754.8311	1754.8311	S	K	89	104
PSM	KDIRGETLNHHVNA	483	sp|Q8NBN7-2|RDH13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4663	17.133	3	1602.8227	1602.8227	A	R	9	23
PSM	KELTEEKESAFEFLSSA	484	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8281	27.233	3	1943.9364	1943.9364	A	-	229	246
PSM	KHRAFEDEMSG	485	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=3847	15.143	2	1321.5721	1321.5721	S	R	666	677
PSM	KHVSDDMKTH	486	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=3246	14.255	3	1212.5557	1212.5557	L	K	271	281
PSM	KKHPDASVNFSEFS	487	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7050	22.523	3	1591.7631	1591.7631	K	K	29	43
PSM	KKQHSDLEEEH	488	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3468	14.616	3	1378.6477	1378.6477	L	R	129	140
PSM	KLLPQLTYLDGYDRDD	489	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8287	27.258	3	1923.9578	1923.9578	F	K	137	153
PSM	KQAHKCEELLNAQHQ	490	sp|Q7Z6B0-2|CCD91_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=4511	16.859	3	1832.8952	1832.8952	E	R	212	227
PSM	KQKYPEHAIH	491	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3679	14.956	3	1249.6568	1249.6568	T	K	700	710
PSM	KTLVSVTKEGLELPEDEEE	492	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7738	24.901	3	2144.0736	2144.0736	G	K	539	558
PSM	KVAHVEHEETLSSR	493	sp|P51654-2|GPC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3849	15.153	3	1620.822	1620.8220	L	R	320	334
PSM	RAHAHLDTG	494	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3554	14.723	2	976.48388	976.4839	F	R	674	683
PSM	RCRDDSFFGETSHNYH	495	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4	ms_run[2]:scan=6372	20.818	4	2026.834	2026.8340	E	K	229	245
PSM	RHGWGYLVPGR	496	sp|P54098|DPOG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7163	22.823	3	1296.684	1296.6840	E	R	617	628
PSM	RHGYIKGIV	497	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5949	19.852	2	1041.6083	1041.6083	E	K	37	46
PSM	RHKWNDFAEDSL	498	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7380	23.38	3	1516.7059	1516.7059	K	R	675	687
PSM	RHQGVMVGMGQKDSYVGDEAQS	499	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5231	18.258	4	2410.0642	2410.0642	P	K	39	61
PSM	RHRPELIEYD	500	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6312	20.686	2	1326.668	1326.6680	H	K	204	214
PSM	RHYNGEAYEDDEHHP	501	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4266	16.376	4	1867.751	1867.7510	R	R	374	389
PSM	RIHTGDRPY	502	sp|Q5T0B9|ZN362_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4191	16.204	3	1113.5679	1113.5679	T	K	303	312
PSM	RKEALDFHVDHQS	503	sp|Q9Y5B8-2|NDK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5855	19.603	4	1580.7696	1580.7696	S	R	94	107
PSM	RKFLEHLSGAG	504	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6083	20.191	3	1213.6568	1213.6568	L	K	14	25
PSM	RKHLGTLNFGGI	505	sp|Q93050-1|VPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7392	23.412	3	1311.7412	1311.7412	R	R	665	677
PSM	RKNAQLNIELEAAHH	506	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6284	20.624	4	1742.9176	1742.9176	I	-	477	492
PSM	RPRHQGVMVGMGQ	507	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=4050	15.703	3	1467.7187	1467.7187	G	K	37	50
PSM	RSHSLSQHTATSSK	508	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3361	14.492	3	1525.7597	1525.7597	E	K	214	228
PSM	RVGDLILAHLHK	509	sp|Q53GS7-2|GLE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7555	24.06	3	1370.8147	1370.8147	P	K	515	527
PSM	RVRHQGDLSSGYLDDT	510	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6406	20.883	3	1817.8656	1817.8656	R	K	422	438
PSM	RVSFELFADKVP	511	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8300	27.312	3	1406.7558	1406.7558	G	K	19	31
PSM	RYHQIGSGKCEI	512	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=5235	18.265	3	1446.7038	1446.7038	S	K	175	187
PSM	RYHTSQSGDEMTSLSEYVS	513	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=7033	22.468	3	2191.9328	2191.9328	L	R	456	475
PSM	RYLHQQWDK	514	sp|Q9BW61|DDA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5226	18.246	3	1272.6364	1272.6364	L	K	57	66
PSM	RPRHQGVMVGMGQ	515	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5298	18.382805417066667	4	1452.725467	1451.723806	G	K	39	52
PSM	KYHTVNGHNCEVR	516	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:4	ms_run[1]:scan=3731	15.012392600266667	3	1613.736606	1612.752858	Q	K	166	179
PSM	RHPGSFDVVHVKDANGNSFAT	517	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6961	22.263094515733332	4	2256.074909	2254.087928	E	R	200	221
PSM	RFFQSHYFH	518	sp|P32780|TF2H1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6990	22.345727342133333	3	1267.589023	1267.588676	T	R	223	232
PSM	KKMEGHYVHAGNIIATQ	519	sp|Q9P0M9|RM27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35	ms_run[1]:scan=5349	18.4782151736	4	1911.959582	1911.962516	I	R	54	71
PSM	KKRIESLID	520	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5896	19.719719669333333	2	1100.655687	1100.655359	L	R	733	742
PSM	RKKLIDIQE	521	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6027	20.057477973333334	2	1141.682985	1141.681908	E	K	753	762
PSM	RKEGFWSLK	522	sp|Q6ZRS2|SRCAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7054	22.530709305866665	3	1149.629210	1149.629478	L	R	114	123
PSM	RRFTMELAK	523	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6302	20.659903202933332	3	1150.627625	1150.628098	T	K	203	212
PSM	RRGLDDDRGP	524	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3852	15.159185148	3	1155.573987	1155.574482	P	R	1070	1080
PSM	RREELAQIR	525	sp|Q9Y5A7|NUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4915	17.589854371733335	3	1169.662697	1169.662903	N	K	414	423
PSM	RRFSDIQIR	526	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6323	20.7146046472	3	1189.668913	1189.667989	V	R	487	496
PSM	RRSVSDNDIR	527	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3711	14.992686076533333	3	1216.625190	1216.627246	A	K	744	754
PSM	RKIASRNEFD	528	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4336	16.537367596533333	3	1234.641109	1234.641834	A	R	63	73
PSM	RRGLDDDRGPW	529	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6390	20.850035089333335	3	1341.654233	1341.653795	P	R	1110	1121
PSM	KTHLSLSHNPEQ	530	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3989	15.457291375733332	3	1391.694352	1389.700077	A	K	866	878
PSM	RKKNLQYYDISA	531	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6477	21.058621273066667	3	1497.793880	1497.793977	H	K	140	152
