MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-4 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172214503394^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\171105HEK_TNSCX_F41.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172214503394^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\171105HEK_TNSCX_F41.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P31942-6|HNRH3_HUMAN	Isoform 6 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63.0	null	62-UNIMOD:35,39-UNIMOD:35	0.19	63.0	6	1	0
PRT	sp|O95297-4|MPZL1_HUMAN	Isoform 4 of Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60.0	null		0.21	60.0	1	1	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59.0	null		0.01	59.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	104-UNIMOD:35	0.07	56.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54.0	null		0.06	54.0	2	1	0
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.00	52.0	1	1	1
PRT	sp|Q5VT52-2|RPRD2_HUMAN	Isoform 2 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null		0.03	52.0	2	1	0
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null		0.03	51.0	1	1	1
PRT	sp|Q96A08|H2B1A_HUMAN	Histone H2B type 1-A OS=Homo sapiens OX=9606 GN=H2BC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51.0	null		0.15	51.0	2	1	0
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	50.0	null	325-UNIMOD:35	0.27	50.0	11	5	2
PRT	sp|Q96S59-2|RANB9_HUMAN	Isoform 2 of Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	186-UNIMOD:4,206-UNIMOD:35	0.07	49.0	2	1	0
PRT	sp|Q9H582|ZN644_HUMAN	Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49.0	null	613-UNIMOD:4	0.04	49.0	3	2	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.05	48.0	2	2	2
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null	56-UNIMOD:35	0.09	48.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.01	48.0	1	1	1
PRT	sp|P06899|H2B1J_HUMAN	Histone H2B type 1-J OS=Homo sapiens OX=9606 GN=H2BC11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48.0	null		0.15	48.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.04	47.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.02	47.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	36-UNIMOD:4,45-UNIMOD:4	0.33	46.0	1	1	1
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	339-UNIMOD:35	0.04	46.0	4	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	504-UNIMOD:4	0.01	46.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.06	46.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46.0	null	135-UNIMOD:4	0.12	46.0	3	1	0
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	518-UNIMOD:4	0.02	45.0	2	2	2
PRT	sp|Q8IVH8-3|M4K3_HUMAN	Isoform 3 of Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.03	45.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.11	45.0	2	2	2
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.12	45.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null		0.13	45.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45.0	null	340-UNIMOD:35	0.10	45.0	6	2	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	540-UNIMOD:4	0.02	44.0	1	1	1
PRT	sp|Q7Z3K3-5|POGZ_HUMAN	Isoform 5 of Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	437-UNIMOD:4,440-UNIMOD:4	0.02	44.0	1	1	1
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44.0	null		0.08	44.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	785-UNIMOD:4	0.02	43.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	774-UNIMOD:35	0.02	43.0	2	1	0
PRT	sp|P29084|T2EB_HUMAN	Transcription initiation factor IIE subunit beta OS=Homo sapiens OX=9606 GN=GTF2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43.0	null		0.08	43.0	1	1	1
PRT	sp|Q13472-3|TOP3A_HUMAN	Isoform 3 of DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q8N4P3|MESH1_HUMAN	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.11	42.0	1	1	1
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null	381-UNIMOD:35	0.04	42.0	1	1	1
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q9BZJ0|CRNL1_HUMAN	Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	294-UNIMOD:35	0.06	41.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.09	41.0	4	2	0
PRT	sp|Q8NB46|ANR52_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|Q9NS87-4|KIF15_HUMAN	Isoform 4 of Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	757-UNIMOD:35	0.02	40.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|P46100-2|ATRX_HUMAN	Isoform 1 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q9H2W6|RM46_HUMAN	39S ribosomal protein L46, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL46 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q9H9V9-2|JMJD4_HUMAN	Isoform 2 of 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	282-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	212-UNIMOD:4	0.05	39.0	3	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	517-UNIMOD:4	0.03	39.0	2	1	0
PRT	sp|Q5VU97|CAHD1_HUMAN	VWFA and cache domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACHD1 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.02	39.0	1	1	0
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q8IZP0-2|ABI1_HUMAN	Isoform 2 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.17	38.0	8	6	4
PRT	sp|Q13586-2|STIM1_HUMAN	Isoform 2 of Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	2	2	2
PRT	sp|Q9H0L4|CSTFT_HUMAN	Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	364-UNIMOD:35	0.04	38.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	2	1	0
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	163-UNIMOD:35	0.02	38.0	2	1	0
PRT	sp|Q9NP77|SSU72_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase SSU72 OS=Homo sapiens OX=9606 GN=SSU72 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	84-UNIMOD:35	0.09	38.0	2	1	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q8NBT2-2|SPC24_HUMAN	Isoform 2 of Kinetochore protein Spc24 OS=Homo sapiens OX=9606 GN=SPC24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	1	1	1
PRT	sp|O75319|DUS11_HUMAN	RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	2	1	0
PRT	sp|P61962|DCAF7_HUMAN	DDB1- and CUL4-associated factor 7 OS=Homo sapiens OX=9606 GN=DCAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	127-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	3	2	1
PRT	sp|Q6NTF9-3|RHBD2_HUMAN	Isoform 3 of Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	118-UNIMOD:4	0.16	37.0	1	1	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37.0	null		0.09	37.0	2	2	2
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	3	3	3
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	3	3	3
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	3848-UNIMOD:35,4790-UNIMOD:35	0.01	36.0	2	2	2
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	58-UNIMOD:4	0.15	36.0	2	2	2
PRT	sp|Q14156-3|EFR3A_HUMAN	Isoform 3 of Protein EFR3 homolog A OS=Homo sapiens OX=9606 GN=EFR3A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	250-UNIMOD:35	0.03	36.0	2	2	2
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q86V24|PAQR2_HUMAN	Adiponectin receptor protein 2 OS=Homo sapiens OX=9606 GN=ADIPOR2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|P43034-2|LIS1_HUMAN	Isoform 2 of Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	98-UNIMOD:35,111-UNIMOD:35	0.18	36.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null	43-UNIMOD:4	0.03	36.0	2	2	2
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	2	2	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	230-UNIMOD:4	0.08	35.0	7	4	3
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	3419-UNIMOD:35	0.00	35.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	305-UNIMOD:35,153-UNIMOD:35	0.30	35.0	7	7	7
PRT	sp|Q8WW12-3|PCNP_HUMAN	Isoform 3 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.29	35.0	1	1	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|O43390|HNRPR_HUMAN	Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	3	2	1
PRT	sp|Q9UI09|NDUAC_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.11	35.0	1	1	1
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	363-UNIMOD:35	0.12	34.0	3	3	3
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	10-UNIMOD:35	0.01	34.0	3	1	0
PRT	sp|O60870-2|KIN17_HUMAN	Isoform 2 of DNA/RNA-binding protein KIN17 OS=Homo sapiens OX=9606 GN=KIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	27-UNIMOD:4,28-UNIMOD:4,65-UNIMOD:4	0.12	34.0	2	2	2
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	0
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P49711-2|CTCF_HUMAN	Isoform 2 of Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:4,200-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	205-UNIMOD:4,286-UNIMOD:35,289-UNIMOD:35	0.16	34.0	3	3	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	466-UNIMOD:35	0.13	34.0	7	6	5
PRT	sp|O00268|TAF4_HUMAN	Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	326-UNIMOD:35	0.03	34.0	2	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	3	2	1
PRT	sp|O43852-12|CALU_HUMAN	Isoform 12 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.18	33.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	579-UNIMOD:35,582-UNIMOD:35	0.04	33.0	4	2	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	4	4	4
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	175-UNIMOD:4	0.05	33.0	1	1	0
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q49AR2|CE022_HUMAN	UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	344-UNIMOD:4,350-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q86Y07-4|VRK2_HUMAN	Isoform 4 of Serine/threonine-protein kinase VRK2 OS=Homo sapiens OX=9606 GN=VRK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	0
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q05513|KPCZ_HUMAN	Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	549-UNIMOD:35,557-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	1259-UNIMOD:35	0.02	33.0	2	2	2
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	323-UNIMOD:4	0.01	33.0	1	1	1
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33.0	null	1139-UNIMOD:35,1144-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P51649|SSDH_HUMAN	Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	237-UNIMOD:4	0.06	32.0	3	3	3
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	179-UNIMOD:35,30-UNIMOD:35	0.17	32.0	5	5	5
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	174-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q15631-2|TSN_HUMAN	Isoform 2 of Translin OS=Homo sapiens OX=9606 GN=TSN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|Q9UHQ1-4|NARF_HUMAN	Isoform 4 of Nuclear prelamin A recognition factor OS=Homo sapiens OX=9606 GN=NARF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P22415-2|USF1_HUMAN	Isoform 2 of Upstream stimulatory factor 1 OS=Homo sapiens OX=9606 GN=USF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	3	3	3
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	129-UNIMOD:4	0.16	32.0	1	1	1
PRT	sp|O60279|SUSD5_HUMAN	Sushi domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SUSD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	626-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	725-UNIMOD:4,726-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	16	2	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	2	2	2
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.00	32.0	2	1	0
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9Y421|FA32A_HUMAN	Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32.0	null		0.18	32.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q9GZR2-2|REXO4_HUMAN	Isoform 2 of RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q9UBI1|COMD3_HUMAN	COMM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=COMMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	62-UNIMOD:4	0.09	31.0	1	1	1
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	161-UNIMOD:4,100-UNIMOD:35,115-UNIMOD:4	0.41	31.0	4	4	4
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	150-UNIMOD:35,948-UNIMOD:35	0.03	31.0	5	3	1
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9UPN3-5|MACF1_HUMAN	Isoform 4 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	4272-UNIMOD:35	0.00	31.0	2	1	0
PRT	sp|Q9Y376|CAB39_HUMAN	Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q96CB9-3|NSUN4_HUMAN	Isoform 3 of 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens OX=9606 GN=NSUN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	166-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	100-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|O15084|ANR28_HUMAN	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	155-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9H2D6|TARA_HUMAN	TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q99729|ROAA_HUMAN	Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	224-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.10	31.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|Q9BYC9|RM20_HUMAN	39S ribosomal protein L20, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL20 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.15	31.0	2	2	2
PRT	sp|O15111|IKKA_HUMAN	Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	586-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q6NSI4-3|RADX_HUMAN	Isoform 3 of RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P37275-3|ZEB1_HUMAN	Isoform 3 of Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	912-UNIMOD:35	0.03	30.0	2	2	2
PRT	sp|P18074|ERCC2_HUMAN	General transcription and DNA repair factor IIH helicase subunit XPD OS=Homo sapiens OX=9606 GN=ERCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P49418-2|AMPH_HUMAN	Isoform 2 of Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|Q10469|MGAT2_HUMAN	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	378-UNIMOD:4,380-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q676U5-3|A16L1_HUMAN	Isoform 3 of Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q96JN0-3|LCOR_HUMAN	Isoform 3 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q6P587|FAHD1_HUMAN	Acylpyruvase FAHD1, mitochondrial OS=Homo sapiens OX=9606 GN=FAHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	78-UNIMOD:35	0.07	30.0	3	1	0
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q9BPW8|NIPS1_HUMAN	Protein NipSnap homolog 1 OS=Homo sapiens OX=9606 GN=NIPSNAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.01	30.0	2	2	2
PRT	sp|P30419|NMT1_HUMAN	Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	85-UNIMOD:35	0.16	30.0	4	3	2
PRT	sp|P28161|GSTM2_HUMAN	Glutathione S-transferase Mu 2 OS=Homo sapiens OX=9606 GN=GSTM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	87-UNIMOD:4	0.07	30.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	488-UNIMOD:35	0.03	30.0	3	1	0
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|Q9Y5B8|NDK7_HUMAN	Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	37-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	11-UNIMOD:4,17-UNIMOD:4,414-UNIMOD:4,416-UNIMOD:4	0.07	29.0	4	3	2
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|Q9NPE2|NGRN_HUMAN	Neugrin OS=Homo sapiens OX=9606 GN=NGRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q13356|PPIL2_HUMAN	RING-type E3 ubiquitin-protein ligase PPIL2 OS=Homo sapiens OX=9606 GN=PPIL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	4121-UNIMOD:4	0.00	29.0	2	1	0
PRT	sp|Q16890-4|TPD53_HUMAN	Isoform 4 of Tumor protein D53 OS=Homo sapiens OX=9606 GN=TPD52L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	1	1	1
PRT	sp|O43353-2|RIPK2_HUMAN	Isoform 2 of Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	251-UNIMOD:4	0.05	29.0	1	1	0
PRT	sp|Q5JRX3-3|PREP_HUMAN	Isoform 3 of Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	434-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q96N67-4|DOCK7_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	331-UNIMOD:4,337-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	133-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|P13051-2|UNG_HUMAN	Isoform 1 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q7LBC6-3|KDM3B_HUMAN	Isoform 3 of Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O94761|RECQ4_HUMAN	ATP-dependent DNA helicase Q4 OS=Homo sapiens OX=9606 GN=RECQL4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q8WXW3|PIBF1_HUMAN	Progesterone-induced-blocking factor 1 OS=Homo sapiens OX=9606 GN=PIBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	293-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P10155|RO60_HUMAN	60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9Y2X0|MED16_HUMAN	Mediator of RNA polymerase II transcription subunit 16 OS=Homo sapiens OX=9606 GN=MED16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|O15392|BIRC5_HUMAN	Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	84-UNIMOD:4	0.10	29.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O95926|SYF2_HUMAN	Pre-mRNA-splicing factor SYF2 OS=Homo sapiens OX=9606 GN=SYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q8NBF2|NHLC2_HUMAN	NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	179-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q12923-3|PTN13_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	45-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	1	1	1
PRT	sp|Q9P031|TAP26_HUMAN	Thyroid transcription factor 1-associated protein 26 OS=Homo sapiens OX=9606 GN=CCDC59 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q96T17-2|MA7D2_HUMAN	Isoform 2 of MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	202-UNIMOD:35,207-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q15811-13|ITSN1_HUMAN	Isoform 13 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q15910-3|EZH2_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	247-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q7Z6J9|SEN54_HUMAN	tRNA-splicing endonuclease subunit Sen54 OS=Homo sapiens OX=9606 GN=TSEN54 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	3	2	1
PRT	sp|Q13596-2|SNX1_HUMAN	Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|A5A3E0|POTEF_HUMAN	POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q15643|TRIPB_HUMAN	Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9ULL5|PRR12_HUMAN	Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q13362|2A5G_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q8TF01|PNISR_HUMAN	Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|O75880|SCO1_HUMAN	Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	294-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	2	2	2
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q8TED0|UTP15_HUMAN	U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	36-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	73-UNIMOD:4,79-UNIMOD:35	0.13	28.0	2	1	0
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	746-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:35,63-UNIMOD:35	0.28	27.0	3	3	3
PRT	sp|Q9GZT3-2|SLIRP_HUMAN	Isoform 2 of SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	2	2
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q15555-2|MARE2_HUMAN	Isoform 2 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q6IS14|IF5AL_HUMAN	Eukaryotic translation initiation factor 5A-1-like OS=Homo sapiens OX=9606 GN=EIF5AL1 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	3	2	1
PRT	sp|Q8N720|ZN655_HUMAN	Zinc finger protein 655 OS=Homo sapiens OX=9606 GN=ZNF655 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O43402|EMC8_HUMAN	ER membrane protein complex subunit 8 OS=Homo sapiens OX=9606 GN=EMC8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	153-UNIMOD:4,161-UNIMOD:4	0.09	27.0	1	1	1
PRT	sp|P22090|RS4Y1_HUMAN	40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens OX=9606 GN=RPS4Y1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	332-UNIMOD:35	0.01	27.0	2	1	0
PRT	sp|P00519-2|ABL1_HUMAN	Isoform IB of Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	39-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P56270-2|MAZ_HUMAN	Isoform 2 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q92530|PSMF1_HUMAN	Proteasome inhibitor PI31 subunit OS=Homo sapiens OX=9606 GN=PSMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	3	1	0
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	2	1	0
PRT	sp|O75616|ERAL1_HUMAN	GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	278-UNIMOD:4	0.07	27.0	2	2	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	2	2	2
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	38-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|P31942|HNRH3_HUMAN	Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	176-UNIMOD:35,199-UNIMOD:35	0.08	27.0	1	1	0
PRT	sp|Q8IYD1|ERF3B_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|Q9UQ88|CD11A_HUMAN	Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O95863|SNAI1_HUMAN	Zinc finger protein SNAI1 OS=Homo sapiens OX=9606 GN=SNAI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	7	2	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O43747|AP1G1_HUMAN	AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	160-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9UPZ3|HPS5_HUMAN	Hermansky-Pudlak syndrome 5 protein OS=Homo sapiens OX=9606 GN=HPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|O14936|CSKP_HUMAN	Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NRL3|STRN4_HUMAN	Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	337-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.15	26.0	1	1	1
PRT	sp|O75629|CREG1_HUMAN	Protein CREG1 OS=Homo sapiens OX=9606 GN=CREG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	178-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9NWZ3-2|IRAK4_HUMAN	Isoform 2 of Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	519-UNIMOD:4	0.00	26.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9UPY3-2|DICER_HUMAN	Isoform 2 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P15622-2|ZN250_HUMAN	Isoform 2 of Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9Y3Z3-4|SAMH1_HUMAN	Isoform 4 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	320-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P61244-6|MAX_HUMAN	Isoform 6 of Protein max OS=Homo sapiens OX=9606 GN=MAX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.14	26.0	1	1	1
PRT	sp|Q14192-2|FHL2_HUMAN	Isoform 2 of Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	7-UNIMOD:4,10-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|O00754-2|MA2B1_HUMAN	Isoform 2 of Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q5VU97-2|CAHD1_HUMAN	Isoform 2 of VWFA and cache domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CACHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|P60763|RAC3_HUMAN	Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens OX=9606 GN=RAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	105-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|Q9BSV6|SEN34_HUMAN	tRNA-splicing endonuclease subunit Sen34 OS=Homo sapiens OX=9606 GN=TSEN34 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	2	2	2
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	201-UNIMOD:4,204-UNIMOD:4,206-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q6Y1H2|HACD2_HUMAN	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens OX=9606 GN=HACD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	360-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q9NYJ8-2|TAB2_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Homo sapiens OX=9606 GN=TAB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	422-UNIMOD:35,428-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q04206-2|TF65_HUMAN	Isoform 2 of Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	82-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q96BT3|CENPT_HUMAN	Centromere protein T OS=Homo sapiens OX=9606 GN=CENPT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O15381|NVL_HUMAN	Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	0
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q16656|NRF1_HUMAN	Nuclear respiratory factor 1 OS=Homo sapiens OX=9606 GN=NRF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9H2K0|IF3M_HUMAN	Translation initiation factor IF-3, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	25-UNIMOD:4	0.08	26.0	2	1	0
PRT	sp|O75323|NIPS2_HUMAN	Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.09	26.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|Q02750|MP2K1_HUMAN	Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9UJY4|GGA2_HUMAN	ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8IWC1|MA7D3_HUMAN	MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	41-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P19447|ERCC3_HUMAN	General transcription and DNA repair factor IIH helicase subunit XPB OS=Homo sapiens OX=9606 GN=ERCC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q8TBM8-2|DJB14_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q96HW7-2|INT4_HUMAN	Isoform 2 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1927-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9NV88-3|INT9_HUMAN	Isoform 3 of Integrator complex subunit 9 OS=Homo sapiens OX=9606 GN=INTS9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P98177-2|FOXO4_HUMAN	Isoform Zeta of Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q7Z569|BRAP_HUMAN	BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	0
PRT	sp|O95620-2|DUS4L_HUMAN	Isoform 2 of tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens OX=9606 GN=DUS4L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O95671-3|ASML_HUMAN	Isoform 3 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	356-UNIMOD:4,364-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q92604|LGAT1_HUMAN	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPGAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9ULF5|S39AA_HUMAN	Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9NWB7|IFT57_HUMAN	Intraflagellar transport protein 57 homolog OS=Homo sapiens OX=9606 GN=IFT57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q7L7X3|TAOK1_HUMAN	Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	964-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|Q92544|TM9S4_HUMAN	Transmembrane 9 superfamily member 4 OS=Homo sapiens OX=9606 GN=TM9SF4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q68DH5|LMBD2_HUMAN	G-protein coupled receptor-associated protein LMBRD2 OS=Homo sapiens OX=9606 GN=LMBRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8TCG1|CIP2A_HUMAN	Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	887-UNIMOD:35	0.03	25.0	2	2	2
PRT	sp|P38398|BRCA1_HUMAN	Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9UBF8|PI4KB_HUMAN	Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.18	24.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1079-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q6UVY6-2|MOXD1_HUMAN	Isoform 2 of DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P08047-3|SP1_HUMAN	Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	580-UNIMOD:4,585-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q92802|N42L2_HUMAN	NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	338-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q13620-3|CUL4B_HUMAN	Isoform 3 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y2Q3-3|GSTK1_HUMAN	Isoform 3 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	2	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9H582-2|ZN644_HUMAN	Isoform 2 of Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	429-UNIMOD:35,430-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|O15381-3|NVL_HUMAN	Isoform 3 of Nuclear valosin-containing protein-like OS=Homo sapiens OX=9606 GN=NVL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q8TDJ6-2|DMXL2_HUMAN	Isoform 2 of DmX-like protein 2 OS=Homo sapiens OX=9606 GN=DMXL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9NUY8-2|TBC23_HUMAN	Isoform 2 of TBC1 domain family member 23 OS=Homo sapiens OX=9606 GN=TBC1D23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	62-UNIMOD:4,63-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q9P032|NDUF4_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 OS=Homo sapiens OX=9606 GN=NDUFAF4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	103-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	185-UNIMOD:35	0.07	24.0	1	1	1
PRT	sp|Q6NXE6-2|ARMC6_HUMAN	Isoform 2 of Armadillo repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=ARMC6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	224-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|P84022-2|SMAD3_HUMAN	Isoform 2 of Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	106-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	647-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q15796|SMAD2_HUMAN	Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P15529|MCP_HUMAN	Membrane cofactor protein OS=Homo sapiens OX=9606 GN=CD46 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	292-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|Q2M1P5|KIF7_HUMAN	Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q9P0K7|RAI14_HUMAN	Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O95347|SMC2_HUMAN	Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q6IA86|ELP2_HUMAN	Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O60610|DIAP1_HUMAN	Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9HBE1-4|PATZ1_HUMAN	Isoform 4 of POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=PATZ1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.11	23.0	1	1	1
PRT	sp|Q9BYC5-3|FUT8_HUMAN	Isoform 3 of Alpha-(1,6)-fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|Q8TBX8-2|PI42C_HUMAN	Isoform 2 of Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q96GA3|LTV1_HUMAN	Protein LTV1 homolog OS=Homo sapiens OX=9606 GN=LTV1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	5	2	1
PRT	sp|O94880-2|PHF14_HUMAN	Isoform 2 of PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	458-UNIMOD:4,461-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:35	0.06	23.0	1	1	1