PSM	RRDPYGFGDSRDS	532	sp|Q9HCD5|NCOA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5654	19.110698749333334	3	1526.685804	1526.686218	T	R	12	25
PSM	RKREELSNVLAAM	533	sp|Q9Y3U8|RL36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35	ms_run[1]:scan=6488	21.081023030133334	3	1531.813493	1531.814061	K	R	85	98
PSM	RKREELSNVLAAM	534	sp|Q9Y3U8|RL36_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35	ms_run[1]:scan=6486	21.078173389333333	3	1531.813493	1531.814061	K	R	85	98
PSM	KKNIFPYHEVTVK	535	sp|P35573|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6391	20.8517266536	4	1601.893354	1601.892963	S	R	1302	1315
PSM	RKKCAEEAQLISSL	536	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=7299	23.160373952	3	1631.867208	1631.866491	V	K	416	430
PSM	KRRELEEETNAFN	537	sp|Q92599|SEPT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5721	19.265007904	3	1634.802426	1634.801248	E	R	387	400
PSM	RKIIKDGEQHEDLNEVA	538	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5325	18.430455133866666	4	1993.023835	1993.022868	A	K	589	606
PSM	KRGLAVNMVDSKHSMNILN	539	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=5958	19.8709810048	4	2158.101312	2158.098693	G	R	434	453
PSM	KKHSQFIGYPITLFVEKE	540	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8240	27.0587003096	4	2163.175228	2163.172827	V	R	208	226
PSM	KKMMTKEELEEEQRTEE	541	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=3992	15.470145520800001	3	2199.006942	2199.003515	Y	-	154	171
PSM	KRYTIYSPKDGQPCMDHD	542	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=5350	18.480354802666668	4	2225.983237	2225.983388	G	R	235	253
PSM	RRICNAVSPDKDVDGFHVINVG	543	sp|P13995|MTDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:4	ms_run[1]:scan=7400	23.445324154666665	4	2467.241606	2467.239026	E	R	142	164
PSM	RRDSFDDRGPSLNPVLDYDHGS	544	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7558	24.073274224266665	4	2517.163714	2517.163278	F	R	185	207
PSM	KKKVEHEISEGNVATAAAAALASAAT	545	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7944	25.806066916533332	4	2537.347676	2537.344930	G	K	854	880
PSM	RKKTGVGYPQLSAVMECADAAHGL	546	sp|Q9P2T1|GMPR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=7450	23.603829413333337	4	2574.281838	2574.268277	T	K	189	213
PSM	KDLFDPIIED	547	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8427	27.869	2	1203.6023	1203.6023	F	R	86	96
PSM	KEKLCYVALDFEQEMATAASSSSLE	548	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4	ms_run[2]:scan=8902	30.033	3	2806.3041	2806.3041	I	K	213	238
PSM	KEKLPLDINPVVHPHGHIF	549	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7600	24.253	4	2189.2109	2189.2109	N	K	287	306
PSM	KGGRPGGFPDHPH	550	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4173	16.152	3	1357.664	1357.6640	F	R	46	59
PSM	KGRGNECVQYQHVLH	551	sp|Q9UHA2|S18L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=5227	18.248	4	1823.8849	1823.8849	N	R	41	56
PSM	KIWHHTFYNEL	552	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7247	23.025	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	553	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7632	24.4	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	554	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7735	24.885	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	555	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7810	25.233	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	556	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7873	25.514	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	557	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7886	25.569	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	558	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8051	26.253	3	1486.7357	1486.7357	E	R	84	95
PSM	KKPQAHLPVHTE	559	sp|Q9Y2L5-2|TPPC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4303	16.453	3	1383.7623	1383.7623	L	K	1132	1144
PSM	KKVHVIFNY	560	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6946	22.217	2	1146.655	1146.6550	T	K	142	151
PSM	KRIHGVGF	561	sp|P62899-3|RL31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5551	18.884	2	912.52937	912.5294	H	K	31	39
PSM	KRIHGVGF	562	sp|P62899-3|RL31_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5586	18.964	2	912.52937	912.5294	H	K	31	39
PSM	KRWENFIHSEN	563	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6819	21.895	3	1458.7004	1458.7004	R	R	280	291
PSM	KTVQGSGHQEHINIH	564	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4108	15.933	4	1683.8441	1683.8441	A	K	42	57
PSM	KVHLVGIDIFTG	565	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8402	27.762	2	1297.7394	1297.7394	A	K	55	67
PSM	KWHFIGHLQ	566	sp|O94903|PLPHP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7214	22.949	3	1164.6192	1164.6192	I	K	90	99
PSM	RCHTTHSMALIHN	567	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=3824	15.113	3	1592.73	1592.7300	G	R	330	343
PSM	RDGRGALQNIIPASTGAA	568	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7549	24.036	3	1766.9387	1766.9387	W	K	155	173
PSM	RDTLYEAVREVLHGNQ	569	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8594	28.613	3	1898.9599	1898.9599	S	R	7	23
PSM	RERHGNVASLVQ	570	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5245	18.287	3	1364.7273	1364.7273	K	R	72	84
PSM	RFFQSHYFH	571	sp|P32780-2|TF2H1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6999	22.368	3	1267.5887	1267.5887	T	R	107	116
PSM	RHKQYEEFAMSYQ	572	sp|Q9HAU5|RENT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=6187	20.419	3	1731.7675	1731.7675	D	K	395	408
PSM	RHKSWGIDCLFE	573	sp|P51580|TPMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:4	ms_run[2]:scan=8165	26.734	3	1546.7351	1546.7351	E	K	226	238
PSM	RIHFFLSK	574	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7334	23.253	2	1046.6025	1046.6025	E	K	59	67
PSM	RIPTPVIHTKH	575	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4944	17.642	3	1297.7619	1297.7619	I	-	407	418
PSM	RIRNNSAIHI	576	sp|O75817|POP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5622	19.038	3	1192.6789	1192.6789	T	R	123	133
PSM	RKSYMIPENEFHH	577	sp|Q8NI27|THOC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=6138	20.309	4	1702.7886	1702.7886	S	K	1176	1189
PSM	RKTHSAASSSQGASVNPEPLHSSLD	578	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5646	19.088	4	2562.2423	2562.2423	Q	K	466	491
PSM	RLPLQHGWR	579	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6354	20.785	3	1161.6519	1161.6519	V	R	526	535
PSM	RRHVFGESDELIGQ	580	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6884	22.062	3	1641.8223	1641.8223	E	K	99	113
PSM	RTDKSSASAPDVDDPEAFPALA	581	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7812	25.244	3	2259.0655	2259.0655	S	-	366	388
PSM	RTDLCDHALHISHDEL	582	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:4	ms_run[2]:scan=7064	22.561	4	1930.8956	1930.8956	K	-	167	183
PSM	RTHTDVGLLEYQHHS	583	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6204	20.459	4	1791.8652	1791.8652	A	R	32	47
PSM	RTRDELEVIHLIEEH	584	sp|P10155-3|RO60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8057	26.278	4	1887.9803	1887.9803	K	R	237	252
PSM	RYNGEPEHIERNDAPH	585	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4523	16.881	4	1932.8827	1932.8827	S	K	131	147
PSM	RPRHQGVMVGMGQ	586	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=4072	15.795853842666666	3	1451.6952	1451.7232	G	K	37	50
PSM	KYHTINGHNAEVR	587	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4196	16.210865573866666	3	1538.759829	1537.774973	Q	K	173	186
PSM	RKHGVNVQSIADIHPIQVQPG	588	sp|P46019|KPB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=7340	23.265979462666667	4	2293.2402	2292.2442	L	R	456	477
PSM	RKQAIRDAE	589	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3479	14.627844729866666	3	1085.594837	1085.594155	A	R	521	530
PSM	KISLHNHLESH	590	sp|P17010|ZFX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4679	17.161703275466667	3	1315.694964	1313.684033	K	K	468	479
PSM	RKDRTPPP	591	sp|P62854|RS26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3376	14.511618490933333	2	965.540994	965.540663	A	R	92	100
PSM	KRNQKPEV	592	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3519	14.670875650133333	2	997.566997	997.566878	A	R	93	101
PSM	RKKQIEEL	593	sp|P09936|UCHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4563	16.972444381066666	2	1042.613804	1042.613494	F	K	63	71
PSM	RKIKLIEGS	594	sp|Q13243|SRSF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5366	18.517085969066667	2	1042.650605	1042.649879	G	K	172	181
PSM	RKKLEMDL	595	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35	ms_run[1]:scan=4586	17.001816920266666	2	1047.576981	1047.574666	A	K	1612	1620
PSM	RKEVIRFE	596	sp|Q13596|SNX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5753	19.3407282184	3	1075.613356	1075.613828	V	K	475	483
PSM	RKAAIRDIEG	597	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4501	16.842250975466666	3	1127.641885	1127.641105	E	K	537	547
PSM	KKREAEEVY	598	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4016	15.568336458133333	2	1150.599476	1150.598238	A	R	165	174
PSM	RRNEPIKYQ	599	sp|Q9UHA3|RLP24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4007	15.536853625333332	3	1202.651965	1202.652004	K	R	74	83
PSM	RRPLEEDFR	600	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5789	19.421438231733337	3	1216.631512	1216.631269	W	R	628	637
PSM	RRPLEEDWR	601	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6085	20.194428922133334	3	1255.642879	1255.642168	W	R	620	629
PSM	RRPRDLPAIQP	602	sp|O94903|PLPHP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6211	20.4741978936	3	1317.764334	1317.762952	A	R	30	41
PSM	RKGKFSEGEATL	603	sp|P47897|SYQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5300	18.38628893706667	3	1321.699453	1321.699014	M	R	391	403
PSM	RKRTEALEQGGLP	604	sp|P50613|CDK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5895	19.717469766666667	3	1453.800382	1453.800125	K	K	329	342
PSM	RVREYYLLHLQ	605	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7523	23.916021149866665	3	1488.820755	1488.820132	E	R	188	199
PSM	RKKQLAEQEELE	606	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4731	17.273002309066666	3	1499.794299	1499.794371	L	R	327	339
PSM	RRRTEEGPTLSYG	607	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5443	18.6714681512	3	1520.769823	1520.769553	K	R	147	160
PSM	RKREPEDEGEDDD	608	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3411	14.550213935199999	3	1588.660768	1588.660122	K	-	237	250
PSM	KKGVQLQTHPNVDK	609	sp|P48444|COPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4081	15.831139210133333	4	1590.883832	1590.884189	D	K	322	336
PSM	RKEWLTNFMEDR	610	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7817	25.2674308424	3	1623.783007	1623.782761	D	R	661	673
PSM	RKYAVLYQPLFDK	611	sp|P55209|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7642	24.449926055200002	3	1639.910462	1639.908613	E	R	104	117
PSM	RKRPNGVSAVALLVGE	612	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7697	24.710024165333333	3	1664.969423	1664.968588	L	K	41	57
PSM	RKRDAEDDGEEEDD	613	sp|Q9BTT0|AN32E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3379	14.515883209333333	3	1677.671693	1677.671415	K	-	255	269
PSM	KKGPSGYGFNLHSDKS	614	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5744	19.3162013944	4	1720.853158	1720.853283	M	K	158	174
PSM	RKVVGCSCVVVKDYG	615	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=5984	19.9382826656	3	1724.873853	1724.870196	P	K	101	116
PSM	RKEVVKITHCPTLLT	616	sp|A6NHR9|SMHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=6506	21.126324960799998	3	1794.016930	1794.018575	Y	R	1847	1862
PSM	RRTKNETDEDGWTTV	617	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6199	20.446481458133334	3	1806.850972	1806.849654	L	R	1366	1381
PSM	RKKDALLSALSIQNYHLECNET	618	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	19-UNIMOD:4	ms_run[1]:scan=7920	25.708269633866667	4	2602.320300	2602.317336	D	K	946	968
PSM	KAGVLPLLTGAITHHGHHTDVV	619	sp|Q6NXE6-2|ARMC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7703	24.742	4	2272.244	2272.2440	V	R	193	215
PSM	KEWHGPPSQGPSYHDTR	620	sp|Q9NWH9-3|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4946	17.645	4	1977.9082	1977.9082	R	R	535	552
PSM	KHHVIKVEPVIQ	621	sp|Q6UVY6-2|MOXD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5723	19.268	3	1425.8456	1425.8456	E	R	148	160
PSM	KIWHHTFYNEL	622	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7510	23.858	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	623	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8776	29.451	3	1486.7357	1486.7357	E	R	84	95
PSM	KKDLHFLMECNHEY	624	sp|Q9Y5X1|SNX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=6628	21.407	3	1878.8393	1878.8393	P	K	483	497
PSM	KNAVIRHEVNYQNVVH	625	sp|Q5VZL5-3|ZMYM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5801	19.451	3	1919.0126	1919.0126	Q	K	125	141
PSM	KRGFAFVTFDDHDTVD	626	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7801	25.192	3	1868.8693	1868.8693	K	K	166	182