PRT	sp|Q99797|MIPEP_HUMAN	Mitochondrial intermediate peptidase OS=Homo sapiens OX=9606 GN=MIPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	448-UNIMOD:4	0.03	23.0	2	2	2
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	2	1	0
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q14119|VEZF1_HUMAN	Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	95-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q5JTD0-4|TJAP1_HUMAN	Isoform 4 of Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9Y5B8-2|NDK7_HUMAN	Isoform 2 of Nucleoside diphosphate kinase 7 OS=Homo sapiens OX=9606 GN=NME7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q8ND76-3|CCNY_HUMAN	Isoform 3 of Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q9H410-2|DSN1_HUMAN	Isoform 2 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	771-UNIMOD:35	0.02	23.0	2	2	2
PRT	sp|P21359-4|NF1_HUMAN	Isoform 4 of Neurofibromin OS=Homo sapiens OX=9606 GN=NF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	1	0
PRT	sp|Q96HJ9-2|FMC1_HUMAN	Isoform 2 of Protein FMC1 homolog OS=Homo sapiens OX=9606 GN=FMC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|P22392|NDKB_HUMAN	Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9NUA8|ZBT40_HUMAN	Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	204-UNIMOD:35	0.09	23.0	3	1	0
PRT	sp|Q01543|FLI1_HUMAN	Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q7Z6K5|ARPIN_HUMAN	Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q7L523|RRAGA_HUMAN	Ras-related GTP-binding protein A OS=Homo sapiens OX=9606 GN=RRAGA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	312-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q70IA6|MOB2_HUMAN	MOB kinase activator 2 OS=Homo sapiens OX=9606 GN=MOB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q9H939|PPIP2_HUMAN	Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens OX=9606 GN=PSTPIP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	123-UNIMOD:35	0.04	23.0	2	1	0
PRT	sp|Q9NX20|RM16_HUMAN	39S ribosomal protein L16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|Q9H8H2|DDX31_HUMAN	Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens OX=9606 GN=DDX31 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8TEH3|DEN1A_HUMAN	DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|Q8IY18|SMC5_HUMAN	Structural maintenance of chromosomes protein 5 OS=Homo sapiens OX=9606 GN=SMC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O60563|CCNT1_HUMAN	Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	59-UNIMOD:35	0.02	23.0	2	2	2
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	353-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9NXW2|DJB12_HUMAN	DnaJ homolog subfamily B member 12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q9H3G5|CPVL_HUMAN	Probable serine carboxypeptidase CPVL OS=Homo sapiens OX=9606 GN=CPVL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	271-UNIMOD:4,274-UNIMOD:4	0.03	22.0	2	1	0
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	403-UNIMOD:35	0.02	22.0	3	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	21-UNIMOD:4	0.10	22.0	2	2	2
PRT	sp|Q86XI2|CNDG2_HUMAN	Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q12923-2|PTN13_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	57-UNIMOD:4	0.08	22.0	1	1	1
PRT	sp|Q9UNY4-2|TTF2_HUMAN	Isoform 2 of Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P05067-10|A4_HUMAN	Isoform APP639 of Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	464-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q9NUQ7|UFSP2_HUMAN	Ufm1-specific protease 2 OS=Homo sapiens OX=9606 GN=UFSP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q7RTP6-5|MICA3_HUMAN	Isoform 5 of [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	9-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q9P2J5-3|SYLC_HUMAN	Isoform 3 of Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	494-UNIMOD:35	0.07	22.0	3	3	3
PRT	sp|P52797-2|EFNA3_HUMAN	Isoform 2 of Ephrin-A3 OS=Homo sapiens OX=9606 GN=EFNA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9H4L5-4|OSBL3_HUMAN	Isoform 1d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q86Y07|VRK2_HUMAN	Serine/threonine-protein kinase VRK2 OS=Homo sapiens OX=9606 GN=VRK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	0
PRT	sp|Q03468|ERCC6_HUMAN	DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9H270|VPS11_HUMAN	Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=VPS11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	2694-UNIMOD:35	0.00	22.0	1	1	1
PRT	sp|P42785|PCP_HUMAN	Lysosomal Pro-X carboxypeptidase OS=Homo sapiens OX=9606 GN=PRCP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	233-UNIMOD:4	0.03	22.0	2	1	0
PRT	sp|Q6ZU65|UBN2_HUMAN	Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q2NKX9|CB068_HUMAN	UPF0561 protein C2orf68 OS=Homo sapiens OX=9606 GN=C2orf68 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	21-UNIMOD:35	0.08	22.0	1	1	1
PRT	sp|Q9BXW7|HDHD5_HUMAN	Haloacid dehalogenase-like hydrolase domain-containing 5 OS=Homo sapiens OX=9606 GN=HDHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q13868|EXOS2_HUMAN	Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	131-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	47-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	16-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P54132|BLM_HUMAN	Bloom syndrome protein OS=Homo sapiens OX=9606 GN=BLM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	928-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	62-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|Q8TCD5|NT5C_HUMAN	5'(3')-deoxyribonucleotidase, cytosolic type OS=Homo sapiens OX=9606 GN=NT5C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P35573-2|GDE_HUMAN	Isoform 5 of Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9BXS6-7|NUSAP_HUMAN	Isoform 7 of Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	193-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|Q8N4C6-6|NIN_HUMAN	Isoform 6 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	139-UNIMOD:35	0.06	21.0	3	2	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	271-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9Y3D0|CIA2B_HUMAN	Cytosolic iron-sulfur assembly component 2B OS=Homo sapiens OX=9606 GN=CIAO2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	117-UNIMOD:35	0.13	21.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	109-UNIMOD:35,116-UNIMOD:4	0.09	21.0	1	1	1
PRT	sp|P11217-2|PYGM_HUMAN	Isoform 2 of Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UDR5|AASS_HUMAN	Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens OX=9606 GN=AASS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9HC38-3|GLOD4_HUMAN	Isoform 3 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	175-UNIMOD:4	0.04	21.0	1	1	0
PRT	sp|Q9BYC5|FUT8_HUMAN	Alpha-(1,6)-fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q9NVK5|FGOP2_HUMAN	FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	0
PRT	sp|A6NHG4|DDTL_HUMAN	D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|Q96PQ6|ZN317_HUMAN	Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	213-UNIMOD:35,215-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q7Z5J4|RAI1_HUMAN	Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q86VS8|HOOK3_HUMAN	Protein Hook homolog 3 OS=Homo sapiens OX=9606 GN=HOOK3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9Y5A7|NUB1_HUMAN	NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	2	2	2
PRT	sp|P17252|KPCA_HUMAN	Protein kinase C alpha type OS=Homo sapiens OX=9606 GN=PRKCA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q16512|PKN1_HUMAN	Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9NRP2|COXM2_HUMAN	COX assembly mitochondrial protein 2 homolog OS=Homo sapiens OX=9606 GN=CMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.18	21.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96II8|LRCH3_HUMAN	DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O75400|PR40A_HUMAN	Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|O43929|ORC4_HUMAN	Origin recognition complex subunit 4 OS=Homo sapiens OX=9606 GN=ORC4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	16-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q99961-3|SH3G1_HUMAN	Isoform 3 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q69YN4-3|VIR_HUMAN	Isoform 3 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P00918|CAH2_HUMAN	Carbonic anhydrase 2 OS=Homo sapiens OX=9606 GN=CA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9P2D1|CHD7_HUMAN	Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q6XZF7|DNMBP_HUMAN	Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9NRZ9-6|HELLS_HUMAN	Isoform 6 of Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P13693|TCTP_HUMAN	Translationally-controlled tumor protein OS=Homo sapiens OX=9606 GN=TPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	13-UNIMOD:35	0.09	20.0	1	1	1
PRT	sp|Q14574-2|DSC3_HUMAN	Isoform 3B of Desmocollin-3 OS=Homo sapiens OX=9606 GN=DSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	804-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|Q7L0Y3|TM10C_HUMAN	tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q13325-2|IFIT5_HUMAN	Isoform 2 of Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q8N7R7-3|CCYL1_HUMAN	Isoform 3 of Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.00	20.0	1	1	0
PRT	sp|Q9H9T3-4|ELP3_HUMAN	Isoform 3 of Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P35609|ACTN2_HUMAN	Alpha-actinin-2 OS=Homo sapiens OX=9606 GN=ACTN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	39-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q8NHW5|RLA0L_HUMAN	60S acidic ribosomal protein P0-like OS=Homo sapiens OX=9606 GN=RPLP0P6 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	101-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|Q68DQ2|CRBG3_HUMAN	Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.00	20.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	69-UNIMOD:35	0.16	20.0	2	2	2
PRT	sp|Q8IYI6|EXOC8_HUMAN	Exocyst complex component 8 OS=Homo sapiens OX=9606 GN=EXOC8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P23258|TBG1_HUMAN	Tubulin gamma-1 chain OS=Homo sapiens OX=9606 GN=TUBG1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	328-UNIMOD:35,331-UNIMOD:35	0.04	20.0	1	1	0
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q96ED9|HOOK2_HUMAN	Protein Hook homolog 2 OS=Homo sapiens OX=9606 GN=HOOK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9Y4B4|ARIP4_HUMAN	Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O94763|RMP_HUMAN	Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9BW30|TPPP3_HUMAN	Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	30-UNIMOD:35	0.11	20.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O43353|RIPK2_HUMAN	Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	388-UNIMOD:4	0.04	20.0	1	1	0
PRT	sp|Q9H9Y2|RPF1_HUMAN	Ribosome production factor 1 OS=Homo sapiens OX=9606 GN=RPF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	591-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|P24666-4|PPAC_HUMAN	Isoform 4 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	71-UNIMOD:35	0.11	19.0	1	1	1
PRT	sp|A0FGR8-4|ESYT2_HUMAN	Isoform 4 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q15599-2|NHRF2_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	137-UNIMOD:4	0.03	19.0	2	1	0
PRT	sp|Q8IWI9-3|MGAP_HUMAN	Isoform 2 of MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	116-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|Q8N5P1|ZC3H8_HUMAN	Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q5W0V3-2|F16B1_HUMAN	Isoform 2 of Protein FAM160B1 OS=Homo sapiens OX=9606 GN=FAM160B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	215-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9UBX3|DIC_HUMAN	Mitochondrial dicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q15393-3|SF3B3_HUMAN	Isoform 3 of Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	338-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	0
PRT	sp|Q8IYD8|FANCM_HUMAN	Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NNX1|TUFT1_HUMAN	Tuftelin OS=Homo sapiens OX=9606 GN=TUFT1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	294-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	2	2	2
PRT	sp|Q96GM5|SMRD1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|O14744|ANM5_HUMAN	Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.00	19.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q96L92|SNX27_HUMAN	Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8N726|ARF_HUMAN	Tumor suppressor ARF OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null		0.15	19.0	1	1	1
PRT	sp|P55017|S12A3_HUMAN	Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	146-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	116-UNIMOD:35,117-UNIMOD:35	0.05	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	1	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	63	26-UNIMOD:35	ms_run[2]:scan=7002	20.141	4	2558.0716	2558.0716	G	R	37	63
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	2	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	3-UNIMOD:35	ms_run[2]:scan=7535	21.091	4	2558.0716	2558.0716	G	R	37	63
PSM	KSLPSGSHQGPVIYAQLDHSGGHHSDKIN	3	sp|O95297-4|MPZL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60		ms_run[2]:scan=7133	20.363	4	3065.5067	3065.5067	V	K	104	133
PSM	RYGSALASAGDPGHPNHPLHASQNSAR	4	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	59		ms_run[2]:scan=5720	17.997	4	2767.3287	2767.3287	L	R	1854	1881
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	5	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	3-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=6472	19.202	4	2574.0666	2574.0666	G	R	37	63
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	6	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	57	3-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=6785	19.755	4	2574.0666	2574.0666	G	R	37	63
PSM	RHPYKMNLASEPQEVLHIGSAHN	7	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	6-UNIMOD:35	ms_run[2]:scan=7968	21.965	4	2643.2976	2643.2976	K	R	99	122
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	8	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	3-UNIMOD:35	ms_run[2]:scan=7543	21.108	4	2558.0716	2558.0716	G	R	37	63
PSM	KKSAVADKHELLSLASSNHLG	9	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	54		ms_run[1]:scan=8253	22.625708009599997	3	2204.194034	2204.191330	E	K	220	241
PSM	KKHDEASSLSHPDLTSVIHLT	10	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=8863	24.243	4	2314.1917	2314.1917	E	R	2905	2926
PSM	RVRESLTLPSHSLEHLGPPHGGGGGGGSNSSSGPPLGPSH	11	sp|Q5VT52-2|RPRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52		ms_run[2]:scan=8261	22.644	5	3864.9004	3864.9004	S	R	1327	1367
PSM	KYSAHSSHVTNVSFTHNDSHLISTGG	12	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51		ms_run[2]:scan=7375	20.792	4	2782.3059	2782.3059	H	K	771	797