PSM	KRLSMYGVDLHHA	627	sp|O43491|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=5933	19.813	3	1541.7773	1541.7773	A	K	399	412
PSM	KVGEVIVTKDDAMLL	628	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:35	ms_run[2]:scan=7629	24.388	2	1645.8961	1645.8961	G	K	344	359
PSM	KYRHSDGNLCV	629	sp|P49458-2|SRP09_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=4916	17.592	3	1347.6354	1347.6354	L	K	30	41
PSM	RDACIIEKGEEHCGHLIEAH	630	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6195	20.44	4	2373.0954	2373.0954	A	K	33	53
PSM	RDYLHYIR	631	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6796	21.836	3	1134.5934	1134.5934	R	K	90	98
PSM	REHLVRFE	632	sp|Q9NWH9-3|SLTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5898	19.723	3	1084.5778	1084.5778	L	R	185	193
PSM	REKPLALYVFSHNH	633	sp|P51648|AL3A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7390	23.408	4	1709.9002	1709.9002	E	K	355	369
PSM	RGHDFHEGV	634	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4416	16.685	3	1052.4788	1052.4788	M	R	338	347
PSM	RGRHEVGALV	635	sp|Q96G21|IMP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5078	17.932	3	1092.6152	1092.6152	N	R	116	126
PSM	RHELQGQKPLLEH	636	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4957	17.673	3	1583.8532	1583.8532	H	-	493	506
PSM	RHFNAPSHI	637	sp|P61254|RL26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5392	18.569	3	1077.5468	1077.5468	K	R	17	26
PSM	RHLYHSSQNELA	638	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4644	17.099	3	1453.7062	1453.7062	T	K	2222	2234
PSM	RHREELEQS	639	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3618	14.898	2	1182.5741	1182.5741	K	K	1380	1389
PSM	RHVVGEIR	640	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4040	15.661	2	964.55665	964.5566	A	R	279	287
PSM	RHYHPEVS	641	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3753	15.036	2	1023.4886	1023.4886	Q	K	443	451
PSM	RIHGVGFK	642	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4973	17.712	2	912.52937	912.5294	K	K	32	40
PSM	RKDGAMFFHW	643	sp|Q9NPF5|DMAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35	ms_run[2]:scan=7677	24.615	3	1309.6026	1309.6026	A	R	105	115
PSM	RKGWSFMHPG	644	sp|O00469-3|PLOD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35	ms_run[2]:scan=6261	20.578	3	1217.5764	1217.5764	P	R	384	394
PSM	RKLHGWAPGPDYQ	645	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6405	20.88	3	1523.7633	1523.7633	P	K	456	469
PSM	RKNTPHFN	646	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3786	15.069	2	1012.5203	1012.5203	S	R	295	303
PSM	RLHCGLWVR	647	sp|Q9NZE8-2|RM35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=6604	21.348	3	1195.6397	1195.6397	L	R	116	125
PSM	RLHPFHVI	648	sp|Q96L21|RL10L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6978	22.316	2	1017.5872	1017.5872	V	R	90	98
PSM	RLVNHFVEEFK	649	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7281	23.115	3	1416.7514	1416.7514	N	R	181	192
PSM	RPASESPHHHTAPA	650	sp|P35520|CBS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3363	14.496	3	1493.7124	1493.7124	G	K	58	72
PSM	RPRHQGVMVGMGQ	651	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4069	15.784	3	1483.7136	1483.7136	G	K	37	50
PSM	RPRHQGVMVGMGQ	652	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4472	16.791	3	1483.7136	1483.7136	G	K	37	50
PSM	RQATKDAGVIAGLNVL	653	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7987	25.988	3	1624.9261	1624.9261	Q	R	100	116
PSM	RQRHPFLLLGTTAN	654	sp|Q96IJ6|GMPPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7503	23.825	3	1622.9005	1622.9005	R	R	132	146
PSM	RRHQMELNTL	655	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=5020	17.797	3	1312.667	1312.6670	E	K	810	820
PSM	RRNTLQLH	656	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4376	16.607	2	1036.589	1036.5890	R	R	194	202
PSM	RSIYHYGNK	657	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4368	16.59	3	1136.5727	1136.5727	P	K	178	187
PSM	RSPHVVFHGSAHLVPTA	658	sp|O75147-2|OBSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6605	21.353	3	1810.9591	1810.9591	G	R	600	617
PSM	RTGEMTVLGHVKH	659	sp|P05423|RPC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=4625	17.066	3	1479.7616	1479.7616	S	K	369	382
PSM	RVKTLHPAVHAGILA	660	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6266	20.588	4	1581.9467	1581.9467	G	R	63	78
PSM	RYTCHVQHEGLPKPLTL	661	sp|P01889|HLAB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=7121	22.718	4	2048.0626	2048.0626	Q	R	280	297
PSM	RVHLENMGSHDIVDGNH	662	sp|P11277|SPTB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:35	ms_run[1]:scan=5241	18.274543856533334	4	1944.886347	1944.886057	Q	R	127	144
PSM	RHTEMIHNYMEHLE	663	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:35	ms_run[1]:scan=6001	19.9852782176	3	1854.815761	1854.814138	Q	R	162	176
PSM	RHLYHSSQNELA	664	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4627	17.07092245706667	3	1453.707953	1453.706225	T	K	2297	2309
PSM	RYKAPFHQL	665	sp|P28370|SMCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6246	20.54658900853333	3	1159.633223	1158.629812	A	R	942	951
PSM	KRKGPEFT	666	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3974	15.4164420672	2	961.534948	961.534515	S	K	71	79
PSM	RRFDEGKL	667	sp|Q15417|CNN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5280	18.3503764728	2	1019.551881	1019.551228	T	K	150	158
PSM	RKLDNTKF	668	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4633	17.079774437333334	2	1020.572559	1020.571629	V	R	173	181
PSM	RRIIKETQ	669	sp|P61088|UBE2N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3614	14.894751461333334	2	1042.625389	1042.624727	P	R	6	14
PSM	KRKILTTEG	670	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3904	15.2402637816	2	1044.629757	1044.629144	E	R	1009	1018
PSM	RRTQAVVSGR	671	sp|Q96MU7|YTDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3504	14.655977900266667	3	1128.647220	1128.647588	L	R	665	675
PSM	RRELFEER	672	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5384	18.552054361600003	3	1133.594096	1133.594155	E	R	192	200
PSM	RKNLPERLL	673	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6436	20.95993221946667	3	1137.698474	1137.698226	P	R	369	378
PSM	RRIATGSFLK	674	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5993	19.964967880266666	3	1147.683015	1147.682576	C	R	101	111
PSM	KRKIIGDTFV	675	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6599	21.332609212533335	3	1175.702918	1175.702643	E	K	336	346