PSM	KHAVSEGTKAVTKYTSSK	13	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	51		ms_run[1]:scan=4752	16.497623735733335	3	1921.027115	1921.026891	A	-	110	128
PSM	KRGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTEN	14	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	50		ms_run[1]:scan=8698	23.665924138399998	5	4701.113139	4701.108743	D	K	215	258
PSM	KAHQSYCHSNKHQSSNLNVPELNSINMS	15	sp|Q96S59-2|RANB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	7-UNIMOD:4,27-UNIMOD:35	ms_run[2]:scan=7637	21.278	4	3239.4836	3239.4836	N	R	180	208
PSM	KKEEASSLNSLHLFSSSSNSHNNFISDPHKPDA	16	sp|Q9H582|ZN644_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	49		ms_run[1]:scan=8583	23.337280427200003	5	3623.730175	3623.724067	F	K	762	795
PSM	KEKLPLDINPVVHPHGHIF	17	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=8842	24.164	4	2189.2109	2189.2109	N	K	287	306
PSM	KKFEQSHLHMSSETQANNELTTNGHGPPAS	18	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	10-UNIMOD:35	ms_run[2]:scan=5835	18.166	4	3292.5167	3292.5167	S	K	47	77
PSM	RNGHVGISFVPKETGEHLVHV	19	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48		ms_run[2]:scan=8367	22.873	4	2311.2185	2311.2185	L	K	1995	2016
PSM	KHAVSEGTKAVTKYTSAK	20	sp|P06899|H2B1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	48		ms_run[1]:scan=4892	16.71618888853333	4	1905.031321	1905.031976	A	-	109	127
PSM	RAISHEHSPSDLEAHFVPLVK	21	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=8490	23.133	5	2368.2288	2368.2288	L	R	113	134
PSM	RSHPETLTHTASPHPGGAEEGDRSGA	22	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=4603	16.287	4	2653.2229	2653.2229	S	R	578	604
PSM	KKFEQSHLHMSSETQANNELTTNGHGPPAS	23	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=6842	19.854	4	3276.5218	3276.5218	S	K	47	77
PSM	RDACIIEKGEEHCGHLIEAH	24	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7100	20.306	4	2373.0954	2373.0954	A	K	33	53
PSM	RGYLGPPHQGPPMHHVPGHES	25	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	13-UNIMOD:35	ms_run[2]:scan=5328	17.364	4	2302.0814	2302.0814	P	R	327	348
PSM	RHGAVCHTGAPDATLHTVHPDSVSSSYSS	26	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	6-UNIMOD:4	ms_run[2]:scan=6750	19.685	4	3032.3795	3032.3795	P	R	499	528
PSM	RVKGHFGPINSVAFHPDG	27	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=8126	22.324	3	1933.9911	1933.9911	G	K	280	298
PSM	KKFQGIKHECQANGPEDLN	28	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	46	10-UNIMOD:4	ms_run[1]:scan=5727	18.0122030384	2	2212.072748	2212.069501	K	R	126	145
PSM	KKFEQSHLHMSSETQANNELTTNGHGPPAS	29	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=6852	19.875	4	3276.5218	3276.5218	S	K	47	77
PSM	KTNSHVKEELEHPGVEHF	30	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7198	20.475	3	2116.0338	2116.0338	M	K	550	568
PSM	RGHVAHLEDDEGDDDESKHSTL	31	sp|Q8IVH8-3|M4K3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=5485	17.589	4	2461.0742	2461.0742	Q	K	385	407
PSM	RHPYKMNLASEPQEVLHIGSAHN	32	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	6-UNIMOD:35	ms_run[2]:scan=7953	21.93	4	2643.2976	2643.2976	K	R	99	122
PSM	KKIFVGGIKEDTEEHHL	33	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=7489	21.0009999416	4	1979.045625	1979.047626	V	R	105	122
PSM	KLGIHSALLDEKKDQDSK	34	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=6837	19.8423409792	3	2024.092415	2024.090219	K	-	140	158
PSM	RKKVEEEDEEEEEEEEEEEEEEDE	35	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=6657	19.499970333866667	3	3083.201204	3082.190578	A	-	177	201
PSM	KRGGSGSHNWGTVKDELTESP	36	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	45		ms_run[1]:scan=7843	21.69638500106667	2	2241.080809	2241.077423	D	K	215	236
PSM	KCHAEHTPEEEIDHTGAKT	37	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	2-UNIMOD:4	ms_run[2]:scan=4746	16.49	4	2188.9807	2188.9807	Q	K	539	558
PSM	KHHVELDQQNGEVDGHTICQHCY	38	sp|Q7Z3K3-5|POGZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=7033	20.204	4	2803.2191	2803.2191	M	R	419	442
PSM	KKALAAAGYDVEKNNS	39	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=5595	17.769923395466666	2	1677.870713	1677.868599	L	R	66	82
PSM	REHGAFDAVKCTHWAEGG	40	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=7877	21.762	4	2026.9068	2026.9068	S	K	775	793
PSM	RIHHTVEEKEEVTMDTSEN	41	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	14-UNIMOD:35	ms_run[2]:scan=4560	16.212	3	2299.0387	2299.0387	E	R	761	780
PSM	KTHNEHLAGVLKDYSDITSSK	42	sp|P29084|T2EB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	43		ms_run[1]:scan=8364	22.86816269013333	4	2342.188351	2342.186639	F	-	271	292
PSM	KHGIGTDATHAEHIETIKA	43	sp|Q13472-3|TOP3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6249	18.825	4	2028.0389	2028.0389	E	R	434	453
PSM	KTVQGSGHQEHINIHKL	44	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5777	18.088	4	1925.0231	1925.0231	A	R	42	59
PSM	RGYLGPPHQGPPMHHVPGHES	45	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6106	18.599	3	2286.0865	2286.0865	P	R	327	348
PSM	RRKDPEGTPYINHPIGVA	46	sp|Q8N4P3|MESH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=7423	20.903417275200002	3	2019.066877	2019.065007	Q	R	23	41
PSM	KKYVLENHPGTNSNYQMHLLK	47	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42	17-UNIMOD:35	ms_run[1]:scan=6969	20.085041465333333	4	2529.283077	2529.279828	L	K	365	386
PSM	RKVKHLDGEEDGSSDQSQASGTTGG	48	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=3814	14.874723680266667	4	2545.168774	2545.164065	A	R	178	203
PSM	KKQQQEKEDAEHHPDEDVDESES	49	sp|Q9BZJ0|CRNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=3813	14.8735218032	4	2736.181309	2736.174690	W	-	826	849
PSM	KVYMGHGGKPWVSDFSHPHYLAG	50	sp|Q96KP4-2|CNDP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:35	ms_run[2]:scan=8389	22.919	4	2585.2274	2585.2274	F	R	291	314
PSM	RHPDSHQLFIGNLPHEVDKSEL	51	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=8786	23.988	5	2567.2881	2567.2881	V	K	335	357
PSM	KKRGFGFVTFDDHDPVD	52	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=8895	24.374433983466666	3	1978.953824	1978.953726	G	K	151	168
PSM	RRAEPHTPSSHDAEEDEPLKES	53	sp|Q8NB46|ANR52_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=5257	17.242327252	4	2516.157988	2516.152772	Y	R	503	525
PSM	KRGGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTEN	54	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=8689	23.635330542400002	6	4701.111525	4701.108743	D	K	215	258
PSM	KELQQELQEYEVVTESEK	55	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=9194	25.712	3	2208.0798	2208.0798	E	R	318	336
PSM	KLQQHVDKLEHHSTQMQELFSSE	56	sp|Q9NS87-4|KIF15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	16-UNIMOD:35	ms_run[2]:scan=7365	20.777	4	2794.3344	2794.3344	L	R	742	765
PSM	KSKSEEAHAEDSVMDHHF	57	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	14-UNIMOD:35	ms_run[2]:scan=4677	16.384	4	2098.9014	2098.9014	H	R	312	330
PSM	KRHATAEEVEEEERD	58	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=4425	15.9793748784	3	1826.840443	1826.839484	A	R	31	46
PSM	KRIFHTVTTTDDPVIR	59	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=7316	20.687545822933334	3	1898.041850	1898.037396	I	K	221	237
PSM	KEHIVGYHEHDSLLDH	60	sp|P46100-2|ATRX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6793	19.768	4	1927.9177	1927.9177	H	K	2041	2057
PSM	KGHHVWVTKDELGDYL	61	sp|Q9H2W6|RM46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8874	24.288	3	1895.953	1895.9530	N	K	249	265
PSM	KTFHHVYSGKDLIAQA	62	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7574	21.17	3	1813.9475	1813.9475	A	R	147	163
PSM	RDRHGNLPYDVTSPALCDTHLHP	63	sp|Q9H9V9-2|JMJD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:4	ms_run[2]:scan=8524	23.205	4	2670.2721	2670.2721	L	R	266	289
PSM	RGCGPEKDHVYLQLHHLPPEQLAT	64	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4	ms_run[2]:scan=8329	22.798	4	2794.3973	2794.3973	G	R	210	234
PSM	RGKDHVVSDFSEHGSL	65	sp|P54886-2|P5CS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7252	20.591	3	1768.8493	1768.8493	L	K	763	779
PSM	RIHHTVEEKEEVTMDTSEN	66	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	14-UNIMOD:35	ms_run[2]:scan=4567	16.23	3	2299.0387	2299.0387	E	R	761	780
PSM	RSLCEQVSHHPPAAAHHAES	67	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	4-UNIMOD:4	ms_run[1]:scan=4641	16.337334881066667	4	2221.025484	2220.024282	Y	K	514	534
PSM	RGYLVAHPTLIDPKGHAPVEQQHITH	68	sp|Q5VU97|CAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=7825	21.657106058666667	4	2914.546063	2913.536194	D	K	844	870
PSM	RKSAHVTVSGGTPKGEAVLGTH	69	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=5572	17.729988421333335	4	2188.172355	2188.171263	A	K	303	325
PSM	RKPIDYTVLDDVGHGVKHGNNQPA	70	sp|Q8IZP0-2|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=8113	22.289651899733332	4	2629.337471	2629.336097	I	R	138	162
PSM	KRGFGFVTFDDHDPVD	71	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9087	25.245	3	1850.8588	1850.8588	K	K	140	156
PSM	REDLNYHDPTVKHSTFHGED	72	sp|Q13586-2|STIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=6248	18.823	4	2396.0782	2396.0782	L	K	93	113
PSM	RGYLGPPHQGPPMHHASGHDT	73	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	13-UNIMOD:35	ms_run[2]:scan=4659	16.36	4	2264.0294	2264.0294	P	R	352	373
PSM	KGIVDQSQQAYQEAFEISK	74	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=9199	25.7314208896	3	2168.054457	2168.074963	K	K	139	158
PSM	REEILANGGSLSHHHGVGKL	75	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7599	21.207227951466667	3	2111.087116	2110.103184	A	R	603	623
PSM	RKKLDESIYDVAFHSS	76	sp|Q13033|STRN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8697	23.663716131199998	3	1893.959928	1893.958477	H	K	765	781
PSM	KKGMWSEGNGSHTIRDL	77	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=7679	21.360668392533334	3	1914.939055	1914.937030	A	K	160	177
PSM	KKRGFAFVTFDDHDSVD	78	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=8789	23.998532305066664	3	1982.949919	1982.948640	G	K	144	161
PSM	RKDKELYTQNGILHMLD	79	sp|Q9NP77|SSU72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	15-UNIMOD:35	ms_run[1]:scan=8328	22.7961214792	3	2089.066497	2089.062625	L	R	70	87
PSM	RKPLTTSGFHHSEEGTSSSGSK	80	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=4209	15.462192722666666	4	2316.112694	2316.109451	E	R	560	582
PSM	KGIHHGPSVAQPIHLDSTQLSR	81	sp|Q8NBT2-2|SPC24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7473	20.975	4	2377.2615	2377.2615	V	K	115	137
PSM	KLFVGGIKEDTEEHHL	82	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7897	21.803	3	1850.9527	1850.9527	K	R	101	117
PSM	REEILANGGSLSHHHGVGKL	83	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7196	20.471	4	2110.1032	2110.1032	A	R	603	623
PSM	RHFHTQTQSLQQSVR	84	sp|O75319|DUS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=5282	17.279	3	1851.9452	1851.9452	P	K	298	313
PSM	RHLEHSTIIYEDPQHHPLL	85	sp|P61962|DCAF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=8193	22.479	4	2334.1869	2334.1869	L	R	207	226
PSM	RHYAHTDCPGHADYV	86	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	8-UNIMOD:4	ms_run[2]:scan=5099	17.014	3	1797.7642	1797.7642	A	K	120	135
PSM	RKHEAFESDLAAHQD	87	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6049	18.511	3	1752.818	1752.8180	I	R	235	250
PSM	RKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQ	88	sp|Q6NTF9-3|RHBD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:4	ms_run[2]:scan=6695	19.575	5	3715.8026	3715.8026	S	K	104	138
PSM	RSHEVKAEGYEVAHGG	89	sp|P53041|PPP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=4858	16.656	3	1724.823	1724.8230	I	R	425	441
PSM	KKRGFAFVTFDDHDTVD	90	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8806	24.041517443733333	3	1996.965521	1996.964290	G	K	165	182
PSM	KKFYPLEIDYGQDEEAVK	91	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=8910	24.442577510933333	3	2171.081291	2171.078651	P	K	636	654
PSM	KAHQDIHTQLQDVKQQH	92	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5267	17.254	4	2053.0453	2053.0453	R	K	187	204
PSM	KGRINATSHVIQHPMYGAGH	93	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:35	ms_run[2]:scan=5412	17.474	4	2189.0912	2189.0912	Y	K	3834	3854
PSM	KHLNEIDLFHCIDPNDSKH	94	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4	ms_run[2]:scan=8812	24.058	4	2331.1066	2331.1066	F	K	48	67
PSM	RATFGNMNNAVRPVFAHLDHH	95	sp|Q14156-3|EFR3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:35	ms_run[2]:scan=8107	22.27	4	2419.1716	2419.1716	G	K	244	265
PSM	RDKGIFLHLSNQHEFG	96	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8598	23.376	3	1896.9595	1896.9595	F	R	498	514
PSM	REGQHYPERHGGPE	97	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3735	14.796	3	1647.7502	1647.7502	E	R	706	720
PSM	RRGDNDSHQGDLEPILEASVLSSHH	98	sp|Q86V24|PAQR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9020	24.938	5	2768.3226	2768.3226	T	K	31	56
PSM	RTMHGHDHNVSSVAIMPNGDHIVSAS	99	sp|P43034-2|LIS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=6819	19.815	4	2800.2769	2800.2769	I	R	96	122
PSM	RKKAVDQHNAEAQDIFG	100	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7044	20.2170405192	3	1925.973594	1925.970773	D	K	519	536
PSM	RKLEEKEHLLQSNIGTGE	101	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=7236	20.544150896799998	3	2080.093772	2080.091282	V	K	803	821
PSM	KAHQSYCHSNKHQSSNLNVPELNSINMS	102	sp|Q96S59-2|RANB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4,27-UNIMOD:35	ms_run[2]:scan=7616	21.237	4	3239.4836	3239.4836	N	R	180	208
PSM	KLFVGGIKEDTEEHHL	103	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8070	22.182	4	1850.9527	1850.9527	K	R	101	117
PSM	KPLTHSLSDKSHAHPGCL	104	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:4	ms_run[2]:scan=5543	17.686	4	1983.9949	1983.9949	F	K	502	520
PSM	KSKSEEAHAEDSVMDHHF	105	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:35	ms_run[2]:scan=5019	16.907	4	2098.9014	2098.9014	H	R	312	330
PSM	KSKSEEAHAEDSVMDHHF	106	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6087	18.569	4	2082.9065	2082.9065	H	R	312	330
PSM	RCRDDSFFGETSHNYH	107	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=7324	20.707	4	2026.834	2026.8340	E	K	229	245
PSM	RHHHENFVGYQDDNLFQDEM	108	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	20-UNIMOD:35	ms_run[2]:scan=8693	23.651	4	2546.0669	2546.0669	A	R	3400	3420
PSM	RKDLYANTVLSGGTTMYPGIAD	109	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	16-UNIMOD:35	ms_run[2]:scan=9051	25.079	3	2358.1526	2358.1526	I	R	290	312
PSM	RNIKSHLGNVHDQDN	110	sp|Q8WW12-3|PCNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4191	15.414	3	1745.8557	1745.8557	E	-	41	56
PSM	RSLCEQVSHHPPAAAHHAES	111	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:4	ms_run[2]:scan=4606	16.292	3	2220.0243	2220.0243	Y	K	514	534
PSM	RHESGASIKIDEPLEGSED	112	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7889	21.7825386112	3	2068.977293	2067.970892	I	R	414	433
PSM	KKLKDYAFVHFED	113	sp|O43390|HNRPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=8534	23.224622979733333	3	1638.843107	1638.840593	V	R	371	384
PSM	KKIRGIVEESVTGVH	114	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7103	20.309231822933334	3	1650.944998	1650.941704	F	R	246	261