PSM	RKQLSYFDR	676	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5973	19.913716172799997	3	1211.641451	1211.641105	Y	R	1356	1365
PSM	KKVRLSETDF	677	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6118	20.27213890053333	3	1221.672294	1221.671737	P	K	9	19
PSM	RRGPEEDRFS	678	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4297	16.444578668266665	3	1247.600847	1247.600697	P	R	969	979
PSM	RRDFTPAELR	679	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6123	20.285492892266667	3	1260.679475	1259.673468	K	R	70	80
PSM	RRDNQFDSPK	680	sp|O14654|IRS4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3816	15.1040749552	3	1261.616157	1261.616347	A	R	1245	1255
PSM	RKKGGFEGGGFLG	681	sp|Q9Y597|KCTD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6788	21.815430702933334	3	1308.693326	1308.693869	F	R	754	767
PSM	KKKPYTMDPDH	682	sp|O00203|AP3B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:35	ms_run[1]:scan=3386	14.521230908533333	3	1374.662517	1374.660186	K	R	287	298
PSM	KKGDTPLHIAIRG	683	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6242	20.538632917066664	3	1404.818656	1404.820132	D	R	366	379
PSM	RRCELIKESEV	684	sp|P60510|PP4C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:4	ms_run[1]:scan=5724	19.270608105066668	3	1417.734791	1417.734748	L	K	15	26
PSM	RRKAVDEAADALL	685	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6911	22.132689074399998	3	1426.789935	1426.789226	E	K	284	297
PSM	RRPRPPNAPSQDG	686	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3693	14.970340418666666	3	1446.743758	1446.744007	R	K	337	350
PSM	RKRDNTNEIYSG	687	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4285	16.423955868	2	1451.713722	1451.711704	C	K	539	551
PSM	RKRTEALEQGGLP	688	sp|P50613|CDK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5890	19.702413345333333	3	1453.800382	1453.800125	K	K	329	342
PSM	RRKGEEVTPISAI	689	sp|Q9Y2J2|E41L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6654	21.47884569653333	3	1454.822042	1454.820526	K	R	485	498
PSM	RKKAVLFCLSED	690	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=7308	23.181582188	3	1464.775866	1464.775885	K	K	32	44
PSM	RREREQQDLEFA	691	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6076	20.178751987733335	3	1575.776092	1575.775367	E	K	511	523
PSM	KEVQEELRALQDQ	692	sp|Q9NRC6|SPTN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5697	19.215573090933333	4	1587.839919	1584.810750	T	R	2018	2031
PSM	RKIRSLQEQADAAEE	693	sp|P09493-5|TPM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5269	18.330962063466664	3	1742.892412	1742.891125	R	R	12	27
PSM	RRSQKEEDEQEDLT	694	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3943	15.325771471466668	3	1761.814613	1761.812935	K	K	355	369
PSM	RKSEDFVKDSELHLP	695	sp|Q9H9J4|UBP42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7370	23.344526923466667	4	1798.923085	1798.921363	S	R	1245	1260
PSM	KKSDCSLFMFGSHNK	696	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=6659	21.488270369066665	3	1800.832121	1800.828725	S	K	83	98
PSM	KKNKGDSHLNVQVSNF	697	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6393	20.855280765866667	3	1813.945402	1813.943495	S	K	245	261
PSM	KRRWDQTADQTPGATP	698	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5450	18.681453469066664	3	1826.903980	1826.902359	R	K	197	213
PSM	KRKGFNEGLWEIDNNP	699	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7569	24.117857294933334	3	1915.955181	1915.954060	N	K	73	89
PSM	RRKECTVALAPNFTANN	700	sp|Q9UPN4|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:4	ms_run[1]:scan=6833	21.926929984533334	3	1960.992688	1960.990128	P	R	155	172
PSM	KAKWHLGI	701	sp|P54646|AAPK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7042	22.499	2	951.56542	951.5654	K	R	399	407
PSM	KCRHPTGGSFI	702	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=5367	18.519	3	1258.6241	1258.6241	F	R	60	71
PSM	KILESHQFSPHNHA	703	sp|Q9NPC8|SIX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4997	17.757	3	1643.8168	1643.8168	Y	K	68	82
PSM	KKCEHDPHVLLAVA	704	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4	ms_run[2]:scan=6576	21.279	3	1615.8504	1615.8504	L	K	795	809
PSM	KKSAEFLLHML	705	sp|P18621-2|RL17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8022	26.134	3	1315.7322	1315.7322	P	K	47	58
PSM	KVGHSIRHPDVEVDGFSEL	706	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7422	23.518	4	2120.0651	2120.0651	W	R	59	78
PSM	RCTTSILHNLSHH	707	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:4	ms_run[2]:scan=6122	20.283	4	1574.7736	1574.7736	A	R	203	216
PSM	RELESAHHPFTAPHPSDIHLLYTEP	708	sp|Q6PI48|SYDM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7603	24.269	4	2893.4147	2893.4147	P	K	495	520
PSM	RFHFASALK	709	sp|Q9HD20-2|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6728	21.675	3	1075.5927	1075.5927	Q	R	505	514
PSM	RFHLFDIH	710	sp|Q9H5K3|SG196_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7756	24.982	3	1083.5614	1083.5614	V	K	303	311
PSM	RGFIYVHKPPVHI	711	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7062	22.558	4	1561.8882	1561.8882	E	R	357	370
PSM	RGVVDSEDLPLNIS	712	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8079	26.366	2	1512.7784	1512.7784	I	R	378	392
PSM	RHGYMGHLT	713	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:35	ms_run[2]:scan=3865	15.178	3	1086.5029	1086.5029	R	R	403	412
PSM	RHKQSLEEAA	714	sp|P15924-3|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3780	15.063	3	1167.5996	1167.5996	A	K	1308	1318
PSM	RHPGSFDVVHV	715	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6779	21.791	3	1248.6364	1248.6364	E	K	200	211
PSM	RHQSDRYV	716	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3840	15.132	2	1059.521	1059.5210	I	K	22	30
PSM	RHTEMIHNYMEHLE	717	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=5093	17.968	4	1870.8091	1870.8091	Q	R	162	176
PSM	RIFTHHLC	718	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4	ms_run[2]:scan=5158	18.107	3	1082.5444	1082.5444	A	R	877	885
PSM	RKHIGPLLE	719	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6236	20.522	2	1061.6346	1061.6346	Y	R	560	569
PSM	RKHIQDLNWQ	720	sp|O75934|SPF27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6365	20.807	2	1336.7	1336.7000	L	R	157	167
PSM	RKHSELSELNV	721	sp|Q92783-2|STAM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6513	21.138	3	1310.6943	1310.6943	D	K	352	363
PSM	RKQHSYIEQG	722	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3998	15.494	2	1244.6262	1244.6262	L	K	129	139