PSM	KKALAAAGYDVEKNNS	115	sp|Q02539|H11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=5587	17.746190178933333	3	1677.869798	1677.868599	L	R	66	82
PSM	KKYYLHDDREGEGSD	116	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=4697	16.422988757066665	3	1810.813636	1810.812206	S	K	878	893
PSM	RKKIQEWIPPSTPYK	117	sp|Q9UI09|NDUAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=7814	21.638416648266666	3	1870.050361	1870.046504	T	-	131	146
PSM	KKHFTILDAPGH	118	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7171	20.422	2	1362.7408	1362.7408	E	K	151	163
PSM	KMAVTFIGNSTAIQELFK	119	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=9981	29.007	3	2013.0605	2013.0605	L	R	362	380
PSM	KRHEMPPHIYAITDTAY	120	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8257	22.633	3	2042.0044	2042.0044	K	R	6	23
PSM	KRVHNNIVYNEYISH	121	sp|O60870-2|KIN17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7331	20.719	3	1884.9595	1884.9595	T	R	87	102
PSM	KYVQKDGHHCCL	122	sp|Q13642-3|FHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4220	15.503	3	1543.7024	1543.7024	K	K	18	30
PSM	RGYLGPPHQGPPMHHASGHDT	123	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5279	17.274	4	2248.0345	2248.0345	P	R	352	373
PSM	RHESGASIKIDEPLEGSED	124	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7420	20.892	3	2067.9709	2067.9709	I	R	390	409
PSM	RHKVNEHEQDGNELQTTPEF	125	sp|Q96C57|CSTOS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7263	20.607	4	2407.1153	2407.1153	L	R	63	83
PSM	RHSQYHVDGSLEKD	126	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5066	16.975	3	1669.7808	1669.7808	I	R	104	118
PSM	RTHTGEKPYACSHCD	127	sp|P49711-2|CTCF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=3694	14.756	3	1817.7574	1817.7574	K	K	187	202
PSM	RVPTANVSVVDLTCRLE	128	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:4	ms_run[2]:scan=9285	26.084	3	1928.0149	1928.0149	F	K	192	209
PSM	RYHTSQSGDEMTSLSEYVS	129	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=8173	22.436	3	2191.9328	2191.9328	L	R	456	475
PSM	KKHGITELHPDVVSYVSHATQQ	130	sp|O00268|TAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=8421	22.986988992	4	2474.277324	2473.271371	G	R	887	909
PSM	RRMEELHNQEVQK	131	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=4241	15.561308736533334	3	1695.851549	1695.847486	L	R	324	337
PSM	KKAEVEGKDLPEHAVL	132	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7213	20.501038672533333	3	1761.964800	1761.962499	Q	K	619	635
PSM	RKRELDVEEAHAASTEE	133	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=5521	17.65891576933333	3	1968.951824	1968.950097	K	K	11	28
PSM	KKKWENPGLGAESHTDSL	134	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=7297	20.656258510133334	3	1996.001707	1996.001404	L	R	73	91
PSM	KDRVHHEPQLSD	135	sp|O43852-12|CALU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4094	15.248	2	1459.7168	1459.7168	K	K	25	37
PSM	KEWSQHINGASHSR	136	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4546	16.184	4	1635.7866	1635.7866	N	R	304	318
PSM	KHYEAVHDAGNDSGHGGESNLALK	137	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5491	17.595	4	2505.1633	2505.1633	F	R	58	82
PSM	KKEMITMLHYDLLHHPYEPSGN	138	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=8390	22.921	4	2684.2727	2684.2727	I	K	576	598
PSM	KKHLEINPDHPIVETL	139	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8362	22.864	3	1882.0312	1882.0312	A	R	623	639
PSM	KKHLEINPDHSIIETL	140	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8606	23.404	3	1886.0262	1886.0262	A	R	631	647
PSM	KKHLVSAGYVHVN	141	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5864	18.212	3	1450.8045	1450.8045	L	R	344	357
PSM	KSKSEEAHAEDSVMDHHF	142	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:35	ms_run[2]:scan=6997	20.128	2	2098.9014	2098.9014	H	R	312	330
PSM	KYHTVNGHNCEVR	143	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4	ms_run[2]:scan=3789	14.846	3	1612.7529	1612.7529	Q	K	166	179
PSM	RAHTFSHPPSSTK	144	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3833	14.901	3	1451.727	1451.7270	R	R	639	652
PSM	RGYLGPPHQGPPMHHVPGHES	145	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5991	18.43	4	2286.0865	2286.0865	P	R	327	348
PSM	RHHFLVGKDTSTTTI	146	sp|Q49AR2|CE022_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7235	20.541	3	1711.9006	1711.9006	G	R	111	126
PSM	RHYCYPHFTCAVDTENIR	147	sp|P63092-3|GNAS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8267	22.657	4	2338.0372	2338.0372	G	R	341	359
PSM	RKGHNGTIEFTSLDAH	148	sp|Q86Y07-4|VRK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7502	21.03	3	1781.8809	1781.8809	P	K	89	105
PSM	KKEFLHAQEEVK	149	sp|P43686|PRS6B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5133	17.068488389866665	3	1484.799863	1484.798728	L	R	69	81
PSM	RKHDSIKDDSEDL	150	sp|Q05513|KPCZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=5346	17.3869133904	2	1556.744692	1556.743064	S	K	219	232
PSM	RRMEELHNQEMQK	151	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	3-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=3529	14.594915131466667	3	1759.809794	1759.809387	L	R	547	560
PSM	KKSKAIIEEYLHLNDM	152	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	16-UNIMOD:35	ms_run[1]:scan=8917	24.463843992533334	3	1947.015745	1947.013549	E	K	1244	1260
PSM	KKNHVCQYYIYELQK	153	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	6-UNIMOD:4	ms_run[1]:scan=8066	22.174713053866665	3	2013.017967	2013.014218	R	R	318	333
PSM	KKRGAPPSSNIEDFHGLLP	154	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8858	24.226284973066665	3	2062.098625	2062.095973	E	K	268	287
PSM	RRGDFFYHSENPKYPEVGDL	155	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=8864	24.24574115653333	4	2425.146491	2425.145108	I	R	220	240
PSM	KRLRPEDSFMSVYPMQTEHHQTPLDYN	156	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=8301	22.731005489066668	4	3350.550394	3350.544846	P	R	1130	1157
PSM	KILLHHAANSVK	157	sp|P51649|SSDH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4400	15.938	2	1329.7881	1329.7881	G	R	290	302
PSM	KKISSIQSIVPALEIANAH	158	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9370	26.448	3	2018.1524	2018.1524	E	R	249	268
PSM	KKYHIDLDPHFNDILGQHS	159	sp|P19784|CSK22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9030	24.983	4	2276.1338	2276.1338	L	R	260	279
PSM	KSMTEAEQQQLIDDHFLFD	160	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35	ms_run[2]:scan=9659	27.66	3	2310.0474	2310.0474	L	K	177	196
PSM	KYHTINGHNCEVK	161	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:4	ms_run[2]:scan=3921	15.006	3	1598.7624	1598.7624	Q	K	165	178
PSM	RCRDDSFFGETSHNYH	162	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4	ms_run[2]:scan=7123	20.345	4	2026.834	2026.8340	E	K	229	245
PSM	REHFGTVKTHLTSL	163	sp|Q15631-2|TSN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7658	21.33	3	1624.8685	1624.8685	A	K	62	76
PSM	RHDGASSDGHLAHIF	164	sp|Q9UHQ1-4|NARF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7717	21.436	4	1618.7601	1618.7601	T	R	230	245
PSM	RHHGLEVVIKNDSN	165	sp|P22415-2|USF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6074	18.555	3	1616.8383	1616.8383	L	-	238	252
PSM	RHLYTKDIDIHEV	166	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7698	21.399	3	1637.8526	1637.8526	V	R	328	341
PSM	RHPHDIIDDINSGAVECPAS	167	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:4	ms_run[2]:scan=8744	23.817	3	2202.0124	2202.0124	G	-	113	133
PSM	RHYHQQIEMEKV	168	sp|O60279|SUSD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=4694	16.414	2	1612.778	1612.7780	A	-	618	630
PSM	RKAAHEALGQFCCALH	169	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7701	21.404	3	1867.8934	1867.8934	V	K	714	730
PSM	RLNFSHGTHEYHAETI	170	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7347	20.751	4	1910.9024	1910.9024	A	K	73	89
PSM	RLVIGDHKSTSHF	171	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6346	19.015	3	1495.7896	1495.7896	G	R	55	68
PSM	RVRESLTLPSHSLEHLGPPHGGGGGGGSNSSSGPPLGPSH	172	sp|Q5VT52-2|RPRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8308	22.751	5	3864.9004	3864.9004	S	R	1327	1367
PSM	RYHTSQSGDEMTSLSEYVS	173	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8873	24.282	3	2175.9379	2175.9379	L	R	456	475
PSM	KKDFDTALKHYD	174	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=6499	19.250528156266668	3	1479.735549	1479.735794	K	K	238	250
PSM	KRLYSLALHPNAFK	175	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8223	22.551579301333334	4	1656.947300	1656.946396	F	R	1061	1075
PSM	RKITIGQGNTEKGHY	176	sp|Q6UB35|C1TM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5169	17.11199017786667	3	1700.897050	1700.895817	L	R	585	600
PSM	RKVAHSDKPGSTSTASF	177	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=4542	16.1789068448	3	1774.895565	1774.896211	L	R	204	221
PSM	RKIIKDGEQHEDLNEVA	178	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=5917	18.297271889599998	3	1993.021504	1993.022868	A	K	589	606
PSM	RHLDTLTEHYDIPKVSWTK	179	sp|Q9Y421|FA32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=8737	23.797875371733333	5	2338.210253	2338.206980	N	-	94	113
PSM	KAFLASPEYVNLPINGNGKQ	180	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9220	25.813	3	2159.1375	2159.1375	L	-	191	211
PSM	KALAAAGYDVEKNNS	181	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6442	19.162	2	1549.7736	1549.7736	K	R	64	79
PSM	KGRILVGHALHNDL	182	sp|Q9GZR2-2|REXO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7222	20.521	3	1541.879	1541.8790	L	K	147	161
PSM	KHCHAAAATYILEAGKH	183	sp|Q9UBI1|COMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:4	ms_run[2]:scan=6932	20.015	4	1876.9366	1876.9366	L	R	60	77
PSM	KHKTGPNLHGLFG	184	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7806	21.623	2	1404.7626	1404.7626	G	R	26	39
PSM	KIGEEQSPEDAEDGPPELLFIHGGHTA	185	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9274	26.038	4	2872.3515	2872.3515	S	K	314	341
PSM	KKITIADCGQLE	186	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4	ms_run[2]:scan=7494	21.011	2	1374.7177	1374.7177	S	-	154	166
PSM	KRHEMPPHIYAISESAY	187	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=7858	21.73	3	2043.9836	2043.9836	K	R	146	163
PSM	KRHLEEIVHVEQG	188	sp|Q01433-3|AMPD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6717	19.614	3	1572.8372	1572.8372	M	R	320	333
PSM	RFPAEDEFPDLSAHNNHMA	189	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	18-UNIMOD:35	ms_run[2]:scan=8778	23.956	3	2212.9596	2212.9596	L	K	13	32
PSM	RHKDSMDELFSH	190	sp|Q9UPN3-5|MACF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7885	21.776	3	1500.678	1500.6780	I	R	4267	4279
PSM	RHKLLSAEFLEQHYD	191	sp|Q9Y376|CAB39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8674	23.585	3	1884.9482	1884.9482	T	R	194	209
PSM	RHSLHEEENNIFK	192	sp|Q96CB9-3|NSUN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6918	19.993	3	1651.8067	1651.8067	D	R	64	77
PSM	RHTEMIHNYMEHLE	193	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=7634	21.272	3	1854.8141	1854.8141	Q	R	162	176
PSM	RKHEAFESDLAAHQD	194	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5824	18.151	3	1752.818	1752.8180	I	R	235	250
PSM	RNVTLCGHLHHG	195	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=5033	16.926	3	1399.6891	1399.6891	I	K	95	107
PSM	RQLFHPEQLITGKEDAANNYA	196	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8906	24.422	4	2414.1979	2414.1979	Y	R	84	105
PSM	RSKFLQVHASSGH	197	sp|Q9BRX2|PELO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5208	17.167	4	1452.7586	1452.7586	N	K	237	250
PSM	RSSFSHYSGLKHED	198	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5366	17.419	4	1648.7594	1648.7594	D	K	201	215
PSM	RTALHHAAFSGHGEMV	199	sp|O15084|ANR28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:35	ms_run[2]:scan=5556	17.708	3	1735.8213	1735.8213	G	K	141	157
PSM	RKQHQSDVEALK	200	sp|Q9H2D6|TARA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=4000	15.113647289866666	3	1437.769826	1437.768825	L	R	2188	2200
PSM	KKFHTVSGSKCEI	201	sp|Q99729|ROAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:4	ms_run[1]:scan=4947	16.787040777333335	3	1519.781992	1519.781698	E	K	214	227
PSM	RKDGFLHETLLDR	202	sp|Q14331|FRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8323	22.7888738344	4	1598.853115	1598.852889	A	R	235	248
PSM	RRMEELHNQEVQK	203	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:35	ms_run[1]:scan=3745	14.804030302400001	3	1711.845015	1711.842401	L	R	324	337
PSM	RKNKESKDPADETEAD	204	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=3540	14.605829658133333	3	1831.857341	1831.854799	V	-	134	150
PSM	RRHEGFAAALGDGKEPEGIFS	205	sp|Q9BYC9|RM20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=8877	24.30082820746667	4	2243.109479	2243.108329	R	R	123	144
PSM	KKKMQAHIQDLEEQLDEEEGA	206	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:35	ms_run[1]:scan=8337	22.812429662133333	3	2484.184529	2484.180233	E	R	945	966
PSM	KGHYTEGAELVDSVLDVV	207	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10229	30.021	3	1929.9684	1929.9684	A	R	103	121
PSM	KHRPSDHSYSDSTEMV	208	sp|O15111|IKKA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:35	ms_run[2]:scan=4397	15.927	3	1890.8166	1890.8166	L	K	572	588
PSM	KKFGLIDHLHYS	209	sp|Q6NSI4-3|RADX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8226	22.558	3	1456.7827	1456.7827	E	R	366	378
PSM	KRHEMPPHIYAITDTAY	210	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=8050	22.141	3	2057.9993	2057.9993	K	R	6	23
PSM	KRHEMPPHIYAITDTAY	211	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8678	23.597	3	2042.0044	2042.0044	K	R	6	23
PSM	RFSHSGSYSQHMNH	212	sp|P37275-3|ZEB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=3818	14.881	3	1689.7066	1689.7066	K	R	901	915
PSM	RGKVSEGIDFVHHYG	213	sp|P18074|ERCC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7986	22.002	4	1699.8431	1699.8431	A	R	601	616
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	214	sp|P31942-6|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,26-UNIMOD:35	ms_run[2]:scan=7013	20.156	4	2574.0666	2574.0666	G	R	37	63
PSM	RHHLEALQSSK	215	sp|P49418-2|AMPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4258	15.597	2	1304.6949	1304.6949	A	R	149	160
PSM	RHLISSLQNHNHQL	216	sp|O75150-3|BRE1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6707	19.599	4	1695.8917	1695.8917	M	K	484	498
PSM	RHLQLAIRNDEELN	217	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7860	21.734	3	1719.9016	1719.9016	P	K	82	96
PSM	RIFHAGDCGMHH	218	sp|Q10469|MGAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=4225	15.524	3	1452.6139	1452.6139	P	K	371	383
PSM	RIKHQEELTELH	219	sp|Q676U5-3|A16L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5670	17.907	2	1531.8107	1531.8107	L	K	89	101
PSM	RLNFSHGTHEYHAETI	220	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6598	19.408	3	1910.9024	1910.9024	A	K	73	89
PSM	RPKQENHLHSLG	221	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4242	15.563	3	1414.7429	1414.7429	A	R	389	401
PSM	RVTKHSTVQHSYS	222	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3635	14.698	3	1528.7746	1528.7746	T	-	1106	1119
PSM	RNLHHELELGVVMGK	223	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	13-UNIMOD:35	ms_run[1]:scan=7428	20.910848491466666	4	1746.918836	1746.919923	T	R	66	81
PSM	RINHANHTGSNHTYL	224	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4822	16.600431030666666	3	1733.808472	1733.834613	L	K	423	438
PSM	RKDAHSTLLSK	225	sp|Q9BPW8|NIPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4203	15.445024270400001	2	1254.705317	1254.704434	P	K	55	66
PSM	KKKLLEAQSHF	226	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=5812	18.132452206133333	2	1327.762782	1327.761221	R	R	2076	2087
PSM	RKLIEVKFSHLS	227	sp|P30419|NMT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7985	22.000214219466667	3	1455.856626	1455.856184	P	R	304	316
PSM	KKSTLRDQINSDH	228	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=4481	16.075315921066668	3	1540.796203	1540.795768	T	R	29	42
PSM	RKTVTAMDVVYALK	229	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=9086	25.241128279733335	3	1593.892299	1593.891249	K	R	79	93
PSM	RKHNLCGESEKEQI	230	sp|P28161|GSTM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	6-UNIMOD:4	ms_run[1]:scan=4708	16.437488838666667	3	1728.853940	1726.842067	A	R	82	96
PSM	KRDAESIHQYLLQR	231	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7788	21.586483997333335	4	1755.937117	1755.938016	L	K	899	913
PSM	KKNVRDQFNSHIQLV	232	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8032	22.096471928533333	4	1824.996563	1824.995865	M	R	408	423
PSM	RKKTQEKDDDMLFAL	233	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:35	ms_run[1]:scan=8333	22.806088348266666	3	1852.937233	1852.935299	P	-	478	493
PSM	KKKYPYWPHQPIENL	234	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=8435	23.016645067733336	3	1940.032268	1940.030854	D	-	147	162
PSM	RRYELLFYPGDGSVEMHDVKNH	235	sp|Q9Y5B8|NDK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	16-UNIMOD:35	ms_run[1]:scan=8615	23.4278361352	4	2677.273566	2677.270720	L	R	22	44
PSM	KAHHAAGQSVRSG	236	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3286	14.301	3	1304.6698	1304.6698	A	R	381	394
PSM	KGKHYYEVSCHDQGLC	237	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=6007	18.458	4	1979.8618	1979.8618	M	R	2	18
PSM	KHLEINPDHSIIETL	238	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8944	24.589	3	1757.9312	1757.9312	K	R	632	647
PSM	KHQEFDNHINSYDHAH	239	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5555	17.706	4	1990.867	1990.8670	Q	K	69	85
PSM	KKAGLAHSLQHL	240	sp|Q9NPE2|NGRN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6083	18.565	3	1301.7568	1301.7568	L	R	142	154
PSM	KKHYYDGTIFH	241	sp|Q13356|PPIL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7165	20.412	3	1407.6935	1407.6935	C	R	312	323
PSM	KKLHSLQPHACF	242	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=6217	18.77	3	1464.766	1464.7660	E	R	4111	4123
PSM	KKTHETLSHAGQ	243	sp|Q16890-4|TPD53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3505	14.571	3	1335.6895	1335.6895	Y	K	68	80
PSM	KLHHCPGNHSWDSTISGSQ	244	sp|O43353-2|RIPK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4	ms_run[2]:scan=6326	18.981	3	2146.9603	2146.9603	M	R	247	266
PSM	KQEYDESGPSIVH	245	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6753	19.69	3	1487.6892	1487.6892	S	R	359	372
PSM	KQFHATHYHPSNA	246	sp|Q5JRX3-3|PREP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4131	15.307	3	1536.7222	1536.7222	L	R	219	232
PSM	KRGSNTTSHLHQAVA	247	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3885	14.952	3	1605.8336	1605.8336	V	K	300	315
PSM	KRGSNTTSHLHQAVA	248	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3895	14.967	3	1605.8336	1605.8336	V	K	300	315
PSM	KRLHNTIVEINNH	249	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5791	18.105	3	1586.8641	1586.8641	V	K	885	898
PSM	KSDALETLGFLNHYQM	250	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:35	ms_run[2]:scan=9646	27.61	3	1881.8931	1881.8931	S	K	419	435
PSM	KTHHNDTELIR	251	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4403	15.944	3	1362.7004	1362.7004	I	K	290	301
PSM	KYHTINGHNAEVR	252	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4053	15.172	4	1537.775	1537.7750	Q	K	161	174
PSM	RAHGELHEQFK	253	sp|Q96N67-4|DOCK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4476	16.067	3	1350.6793	1350.6793	G	R	1910	1921
PSM	RCHTTHSMALIHN	254	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=4042	15.156	3	1592.73	1592.7300	G	R	330	343
PSM	RCHTTHSMALIHN	255	sp|P33991|MCM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4	ms_run[2]:scan=5299	17.308	4	1576.7351	1576.7351	G	R	330	343
PSM	RDHFGFNPEKPWGH	256	sp|Q9UPN6|SCAF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8496	23.148	4	1722.8015	1722.8015	R	R	1082	1096
PSM	RDLLHNEDRHDDYFQE	257	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7973	21.974	4	2100.9249	2100.9249	H	R	430	446
PSM	RGFGFVTFDDHDPVD	258	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9532	27.126	3	1722.7638	1722.7638	K	K	141	156
PSM	RHDPHKLLEGCLVGG	259	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4	ms_run[2]:scan=8026	22.088	3	1686.8624	1686.8624	L	R	123	138
PSM	RHHVLQTAHPSPLSVY	260	sp|P13051-2|UNG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7703	21.407	4	1840.9696	1840.9696	K	R	260	276
PSM	RHKDSMDELFSH	261	sp|Q9UPN3-5|MACF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35	ms_run[2]:scan=5895	18.269	3	1516.6729	1516.6729	I	R	4267	4279
PSM	RHLSNTHTNHED	262	sp|Q7LBC6-3|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3371	14.392	3	1459.6553	1459.6553	F	K	719	731
PSM	RHVHADSTDFLAVK	263	sp|O94761|RECQ4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7291	20.643	4	1594.8216	1594.8216	R	R	830	844
PSM	RINHANHTGSNHTYL	264	sp|Q9Y2U8|MAN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4869	16.674	3	1733.8346	1733.8346	L	K	423	438
PSM	RKHEILEASHMIQT	265	sp|Q8WXW3|PIBF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=6054	18.518	3	1707.8726	1707.8726	R	K	283	297
PSM	RPDNFVFGQSGAGNNWA	266	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9470	26.866	2	1835.8339	1835.8339	F	K	86	103
PSM	RPKQENHLHSLG	267	sp|Q96JN0-3|LCOR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4252	15.588	3	1414.7429	1414.7429	A	R	389	401
PSM	RTHVDSHGHNVF	268	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4936	16.771	3	1404.6647	1404.6647	L	K	204	216
PSM	RVAPEEHPVLLTEAPLNPKAN	269	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8551	23.265	4	2294.2383	2294.2383	L	R	95	116
PSM	RHFHTQTQSLQQSVR	270	sp|O75319|DUS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=5270	17.2591788712	3	1851.945089	1851.945226	P	K	298	313
PSM	RTRDELEVIHLIEEH	271	sp|P10155|RO60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=9312	26.202855367466668	4	1887.980918	1887.980275	K	R	237	252
PSM	RKDKFPAITHL	272	sp|Q9Y2X0|MED16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7916	21.845367803200002	3	1324.762422	1324.761555	N	K	273	284
PSM	RKKQDPPVTHDL	273	sp|P25685|DNJB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=4643	16.3407910848	3	1432.779121	1432.778662	A	R	157	169
PSM	KKHSSGCAFLSVK	274	sp|O15392|BIRC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:4	ms_run[1]:scan=5994	18.437479330933336	3	1447.760537	1447.760569	H	K	78	91
PSM	KKHKDVAEEIANY	275	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7303	20.672712768	3	1543.799894	1543.799457	V	R	784	797
PSM	RKLNHQEVVEEDK	276	sp|O95926|SYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=3951	15.054620460533332	3	1622.836928	1622.837633	A	R	48	61
PSM	KKRNLLYVADSYNH	277	sp|Q8NBF2|NHLC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7587	21.191803094133334	3	1719.911428	1719.905653	D	K	484	498
PSM	RKPRAEDQTESSCESH	278	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4	ms_run[1]:scan=3408	14.434953629333334	3	1915.844247	1915.844252	R	R	167	183
PSM	RKHESDSSSIEDPGQAYVLDVLHK	279	sp|Q12923-3|PTN13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8926	24.503045712533332	4	2709.335527	2709.335822	R	R	1037	1061
PSM	RRQNVAYEYLCHLEEAK	280	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:4	ms_run[1]:scan=8978	24.738546163466665	4	2178.065519	2178.064021	R	R	35	52
PSM	KARDPHSGHFVAL	281	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6523	19.286	3	1433.7528	1433.7528	Y	K	22	35
PSM	KHDNLLHGTK	282	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3977	15.089	3	1161.6255	1161.6255	E	K	547	557
PSM	KHHHVTLEASQ	283	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4018	15.131	2	1285.6527	1285.6527	L	K	2871	2882
PSM	KHLYLAEEERH	284	sp|Q9P031|TAP26_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5332	17.368	3	1423.7208	1423.7208	L	R	94	105
PSM	KSTFVLDEFK	285	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8949	24.614	2	1212.639	1212.6390	P	R	285	295
PSM	KTVETRDGQVINETSQHHDDLE	286	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6254	18.832	4	2550.1946	2550.1946	I	-	445	467
PSM	RAHHMHLSPMEAILVS	287	sp|Q96T17-2|MA7D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=7409	20.86	3	1859.9135	1859.9135	D	R	198	214
PSM	RALQHSYLHKDEGNPE	288	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4938	16.773	4	1892.9129	1892.9129	F	-	288	304
PSM	RDHFGFNPEKPWGH	289	sp|Q9UPN6|SCAF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8501	23.157	3	1722.8015	1722.8015	R	R	1082	1096
PSM	RDKQWLEHVQQEDEHQ	290	sp|Q15811-13|ITSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7138	20.37	3	2103.9722	2103.9722	E	R	656	672
PSM	REQSLHSFHTLFCR	291	sp|Q15910-3|EZH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:4	ms_run[2]:scan=8402	22.951	4	1816.8791	1816.8791	Q	R	235	249
PSM	REREHHAEAAQFQEDVNADPEVQ	292	sp|Q7Z6J9|SEN54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7298	20.658	4	2704.2226	2704.2226	R	R	351	374
PSM	RKHFGAGGNQ	293	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3660	14.725	2	1070.537	1070.5370	A	R	514	524
PSM	RKLHAVVETLVNH	294	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7503	21.031	3	1514.8681	1514.8681	L	R	259	272
PSM	RLAQHITYVHQHS	295	sp|P33993-3|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5273	17.265	4	1588.8223	1588.8223	L	R	356	369
PSM	RPGIHHSLFGDVK	296	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7219	20.515	4	1461.7841	1461.7841	L	K	383	396
PSM	RREPEEHQVEEEH	297	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3721	14.781	3	1702.7659	1702.7659	E	R	327	340
PSM	RSISLYYTGEKGQNQDY	298	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8391	22.923	3	2020.949	2020.9490	G	R	457	474
PSM	RTTGIVMDSGDGVTHTVPIYEGYALPHAIL	299	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=9715	27.887	4	3198.6019	3198.6019	G	R	147	177
PSM	RVAPEEHPVLLTEAPLNP	300	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9035	25.007	3	1981.0633	1981.0633	L	K	95	113
PSM	RYSHVSQHSPSK	301	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3461	14.524	3	1411.6957	1411.6957	A	K	1352	1364
PSM	RVAPEEHPVLLTEATLNPKAN	302	sp|A5A3E0|POTEF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8551	23.264910037333333	4	2298.232789	2298.233195	L	R	795	816
PSM	RNLFIGHFHTPKNQ	303	sp|Q15643|TRIPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7828	21.66384826133333	4	1708.900340	1707.895757	M	R	1785	1799
PSM	RKIDGLLNEHK	304	sp|Q9ULL5|PRR12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5899	18.274567937333334	3	1321.746295	1321.746633	M	K	1883	1894
PSM	KRLEEKHEALL	305	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5755	18.049792369600002	2	1364.778487	1364.777599	M	K	400	411
PSM	RKTVKDEAHQAQ	306	sp|Q13362|2A5G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=3429	14.4707201256	2	1410.723696	1409.737525	L	K	472	484
PSM	RKEKEQQLLHD	307	sp|Q8TF01|PNISR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4547	16.185519487733334	3	1422.757643	1422.757926	W	K	428	439
PSM	RKKQDPPVTHDL	308	sp|P25685|DNJB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4617	16.3047913624	3	1432.779121	1432.778662	A	R	157	169
PSM	KRKGEIAASIATHM	309	sp|O75880|SCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:35	ms_run[1]:scan=5132	17.067669753333334	3	1527.813293	1527.819147	N	R	281	295
PSM	RKEHQQELEILK	310	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6637	19.468872558133334	3	1549.857980	1549.857640	L	K	1957	1969
PSM	RKDDEVQVVRGHY	311	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=5884	18.250920292533333	4	1599.811657	1599.811753	I	K	50	63
PSM	RKTVTAMDVVYALK	312	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:35	ms_run[1]:scan=8509	23.176054416533336	3	1609.886723	1609.886164	K	R	79	93
PSM	KKLKDYAFIHFDE	313	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8784	23.983234507733336	3	1652.857220	1652.856243	V	R	368	381
PSM	KKNKGDSHLNVQVSNF	314	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7337	20.7357643568	3	1813.943313	1813.943495	S	K	245	261
PSM	KHAVSEGTKAVTKYTSSK	315	sp|Q96A08|H2B1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4738	16.478800635466666	3	1921.027115	1921.026891	A	-	110	128
PSM	RRKGPQHPPPPSGPEEPGE	316	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=4593	16.2669854112	3	2048.021522	2048.018785	P	K	37	56
PSM	RRKEGTSVLEHTSDGFPEN	317	sp|Q8TED0|UTP15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6998	20.133749491466666	3	2158.044655	2158.040309	M	K	495	514
PSM	RRKTSDANETEDHLESLIC	318	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	19-UNIMOD:4	ms_run[1]:scan=8488	23.130300630933334	4	2273.071255	2273.070623	K	K	18	37
PSM	KKYEDICPSTHNMDVPNIK	319	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=7031	20.20169071626667	4	2304.088896	2304.087853	G	R	67	86
PSM	RKPVKHTAMVSWGGVSIPNSPF	320	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:35	ms_run[1]:scan=9141	25.486018328	4	2410.261007	2410.257970	P	R	738	760
PSM	RKIDTHPSPSHSSTVKDSLIEL	321	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=7993	22.019533116266665	5	2446.281812	2446.281602	R	K	1410	1432
PSM	RKDKELYTQNGILHMLD	322	sp|Q9NP77|SSU72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8989	24.787337521866668	3	2073.068418	2073.067710	L	R	70	87
PSM	KKRILDEIEEHNI	323	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=8397	22.9374436736	2	1635.897274	1635.894420	L	K	196	209
PSM	KAMGIMNSFVNDIFE	324	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=9963	28.934	2	1746.7957	1746.7957	S	R	58	73
PSM	KEHFAQFGHVR	325	sp|Q9GZT3-2|SLIRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6071	18.551	3	1354.6895	1354.6895	L	R	36	47
PSM	KIGEEQSAEDAEDGPPELLFIHGGHTA	326	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9255	25.96	4	2846.3359	2846.3359	S	K	348	375
PSM	KIQKHQEHIL	327	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4722	16.455	2	1272.7303	1272.7303	T	R	255	265
PSM	KKGHHTETVFN	328	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4389	15.905	2	1296.6575	1296.6575	G	R	2114	2125
PSM	KKSHHANSPTAGAA	329	sp|Q15555-2|MARE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3365	14.388	3	1375.6957	1375.6957	P	K	193	207
PSM	KNRFWHDTCF	330	sp|Q13642-3|FHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:4	ms_run[2]:scan=8285	22.695	2	1409.6299	1409.6299	Y	R	57	67