PSM	RKWQHLEQNNFAM	723	sp|Q96LB3|IFT74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:35	ms_run[2]:scan=6296	20.648	3	1716.8155	1716.8155	E	K	547	560
PSM	RNRDHDTFLAV	724	sp|Q12907|LMAN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6888	22.069	3	1342.6742	1342.6742	F	R	207	218
PSM	RPDTTHLHPQH	725	sp|Q86TB9-2|PATL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3616	14.896	3	1337.6589	1337.6589	F	R	208	219
PSM	RPRHQGVMVGMGQ	726	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=3666	14.944	3	1483.7136	1483.7136	G	K	37	50
PSM	RRIVDLHS	727	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5003	17.77	2	994.56721	994.5672	A	R	550	558
PSM	RRLHGLPEQFLYGTAT	728	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7711	24.772	3	1857.985	1857.9850	Q	K	691	707
PSM	RSHEVKAEGYEVAHGG	729	sp|P53041|PPP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4433	16.72	4	1724.823	1724.8230	I	R	425	441
PSM	RTHYDPPR	730	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3690	14.968	2	1040.5152	1040.5152	V	K	192	200
PSM	RVIHLSNLPHSGYSDSAVL	731	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7485	23.755	3	2064.0752	2064.0752	G	K	496	515
PSM	RVRVHGPGIQSGTTN	732	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4516	16.869	3	1577.8386	1577.8386	S	K	1357	1372
PSM	RYKHPSEEEL	733	sp|Q9NX61-2|T161A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4786	17.362	3	1286.6255	1286.6255	F	R	39	49
PSM	RYRDSHEPTYGIY	734	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6537	21.184	3	1655.7692	1655.7692	D	-	368	381
PSM	RPRHQGVMVGMGQ	735	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:35	ms_run[1]:scan=3691	14.968629934933334	3	1467.691010	1467.718721	G	K	39	52
PSM	RHYNGEAYEDDEHHP	736	sp|P31689|DNJA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4722	17.256233698933332	4	1868.734475	1867.751003	R	R	374	389
PSM	RHKWNDFAEDSL	737	sp|O60313|OPA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7367	23.335708213066667	3	1516.706948	1516.705891	K	R	711	723
PSM	KHHNQPYCGIAPYI	738	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:4	ms_run[1]:scan=7354	23.299962603999997	3	1697.833861	1696.814395	E	R	32	46
PSM	RTPWKLYH	739	sp|Q9NVS2|RT18A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6480	21.064169011999997	3	1100.589315	1099.592699	S	-	189	197
PSM	RVIHLFDEKGNDLGNMH	740	sp|Q9H2K0|IF3M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:35	ms_run[1]:scan=6922	22.160553484	4	2009.975250	2009.974144	Q	R	85	102
PSM	RKWTVVHAGA	741	sp|Q9BZM4|ULBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5319	18.418559421866668	3	1123.624625	1123.625061	N	R	157	167
PSM	RKHLGLLE	742	sp|Q9Y3A2|UTP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6110	20.256693105866667	2	964.582183	964.581800	F	K	25	33
PSM	RHYQHVLAVDPEKAAQM	743	sp|Q06481|APLP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	17-UNIMOD:35	ms_run[1]:scan=6040	20.086829538933333	3	2007.9752	2007.9942	I	K	509	526
PSM	RKKLSELL	744	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6609	21.364704799466665	2	985.628380	985.628415	N	R	456	464
PSM	KRKDIESI	745	sp|Q6PI48|SYDM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4580	16.993504135466665	2	987.571775	987.571295	L	R	380	388
PSM	RKFIEDRV	746	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5444	18.6737538136	3	1062.600820	1061.598178	E	K	264	272
PSM	RRMLTDKE	747	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=3578	14.8048893824	2	1063.543827	1063.544428	S	R	336	344
PSM	RRPEVDGVR	748	sp|O95865|DDAH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3886	15.208512041333334	3	1082.594676	1082.594490	A	K	96	105
PSM	RRLDQLER	749	sp|Q96CT7|CC124_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4811	17.406614006666665	3	1084.609534	1084.610140	K	K	59	67
PSM	RKYYEVKN	750	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3965	15.393737610133334	3	1098.581800	1098.582194	D	K	453	461
PSM	RRLEELER	751	sp|O95819|M4K4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4849	17.471326169066668	3	1099.609945	1099.609805	K	R	436	444
PSM	RRFQDAVRL	752	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6645	21.4552456536	3	1159.657657	1159.657424	E	R	374	383
PSM	RKKAYADFY	753	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6227	20.504104028266667	2	1160.597890	1160.597844	Q	R	45	54
PSM	KRKFVADGIF	754	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7264	23.054078862133334	3	1179.677251	1179.676428	K	K	8	18
PSM	RKKLGEFFQT	755	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6939	22.203861438933334	3	1252.692967	1252.692807	N	K	711	721
PSM	RKKLPVDSVFN	756	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6745	21.704316904	3	1301.745308	1301.745571	K	K	686	697
PSM	RRDYDDMSPR	757	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4547	16.936352444	3	1309.581323	1309.583333	S	R	277	287
PSM	RKREAFLEQF	758	sp|P23258|TBG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7351	23.2910022968	3	1322.710292	1322.709519	L	R	399	409
PSM	RKKIQINQEEE	759	sp|P42696|RBM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4239	16.311983651466665	3	1413.758034	1413.757592	Q	R	169	180
PSM	RRTWDDDYVLK	760	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6933	22.1902886568	3	1465.731611	1465.731377	R	R	1758	1769
PSM	KGPNGYGFHLHGEKG	761	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6054	20.122258590133335	3	1597.764721	1596.779724	E	K	19	34
PSM	KKTTHFVEGGDAGNREDQIN	762	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4899	17.561256715733336	4	2216.045329	2215.061773	K	R	222	242
PSM	RRRDISSSLNSLADSNA	763	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6851	21.976784041866665	3	1860.944673	1860.940201	F	R	47	64
PSM	KRPPSAFFLFCSEHRP	764	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=7690	24.679447277333335	3	1974.990761	1974.988672	P	K	96	112
PSM	KKALEEETKNHEAQIQDM	765	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	18-UNIMOD:35	ms_run[1]:scan=4593	17.012520812533335	4	2157.039011	2157.037198	L	R	1180	1198
PSM	KKEVDLLQHLQVSPPVSGLQ	766	sp|B1AJZ9|FHAD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5137	18.056588860533335	4	2214.227032	2214.237218	L	K	583	603
PSM	KKSTDHPKYSDMIVAAIQAE	767	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:35	ms_run[1]:scan=7352	23.295052161333334	4	2247.120215	2247.120533	S	K	20	40
PSM	RRSVSDNDIR	768	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3704	14.984529837066667	2	1216.625199	1216.627246	A	K	744	754