PSM	KQVHPDTGISS	331	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4304	15.716	2	1167.5884	1167.5884	L	K	47	58
PSM	KRHEMPPHIYAISESAY	332	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8100	22.255	3	2027.9887	2027.9887	K	R	146	163
PSM	KVHLVGIDIFTGK	333	sp|Q6IS14|IF5AL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9213	25.787	3	1425.8344	1425.8344	A	K	55	68
PSM	RAHLVQHQSIHT	334	sp|Q8N720|ZN655_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4527	16.147	2	1425.7589	1425.7589	Q	K	476	488
PSM	RALHHGIDLEKI	335	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7586	21.191	3	1400.7888	1400.7888	E	K	341	353
PSM	RCRDPHHDYCEDWPEAQ	336	sp|O43402|EMC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7237	20.55	3	2269.9018	2269.9018	W	R	152	169
PSM	RERHPGSFDVVHV	337	sp|P22090|RS4Y1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7456	20.95	3	1533.7801	1533.7801	N	K	198	211
PSM	RERPAYAVHGNMLHYV	338	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:35	ms_run[2]:scan=7266	20.61	4	1927.9475	1927.9475	E	K	321	337
PSM	RFSHSGSYSSHISSK	339	sp|P37275-3|ZEB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4599	16.284	4	1665.7859	1665.7859	K	K	209	224
PSM	RGYLGPPHQGPPMHHVPGHES	340	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6053	18.517	5	2286.0865	2286.0865	P	R	327	348
PSM	RHGGPHCNVFVEHEALQ	341	sp|P00519-2|ABL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4	ms_run[2]:scan=7062	20.242	4	1985.9279	1985.9279	S	R	33	50
PSM	RIASHSHVKGLGLDESGLA	342	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7651	21.314	4	1946.0334	1946.0334	Q	K	14	33
PSM	RIHAVKDHGLQAP	343	sp|P56270-2|MAZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5469	17.57	3	1440.795	1440.7950	L	R	435	448
PSM	RIPPHHPHTS	344	sp|Q92530|PSMF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3435	14.492	2	1177.6105	1177.6105	L	R	170	180
PSM	RIVGWYHTGPKLH	345	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7664	21.342	4	1562.847	1562.8470	E	K	90	103
PSM	RLNFSHGTHEYHAETI	346	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7470	20.971	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	347	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8996	24.822	4	1910.9024	1910.9024	A	K	73	89
PSM	RQAFHSHPGTHCPSPAVKDPNTQSVGNPQ	348	sp|O75616|ERAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=5446	17.517	4	3150.4802	3150.4802	M	R	267	296
PSM	RQATKDAGTIAGLNVL	349	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9019	24.928	3	1626.9053	1626.9053	Q	R	155	171
PSM	RQKHQEYLNSILQHA	350	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8392	22.925	4	1863.9704	1863.9704	R	K	445	460
PSM	RVINEPTAAALAYGLDKSED	351	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9158	25.558	3	2132.075	2132.0750	L	K	218	238
PSM	RTLTIVDTGIGMT	352	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	12-UNIMOD:35	ms_run[1]:scan=9003	24.849835007466666	2	1392.728782	1392.728266	D	K	27	40
PSM	KSKSEEAHAEDSVMDHHF	353	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5645	17.860837314399998	4	2083.889708	2082.906517	H	R	327	345
PSM	RGMGGHGYGGAGDASSGFHGGHFVHM	354	sp|P31942|HNRH3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=6769	19.73065415893333	5	2576.068964	2574.066558	G	R	174	200
PSM	RKHFTILDAPGH	355	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7329	20.715120718666665	3	1390.747307	1390.746968	E	K	280	292
PSM	RHESGASIKIDEPLEGSED	356	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7917	21.847659140799998	3	2068.977293	2067.970892	I	R	414	433
PSM	KHLHDNWILH	357	sp|Q9UQ88|CD11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7490	21.00328577226667	3	1312.686340	1311.683639	V	R	539	549
PSM	RAHLQTHSDVK	358	sp|O95863|SNAI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3644	14.707245621333334	3	1291.688805	1290.679282	L	K	224	235
PSM	RKASDVHEVR	359	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=3515	14.581923775466667	3	1195.643050	1195.642168	I	K	246	256
PSM	KKVHVIFNYKG	360	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6846	19.8632825944	2	1331.772677	1331.771391	T	K	142	153
PSM	KRLEIEHSVPK	361	sp|Q9NZI8|IF2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5336	17.372451021333333	2	1334.767690	1334.767034	G	K	66	77
PSM	RKKAALCAVHVI	362	sp|O43747|AP1G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:4	ms_run[1]:scan=6871	19.914907122666666	3	1364.806729	1364.807460	L	R	154	166
PSM	RKTLTADKLEHL	363	sp|Q9UPZ3|HPS5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7071	20.252069509600002	4	1423.816533	1423.814713	A	K	390	402
PSM	RKTLVLLGAHGVGR	364	sp|O14936|CSKP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7460	20.956167145333332	4	1475.904644	1475.904865	K	R	739	753
PSM	RRVREEEIEVDS	365	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5803	18.119369148266667	2	1515.766895	1515.764134	F	R	626	638
PSM	RRLAISEDHVASVK	366	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=5952	18.358140269066666	4	1579.878654	1579.879438	L	K	50	64
PSM	RRGDQGPKTIDQIH	367	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4946	16.7847527464	4	1619.848756	1619.849201	P	K	993	1007
PSM	KRLYSLALHPNAFK	368	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8215	22.532944208533333	3	1656.947714	1656.946396	F	R	1061	1075
PSM	RKASAHSIVECDPVR	369	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:4	ms_run[1]:scan=5569	17.7269675296	3	1723.879145	1723.878787	E	K	33	48
PSM	RRGEEGHDPKEPEQL	370	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4795	16.561045984	4	1775.854481	1775.855074	R	R	20	35
PSM	RRCTVDGSPHELESR	371	sp|Q9NRL3|STRN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:4	ms_run[1]:scan=4777	16.5355546208	4	1797.856353	1797.854029	P	R	335	350
PSM	RRPLILQLVHVSQEDK	372	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8935	24.546487030933335	4	1930.111883	1930.111229	T	R	60	76
PSM	KKGMWSEGNGSHTIRDL	373	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:35	ms_run[1]:scan=7088	20.2824569792	4	1930.935278	1930.931945	A	K	160	177
PSM	KRKHEDDEPVFEQIENTANPS	374	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=8724	23.755679767733334	4	2482.174785	2482.172445	G	R	1280	1301
PSM	KAHVLHFGKY	375	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6906	19.972	3	1198.6611	1198.6611	T	R	93	103
PSM	KEKLEATINELV	376	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9072	25.174	2	1385.7766	1385.7766	N	-	74	86
PSM	KHFHNTLEHL	377	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5972	18.397	3	1274.652	1274.6520	N	R	768	778
PSM	KHSLFIRHPEM	378	sp|O75629|CREG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=5581	17.74	3	1409.7238	1409.7238	A	K	168	179
PSM	KHWDHLTQVK	379	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5487	17.591	3	1290.6833	1290.6833	L	K	118	128
PSM	KIAQGAANGINFLHENHHIH	380	sp|Q9NWZ3-2|IRAK4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7923	21.859	4	2220.1301	2220.1301	C	R	166	186
PSM	KKAHVTHPEL	381	sp|O95478|NSA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4515	16.127	2	1158.6509	1158.6509	F	K	179	189
PSM	KKHFFINICH	382	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4	ms_run[2]:scan=7882	21.769	3	1342.6968	1342.6968	E	R	511	521
PSM	KLHTNFHIPK	383	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7037	20.21	3	1233.6982	1233.6982	N	K	377	387
PSM	KLRFPAEDEFPDLSAHNNHMA	384	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:35	ms_run[2]:scan=8854	24.21	4	2454.1386	2454.1386	L	K	11	32
PSM	KPRTVATPLNQVANPNSAIFGGA	385	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9144	25.499	3	2322.2444	2322.2444	L	R	194	217
PSM	KRADHLEELLEQH	386	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8339	22.816	3	1616.8271	1616.8271	V	R	1024	1037
PSM	KSKSEEAHAEDSVMDHHF	387	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6947	20.045	5	2082.9065	2082.9065	H	R	312	330
PSM	KSPDDPSRYISPDQLADLY	388	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9681	27.753	3	2179.0433	2179.0433	F	K	169	188
PSM	KTVRDTLLALHQHGHSGPFES	389	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8495	23.147	4	2329.1927	2329.1927	P	K	303	324
PSM	KYHTINGHNAEV	390	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5037	16.93	3	1381.6739	1381.6739	Q	R	161	173
PSM	KYIKHEQEELH	391	sp|Q9UPY3-2|DICER_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4004	15.117	3	1452.7361	1452.7361	Q	R	331	342
PSM	RAFNQHGHLIQHQ	392	sp|P15622-2|ZN250_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4949	16.789	4	1584.8022	1584.8022	G	K	425	438
PSM	RCRDDSFFGETSHNYH	393	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4	ms_run[2]:scan=7298	20.658	3	2026.834	2026.8340	E	K	229	245
PSM	RDCHHLGIQNNFDYK	394	sp|Q9Y3Z3-4|SAMH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=7527	21.072	4	1915.8748	1915.8748	A	R	318	333
PSM	RDEHFDFIQSHIR	395	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8502	23.158	4	1698.8227	1698.8227	Y	K	260	273
PSM	RDHIKDSFHSL	396	sp|P61244-6|MAX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6924	20.002	3	1353.6789	1353.6789	R	R	36	47
PSM	RFDCHHCNESLFGK	397	sp|Q14192-2|FHL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7155	20.398	4	1805.7726	1805.7726	E	K	4	18
PSM	RGRHLVLLDTAQAAAAGH	398	sp|O00754-2|MA2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8330	22.801	4	1856.0129	1856.0129	V	R	838	856
PSM	RGYLVAHPTLIDPKGHAPVEQQHITH	399	sp|Q5VU97-2|CAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7812	21.636	5	2913.5362	2913.5362	D	K	548	574
PSM	RHHCPHTPILLVGT	400	sp|P60763|RAC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=7785	21.583	3	1636.862	1636.8620	V	K	102	116
PSM	RHHSLALTSFK	401	sp|Q9BSV6|SEN34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6923	20	3	1295.7099	1295.7099	S	R	77	88
PSM	RHREEVAALQSHIE	402	sp|Q96CN9|GCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6694	19.574	3	1673.8598	1673.8598	E	K	694	708
PSM	RHSSGQDKPHETY	403	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3706	14.768	3	1540.7019	1540.7019	G	R	600	613
PSM	RHVFIHTGEKPFQCSQCDM	404	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:4,17-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=7226	20.527	4	2392.0511	2392.0511	Q	R	188	207
PSM	RKAHQDIHTQLQDV	405	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6082	18.563	3	1687.8754	1687.8754	L	K	186	200
PSM	RKEPFFHGHDNYDQLV	406	sp|P68400-2|CSK21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8377	22.897	4	2000.9493	2000.9493	F	R	92	108
PSM	RKHFTILDAPGH	407	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7346	20.749	3	1390.747	1390.7470	E	K	280	292
PSM	RKILSHTEEH	408	sp|Q6Y1H2|HACD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3737	14.798	3	1248.6575	1248.6575	R	K	241	251
PSM	RKLFACEEHPSH	409	sp|Q9UL15|BAG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=5089	17.003	4	1509.7147	1509.7147	K	K	355	367
PSM	RLNFSHGTHEYHAETI	410	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8758	23.869	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	411	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9075	25.19	4	1910.9024	1910.9024	A	K	73	89
PSM	RNLHHELELGVVMGK	412	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8251	22.621	4	1730.925	1730.9250	T	R	66	81
PSM	RNMSGQVSMGPAFIHHHPPKS	413	sp|Q9NYJ8-2|TAB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5573	17.731	4	2346.111	2346.1110	S	R	420	441
PSM	RPHPHELVGKDC	414	sp|Q04206-2|TF65_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:4	ms_run[2]:scan=4177	15.389	4	1443.7041	1443.7041	H	R	71	83
PSM	RQDPHKAGLSHYV	415	sp|Q96BT3|CENPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5906	18.282	4	1506.7692	1506.7692	P	K	452	465
PSM	RRDHPLPEVAHV	416	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6659	19.506	3	1424.7637	1424.7637	D	K	41	53
PSM	RSKFLQVHASSGH	417	sp|Q9BRX2|PELO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5199	17.155	3	1452.7586	1452.7586	N	K	237	250
PSM	KSKSEEAHAEDSVMDHHF	418	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:35	ms_run[1]:scan=5065	16.972601505866667	5	2098.901045	2098.901432	H	R	327	345
PSM	KHHSGGEKPFQAQ	419	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3974	15.0845182352	2	1450.742422	1449.711310	V	K	33	46
PSM	RHPEVYHHLGVVPP	420	sp|O15381|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7276	20.6226962056	3	1635.864259	1635.863394	M	R	285	299
PSM	RGKHDGSHEGTVYF	421	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6291	18.902032796	3	1588.742539	1588.738253	E	K	46	60
PSM	KRPHVFESNPSIR	422	sp|Q16656|NRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5821	18.147391710399997	3	1565.844122	1565.842659	R	K	92	105
PSM	KKHLVQITIK	423	sp|Q9H2K0|IF3M_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6181	18.707729681866667	3	1206.780956	1206.781228	K	K	185	195
PSM	RKKTATAVAHC	424	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:4	ms_run[1]:scan=3378	14.399630958133335	3	1241.664910	1241.666275	G	K	15	26
PSM	RKDAHSNLLAK	425	sp|O75323|NIPS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4129	15.303131283733334	3	1251.705797	1251.704768	P	K	57	68
PSM	KKVHPAVVIRQ	426	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4611	16.29916846693333	3	1273.798209	1273.798275	R	R	74	85
PSM	KKKHLLIGVSSD	427	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6213	18.763879546400002	3	1323.787589	1323.787435	D	R	88	100
PSM	RKNPSDPKLAHL	428	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=5460	17.5534376256	3	1374.773367	1374.773182	F	K	512	524
PSM	RKLIHLEIKPAI	429	sp|Q02750|MP2K1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8385	22.9108144648	3	1429.913959	1429.913305	A	R	96	108
PSM	KRVSAVEEVRSHV	430	sp|Q9UJY4|GGA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7135	20.365370824000003	3	1494.830471	1494.826674	S	K	230	243
PSM	RRSASASHQADIKEA	431	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3746	14.806318072	3	1625.826396	1625.823380	A	R	95	110
PSM	KKRILDEIEEHNI	432	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8410	22.9698994808	3	1635.894927	1635.894420	L	K	196	209
PSM	KKHEAFETDFTVHKD	433	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6758	19.701729421066666	4	1830.890057	1830.890063	L	R	1910	1925
PSM	RRDSNLHSSTDKEQAE	434	sp|Q8IWC1|MA7D3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3530	14.5955984808	3	1871.874484	1871.872181	N	R	226	242
PSM	RRLDPNKYPVPENWLH	435	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8714	23.718584275733335	4	2033.061591	2033.059528	V	K	261	277
PSM	KKEVSMDDHKLSLDELH	436	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	6-UNIMOD:35	ms_run[1]:scan=7124	20.345731527999998	4	2039.004880	2038.999356	L	R	36	53
PSM	KKSAVADKHELLSLASSNHLG	437	sp|O15372|EIF3H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8256	22.630330860533334	4	2204.192796	2204.191330	E	K	220	241
PSM	KKFQGIKHECQANGPEDLN	438	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4	ms_run[1]:scan=5688	17.930618310133333	4	2212.069805	2212.069501	K	R	126	145