PSM	RHLEDHQAHCEFALMDCPQCQ	769	sp|Q9Y4K3|TRAF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4,15-UNIMOD:35,17-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=6430	20.946811511466667	4	2697.098075	2697.094095	L	R	146	167
PSM	KEVHHDIREDVPPP	770	sp|P78310-7|CXAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5412	18.611	3	1666.8427	1666.8427	E	K	230	244
PSM	KGALHTVSHEDIRDI	771	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6228	20.506	4	1689.8798	1689.8798	H	R	756	771
PSM	KGHQFSCVCLHGDR	772	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5307	18.395	3	1699.7671	1699.7671	K	K	408	422
PSM	KGPVREGDVLTLLESE	773	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8436	27.906	3	1740.9258	1740.9258	V	R	47	63
PSM	KHRELFLS	774	sp|Q9BTC8-2|MTA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6401	20.874	2	1028.5767	1028.5767	L	R	87	95
PSM	KIDTIEIITD	775	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7832	25.341	2	1159.6336	1159.6336	G	R	137	147
PSM	KIWHHTFYNEL	776	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7544	24.011	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	777	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8097	26.44	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	778	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8133	26.591	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	779	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8209	26.925	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	780	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8289	27.266	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	781	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8364	27.6	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	782	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8443	27.936	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	783	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8520	28.279	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	784	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8631	28.776	3	1486.7357	1486.7357	E	R	84	95
PSM	KIWHHTFYNEL	785	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8704	29.116	3	1486.7357	1486.7357	E	R	84	95
PSM	KKHLGFF	786	sp|Q9BRU9-2|UTP23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7006	22.389	2	875.50176	875.5018	A	R	10	17
PSM	KPLAHHIPVEKICE	787	sp|P55145|MANF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	13-UNIMOD:4	ms_run[2]:scan=5834	19.547	4	1669.8974	1669.8974	S	K	94	108
PSM	KPRYTLHY	788	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5894	19.715	3	1076.5767	1076.5767	D	K	271	279
PSM	KQFVFDLHSGKLH	789	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7214	22.949	4	1554.8307	1554.8307	L	R	345	358
PSM	KRCHWSDMFTG	790	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=6340	20.747	3	1439.6074	1439.6074	L	R	80	91
PSM	KRLSMYGVDLHHA	791	sp|O43491|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35	ms_run[2]:scan=5869	19.641	4	1541.7773	1541.7773	A	K	399	412
PSM	KRSHAGYQTI	792	sp|P11279-2|LAMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4323	16.497	2	1159.6098	1159.6098	R	-	355	365
PSM	KTEWLDGKHVVFG	793	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7446	23.586	3	1514.7882	1514.7882	A	K	118	131
PSM	KTPELNLDQFHD	794	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7631	24.394	3	1455.6994	1455.6994	S	K	62	74
PSM	KVRNHYNEEMSNL	795	sp|P15924-3|DESP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6009	20.003	3	1632.7678	1632.7678	A	R	1194	1207
PSM	RERGLLHSS	796	sp|Q9UJX2|CDC23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4118	15.974	2	1053.5679	1053.5679	T	K	44	53
PSM	RERLQEHL	797	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4920	17.598	3	1079.5836	1079.5836	R	R	1687	1695
PSM	REWHHFLVVNM	798	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7811	25.239	3	1466.7241	1466.7241	Y	K	82	93
PSM	RFHDFDH	799	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4992	17.749	2	972.42021	972.4202	D	R	676	683
PSM	RHEVGHIDNSMKIPLNNGAGC	800	sp|Q969X5-3|ERGI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=5880	19.678	4	2334.0957	2334.0957	G	R	50	71
PSM	RHHEDNLL	801	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5014	17.788	2	1032.5101	1032.5101	I	R	1861	1869
PSM	RHIYHSELE	802	sp|P40425|PBX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4619	17.058	3	1182.5782	1182.5782	I	K	169	178
PSM	RHKLLELTQ	803	sp|Q5JRA6-4|TGO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6378	20.829	3	1136.6666	1136.6666	L	K	501	510
PSM	RHKPLLIDMN	804	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=5492	18.76	3	1251.6758	1251.6758	H	K	167	177
PSM	RHLFQEK	805	sp|P25325|THTM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4487	16.817	2	956.5192	956.5192	I	K	230	237
PSM	RHMYHSLYL	806	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6840	21.945	3	1218.5968	1218.5968	D	K	117	126
PSM	RHRPQLLVE	807	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5829	19.529	3	1146.6622	1146.6622	N	R	121	130
PSM	RKESYSIYVY	808	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7339	23.262	2	1306.6558	1306.6558	G	K	34	44
PSM	RKESYSVYVY	809	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7027	22.453	2	1292.6401	1292.6401	S	K	34	44
PSM	RKFGYVDFESAEDLE	810	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8042	26.218	3	1803.8315	1803.8315	T	K	347	362
PSM	RKGCALADHLLHTQAQDGAISTDAEG	811	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=7161	22.818	4	2734.3093	2734.3093	C	K	1126	1152
PSM	RKHEGLE	812	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3538	14.692	2	867.45626	867.4563	L	R	295	302
PSM	RKHLGLLE	813	sp|Q9Y3A2-2|UTP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6126	20.291	2	964.5818	964.5818	F	K	25	33
PSM	RKIVHDY	814	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3884	15.205	2	929.5083	929.5083	A	R	48	55
PSM	RLAHYNK	815	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3521	14.673	2	900.49298	900.4930	S	R	80	87
PSM	RLIKHDL	816	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4788	17.365	2	893.54469	893.5447	I	K	327	334
PSM	RPQQHFLPNQAHQGDHY	817	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5619	19.033	4	2071.9725	2071.9725	P	R	351	368
PSM	RPRHQGVMVGMGQ	818	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35	ms_run[2]:scan=5292	18.372	3	1467.7187	1467.7187	G	K	37	50
PSM	RQLMHSGHPSEKEI	819	sp|Q01082-3|SPTB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4649	17.107	4	1647.8151	1647.8151	A	K	900	914
PSM	RRDHFEEAM	820	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	9-UNIMOD:35	ms_run[2]:scan=3836	15.127	3	1205.5248	1205.5248	I	R	732	741
PSM	RREPHISTL	821	sp|Q8N543|OGFD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5312	18.406	3	1107.6149	1107.6149	K	R	107	116
PSM	RRFSDFLGLHS	822	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7758	24.989	2	1333.6891	1333.6891	K	K	65	76
PSM	RRGEAHLAVNDFELA	823	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7513	23.871	3	1696.8645	1696.8645	F	R	358	373
PSM	RRHEGFAAALGDG	824	sp|Q9BYC9|RM20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6481	21.067	3	1355.6694	1355.6694	R	K	123	136
PSM	RRVALGHGL	825	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5454	18.687	2	977.58828	977.5883	W	K	54	63
PSM	RSRDPHYDDF	826	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5590	18.971	3	1306.5691	1306.5691	P	R	389	399
PSM	RVRFFPYNYH	827	sp|Q5EBL8|PDZ11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7316	23.204	3	1397.6993	1397.6993	M	R	123	133
PSM	RWQDEHKF	828	sp|Q96BX8|MOB3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5765	19.368	3	1144.5414	1144.5414	Y	R	100	108
PSM	RYRPSVDCHE	829	sp|O75362|ZN217_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=4131	16.023	3	1317.5884	1317.5884	C	K	675	685
PSM	RRHVFGESDELIGQ	830	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7040	22.494430437866665	3	1642.811997	1641.822317	E	K	99	113
PSM	RKHIGPLLE	831	sp|Q86Y56|DAAF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6196	20.441100181866666	2	1061.635303	1061.634563	Y	R	560	569
PSM	RHMGIGK	832	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:35	ms_run[1]:scan=3359	14.489531031199999	2	813.427530	813.427942	G	R	74	81
PSM	RFPHRGLLLDTS	833	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7329	23.233994503466665	3	1411.776286	1410.773182	P	R	166	178
PSM	KFILCNLTVEAVGADSASV	834	sp|Q7L0X0|TRIL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=6119	20.274159583733333	3	1993.039453	1993.019028	N	R	584	603
PSM	RRPIKGAAG	835	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3378	14.513597494399999	2	924.561728	924.561733	C	R	364	373
PSM	RKKLEEE	836	sp|B1AK53|ESPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3448	14.593149091733332	2	930.513666	930.513445	L	R	795	802
PSM	RRGEPHVT	837	sp|P67775|PP2AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3522	14.675065537866667	2	950.499471	950.504612	P	R	294	302
PSM	RKKGFTEV	838	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4337	16.5389365136	2	963.550526	963.550165	D	K	484	492
PSM	RRSKEITV	839	sp|P17844|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4179	16.174180558933333	2	987.581541	987.582528	Y	R	77	85
PSM	RKKLEMDL	840	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6279	20.616411542133335	2	1031.578275	1031.579751	A	K	1612	1620
PSM	KRKQEILE	841	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4180	16.1764473552	2	1042.612884	1042.613494	R	K	739	747
PSM	RKRLPDGLT	842	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5005	17.774984463733333	2	1054.625355	1054.624727	S	R	362	371
PSM	RKPKQLEGL	843	sp|Q7Z3K3|POGZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5204	18.201952589066664	3	1067.645202	1067.645128	F	K	674	683
PSM	RKKGFGEDF	844	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5779	19.396988390666667	3	1082.550565	1082.550893	M	K	340	349
PSM	RRQTIEER	845	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3533	14.686096606133333	3	1086.592203	1086.589404	A	K	571	579
PSM	RKKDINNIV	846	sp|Q9H9Q2|CSN7B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5081	17.943679310666667	3	1098.651137	1098.650942	I	K	163	172
PSM	RKKSSNAEVI	847	sp|Q9UQ13|SHOC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4038	15.654944453333334	3	1130.640910	1130.640771	T	K	82	92
PSM	RKKLEELLI	848	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7372	23.35033734186667	3	1140.723937	1140.723044	D	K	1440	1449
PSM	RRADDDRFP	849	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4978	17.7177785968	3	1146.553270	1146.553019	S	R	1150	1159
PSM	RKKMMEIMT	850	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6015	20.02171752	3	1166.596009	1166.597391	I	R	165	174
PSM	RRGMDDDRGP	851	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3649	14.927507464	3	1173.531046	1173.530903	P	R	959	969
PSM	RRLLTQENR	852	sp|P35573|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4097	15.891436466666667	3	1184.674706	1184.673803	F	R	314	323
PSM	RRLYWDDLK	853	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7149	22.7924056824	3	1263.671612	1263.672406	A	R	120	129
PSM	RKKFMGTELNG	854	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5696	19.213285414399998	3	1279.670476	1279.670691	E	K	135	146
PSM	RKKLQLSLADF	855	sp|O00541|PESC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7745	24.931297618933336	3	1317.777701	1317.776871	A	R	24	35
PSM	KKIRGIGFGDIF	856	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7965	25.8966997088	3	1349.781721	1349.781956	P	K	209	221
PSM	KRPRDEDDADY	857	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3804	15.0877001144	2	1378.612489	1378.611321	L	K	137	148
PSM	RRKPDTIEVQQM	858	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5775	19.389859285066667	3	1499.788017	1499.787846	R	K	294	306
PSM	RKKLYYDTDYGS	859	sp|Q9NQZ2|SAS10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5828	19.52654160373333	3	1507.730643	1507.730708	Q	K	132	144
PSM	RRKPDTIEVQQM	860	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:35	ms_run[1]:scan=4345	16.552876078133334	3	1515.783623	1515.782761	R	K	294	306
PSM	RKRNEPNSYAISF	861	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7020	22.43015588986667	3	1580.806565	1580.805939	V	R	694	707
PSM	KRKTVTAMDVVYAL	862	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7937	25.77906512666667	3	1593.892175	1593.891249	A	K	78	92
PSM	RRKGGEADNLDEFL	863	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7566	24.106605320266667	3	1618.805987	1618.806333	K	K	404	418
PSM	RKRGFQEVVTPNIFNS	864	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7654	24.5029130848	3	1891.008231	1891.006430	Y	R	365	381
PSM	KRKGFSEGLWEIENNPTV	865	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7846	25.4056446224	3	2103.085167	2103.074903	N	K	78	96
PSM	KKGEKEQQEAIEHIDEVQNEID	866	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7288	23.13497211386667	4	2608.267973	2608.261654	P	R	45	67