PSM	RKSEHLSVRPQTALEENETQ	439	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6642	19.474795500266666	3	2351.186297	2351.182950	S	K	149	169
PSM	KKHTEYLHSSSCVDSFGSPLGLDK	440	sp|Q9H582|ZN644_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4	ms_run[1]:scan=8327	22.794555078933335	4	2691.292697	2691.296266	L	R	602	626
PSM	RKRHYEDEEDDEEDAPGNDPQEAVPSAAG	441	sp|P19447|ERCC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=6583	19.384958758133333	4	3225.370415	3225.371886	S	K	15	44
PSM	RRPHKEEEEEAYYPPAPPPYSETDSQAS	442	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=7822	21.649408283466666	4	3259.473344	3259.469415	R	R	604	632
PSM	KKEEASSLNSLHLFSSSSNSHNNFISDPHKPDA	443	sp|Q9H582|ZN644_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8595	23.3689594008	5	3623.730175	3623.724067	F	K	762	795
PSM	KFHPDKNHAPGATDAF	444	sp|Q8TBM8-2|DJB14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6293	18.905	3	1751.838	1751.8380	L	K	49	65
PSM	KHLTDTSHGVRN	445	sp|Q96HW7-2|INT4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3573	14.638	3	1363.6957	1363.6957	C	K	157	169
PSM	KHRVQELGHGCAALVT	446	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4	ms_run[2]:scan=6338	19.004	3	1774.9261	1774.9261	I	K	1917	1933
PSM	KKYDAFLASESLI	447	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9432	26.706	2	1483.7922	1483.7922	A	K	105	118
PSM	KLKHYPSIHGDFSNDF	448	sp|Q9NV88-3|INT9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8319	22.778	3	1903.9217	1903.9217	N	R	348	364
PSM	KNSIRHNLSLHS	449	sp|P98177-2|FOXO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5241	17.215	3	1404.7586	1404.7586	W	K	96	108
PSM	KRNTLFGTFHVAHSSSLDDVDH	450	sp|Q13586-2|STIM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8484	23.121	4	2482.1989	2482.1989	K	K	386	408
PSM	KVAIIHQHLGR	451	sp|Q7Z569|BRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5429	17.495	3	1270.7622	1270.7622	E	R	56	67
PSM	RFHPKPSDLHLQTGY	452	sp|P24928-2|RPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7880	21.767	3	1794.9166	1794.9166	L	K	430	445
PSM	RGCGPEKDHVYLQLHHLPPEQLAT	453	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=8642	23.492	4	2794.3973	2794.3973	G	R	210	234
PSM	RHGGYKPSDEH	454	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3454	14.517	3	1281.585	1281.5850	D	K	96	107
PSM	RHHSVEIKIE	455	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5691	17.933	2	1246.6782	1246.6782	D	K	510	520
PSM	RHILEAPQHGLER	456	sp|Q9NVK5-3|FGOP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6051	18.514	4	1554.8379	1554.8379	S	R	150	163
PSM	RHQPVHYDSIKII	457	sp|O95620-2|DUS4L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7975	21.978	4	1604.8787	1604.8787	E	K	72	85
PSM	RHRFEVNPVW	458	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8587	23.348	2	1338.6945	1338.6945	H	K	248	258
PSM	RILHDWPDDKVH	459	sp|O95671-3|ASML_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7299	20.659	4	1529.7739	1529.7739	C	K	467	479
PSM	RIPPHHPHTS	460	sp|Q92530|PSMF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3983	15.095	3	1177.6105	1177.6105	L	R	170	180
PSM	RKLPCGHLFHNSCL	461	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7702	21.405	4	1737.8555	1737.8555	A	R	352	366
PSM	RKPTVTHVHY	462	sp|Q92604|LGAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4492	16.089	3	1236.6727	1236.6727	Y	R	275	285
PSM	RLHDVLHSDK	463	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4698	16.424	3	1218.6469	1218.6469	V	K	65	75
PSM	RLNFSHGTHEYHAETI	464	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6806	19.794	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	465	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9236	25.879	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	466	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9863	28.509	4	1910.9024	1910.9024	A	K	73	89
PSM	RNGHDPGRGHQDLDPDNEGEL	467	sp|Q9ULF5|S39AA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6442	19.162	3	2327.0275	2327.0275	E	R	285	306
PSM	RRDSSHNELYYEEAEHE	468	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6776	19.742	4	2162.9253	2162.9253	R	R	333	350
PSM	RRIPGSTEAFPHQH	469	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5735	18.029	4	1631.8281	1631.8281	Q	R	18	32
PSM	RSQAGHTLHHQES	470	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3427	14.468	3	1486.7025	1486.7025	Q	R	171	184
PSM	RYGRPPDSHHS	471	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3558	14.623	3	1307.6119	1307.6119	A	R	91	102
PSM	RLNFSHGTHEYHAETI	472	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9702	27.8350634208	4	1910.902633	1910.902359	A	K	73	89
PSM	RIHVDQMHQH	473	sp|Q9NWB7|IFT57_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=3696	14.7578974064	3	1315.618191	1315.620387	W	R	262	272
PSM	KKHHLQPENPGPGGAAPSLEQN	474	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=6124	18.6198948768	3	2306.1202	2305.1562	K	R	405	427
PSM	KKFQQHIQAQQK	475	sp|Q7L7X3|TAOK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3803	14.860915528266666	3	1510.838657	1510.836845	E	K	534	546
PSM	RRLGGGLGGTR	476	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4609	16.297222834933333	3	1098.636614	1098.637023	P	R	190	201
PSM	RKSLQAIKIH	477	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5449	17.522291874666667	3	1192.740634	1192.740426	D	R	377	387
PSM	KKHELLEEAR	478	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4751	16.495337988533333	3	1251.693168	1251.693535	Q	R	860	870
PSM	RKHSAELIAMEK	479	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:35	ms_run[1]:scan=4423	15.9768831496	3	1427.752781	1427.755484	P	R	955	967
PSM	RKLDRLAYIAHP	480	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7507	21.0369976112	4	1451.834263	1451.836117	S	K	91	103
PSM	KRPNPDILDHER	481	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5749	18.04263402586667	4	1488.779173	1488.779724	V	K	51	63
PSM	KKEKDVQFEHGY	482	sp|Q92544|TM9S4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5439	17.50915657146667	3	1506.743299	1506.746693	K	R	156	168
PSM	RKVNESIKYNHPL	483	sp|Q68DH5|LMBD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6058	18.52317253973333	4	1596.874333	1596.873625	V	R	252	265
PSM	KKHLVQITIK	484	sp|Q9H2K0|IF3M_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6152	18.667138362133336	3	1206.780956	1206.781228	K	K	185	195
PSM	RKEVQNQLVDREH	485	sp|Q8TCG1|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=4620	16.3094415472	4	1649.859394	1649.859766	Q	K	787	800
PSM	RRPTSGLHPEDFIK	486	sp|P38398|BRCA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7972	21.971745726133335	4	1651.879659	1651.879438	K	K	506	520
PSM	RRLSEQLAHTPTAFK	487	sp|Q9UBF8|PI4KB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7274	20.620858797333334	3	1753.962692	1753.958751	R	R	508	523
PSM	RKKTQEKDDDMLFAL	488	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:35	ms_run[1]:scan=8330	22.8008797864	4	1852.935858	1852.935299	P	-	478	493
PSM	KHSHMIAMIHSLSGG	489	sp|Q8TCG1|CIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:35	ms_run[1]:scan=6962	20.074843556266668	3	1621.791183	1620.786466	N	K	880	895
PSM	KKISSIQSIVPALEIANAHR	490	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9121	25.399800222133333	4	2174.256375	2174.253536	E	K	249	269
PSM	KDIGFIKLD	491	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9031	24.985	2	1047.5964	1047.5964	A	-	48	57
PSM	KDLFDPIIED	492	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9709	27.863	2	1203.6023	1203.6023	F	R	86	96
PSM	KDWPHAGRPAHEL	493	sp|Q9BSV6|SEN34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6086	18.568	3	1512.7586	1512.7586	S	R	207	220
PSM	KGHQFSCVCLHGDR	494	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5909	18.287	4	1699.7671	1699.7671	K	K	408	422
PSM	KHFYTFTNEHH	495	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6014	18.464	4	1459.6633	1459.6633	E	R	118	129
PSM	KHHCAAITPGRG	496	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=3760	14.819	3	1303.6568	1303.6568	I	R	1076	1088
PSM	KHHVIKVEPVIQ	497	sp|Q6UVY6-2|MOXD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6430	19.146	3	1425.8456	1425.8456	E	R	148	160
PSM	KHTGPGILSMANAGPNTNGSQFFICTA	498	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:35,25-UNIMOD:4	ms_run[2]:scan=9295	26.128	3	2806.3167	2806.3167	L	K	91	118
PSM	KKEMITMLHYDLLHHPYEPSGN	499	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=8704	23.685	4	2668.2778	2668.2778	I	K	576	598
PSM	KKGAVLHHLVN	500	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4900	16.723	2	1214.7248	1214.7248	M	K	720	731
PSM	KKQHICHIQGCG	501	sp|P08047-3|SP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=3836	14.906	3	1464.7078	1464.7078	K	K	575	587
PSM	KLKLHTFESH	502	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6017	18.468	3	1238.6772	1238.6772	L	K	306	316
PSM	KLKSTTESYVFHNHSNADFH	503	sp|Q92802|N42L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7090	20.286	4	2361.1138	2361.1138	K	R	25	45
PSM	KQSKDHAATTAGAASLAGGHH	504	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4187	15.408	4	2014.9933	2014.9933	L	R	215	236
PSM	KRFHWEQDQIAHM	505	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=7238	20.552	3	1740.8155	1740.8155	M	K	326	339
PSM	KRYQDIIHSIHLA	506	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8796	24.023	4	1592.8787	1592.8787	E	R	1019	1032
PSM	KTKHPQLHIES	507	sp|P48730-2|KC1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4913	16.738	3	1316.7201	1316.7201	V	K	43	54
PSM	KVGHSIRHPDVEVDGFSEL	508	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8621	23.446	4	2120.0651	2120.0651	W	R	59	78
PSM	REVPEYLHHVNK	509	sp|Q13620-3|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5679	17.919	3	1519.7896	1519.7896	E	R	212	224
PSM	RHHLQIPIHFP	510	sp|Q9Y2Q3-3|GSTK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8802	24.032	3	1393.7731	1393.7731	L	K	74	85
PSM	RHLAVMPHPERAV	511	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6526	19.288	4	1511.8143	1511.8143	G	R	1290	1303
PSM	RHMMYHLDGNSHF	512	sp|Q9H582-2|ZN644_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6606	19.418	4	1675.6984	1675.6984	H	R	427	440
PSM	RHPEVYHHLGVVPP	513	sp|O15381-3|NVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7233	20.539	3	1635.8634	1635.8634	M	R	88	102
PSM	RHTEMIHNYMEHLE	514	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8202	22.497	3	1838.8192	1838.8192	Q	R	162	176
PSM	RIHVDQMHQH	515	sp|Q9NWB7|IFT57_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=3715	14.777	3	1315.6204	1315.6204	W	R	262	272
PSM	RIQHALETIHHL	516	sp|Q8TDJ6-2|DMXL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7362	20.774	3	1466.8106	1466.8106	D	K	304	316
PSM	RKDNHHLFGSTLLGI	517	sp|Q9NUY8-2|TBC23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9179	25.648	3	1706.9216	1706.9216	F	K	291	306
PSM	RKHNNCMASHLTPAVYA	518	sp|P12532|KCRU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4	ms_run[2]:scan=7209	20.495	4	1968.9411	1968.9411	L	R	57	74
PSM	RLNFSHGTHEYHAETI	519	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7604	21.215	4	1910.9024	1910.9024	A	K	73	89
PSM	RLPKDHHFDMINI	520	sp|Q9P032|NDUF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:35	ms_run[2]:scan=8159	22.405	3	1650.83	1650.8300	F	K	94	107
PSM	RLVQKFNHSH	521	sp|Q9UNZ2-6|NSF1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4245	15.57	2	1264.6789	1264.6789	G	R	196	206
PSM	RNLHHELELGVVMGK	522	sp|Q6P587|FAHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=7435	20.923	4	1746.9199	1746.9199	T	R	66	81
PSM	RNPDDITNEEYGEFY	523	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9203	25.749	2	1860.7802	1860.7802	T	K	299	314
PSM	RNPDDITQEEYGEFY	524	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9240	25.896	2	1874.7959	1874.7959	T	K	291	306
PSM	RTDKSSASAPDVDDPEAFPALA	525	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9063	25.135	3	2259.0655	2259.0655	S	-	372	394
PSM	RVISKHDLGHFML	526	sp|P30043|BLVRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:35	ms_run[2]:scan=8344	22.824	4	1567.8293	1567.8293	S	R	174	187
PSM	RVMTFDDDIRVPFGHAHNHA	527	sp|Q6NXE6-2|ARMC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=8383	22.906	3	2350.1025	2350.1025	L	K	222	242
PSM	RWPDLHSHHEL	528	sp|P84022-2|SMAD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7850	21.713	3	1425.6902	1425.6902	W	R	49	60
PSM	RLNFSHGTHEYHAETI	529	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9460	26.822913677866666	4	1910.902633	1910.902359	A	K	73	89
PSM	KRPPSAFFLFCSEH	530	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:4	ms_run[1]:scan=9269	26.018221112	3	1722.839166	1721.834797	P	R	96	110
PSM	RWYNHIKSYE	531	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7467	20.966416897333332	3	1394.674026	1394.673134	L	K	54	64
PSM	RHDPDLHMHQGYD	532	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35	ms_run[1]:scan=4356	15.843052704533333	3	1635.685268	1635.684838	L	K	640	653
PSM	RWPDLHSHHEL	533	sp|Q15796|SMAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7872	21.755955672000002	3	1425.690302	1425.690181	W	K	133	144
PSM	RIVGWYHTGPKLH	534	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7643	21.2919107888	4	1562.846463	1562.847016	E	K	90	103
PSM	KKHVVAVVK	535	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3803	14.860915528266666	2	1006.666705	1006.665135	K	-	437	446
PSM	RRREQEEEL	536	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4341	15.808698809066668	2	1243.626716	1243.626912	R	R	331	340
PSM	RRRDLAQALIN	537	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7729	21.469149717599997	3	1324.768546	1324.768766	T	R	320	331
PSM	RRDRDGYSYGS	538	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4315	15.737897094133332	3	1330.601441	1330.601425	P	R	74	85
PSM	KKFQSFQDHKL	539	sp|Q14331|FRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6214	18.766164856533333	3	1404.751939	1404.751384	V	K	211	222
PSM	KKKGTYLTDETH	540	sp|P15529|MCP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4232	15.539344445333334	3	1419.735855	1419.735794	R	R	373	385
PSM	KRIDIIHNLKLD	541	sp|Q9ULM3|YETS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8639	23.485033612	3	1476.879115	1476.877647	N	R	299	311
PSM	RKVDWLTEKMHA	542	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8069	22.180148553333332	4	1512.787643	1512.787118	R	R	283	295
PSM	RRALEELGEELHK	543	sp|Q2M1P5|KIF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7874	21.758322072533336	4	1578.847120	1578.847804	Q	R	926	939
PSM	KKRSNTENLSQHF	544	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5339	17.3778178344	3	1587.810535	1587.811753	E	R	52	65
PSM	RKILTTEGRNALIH	545	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6686	19.5512762056	4	1620.941464	1620.942373	K	K	1010	1024
PSM	RKYAVLYQPLFDK	546	sp|P55209|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8902	24.404852589866668	3	1639.910277	1639.908613	E	R	104	117
PSM	RRAEPHTPSSHDAEEDEPLKES	547	sp|Q8NB46|ANR52_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5249	17.228810257333336	3	2517.163218	2516.152772	Y	R	503	525
PSM	KRKSLEDVTAEYIH	548	sp|Q9P0K7|RAI14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8358	22.856008631199998	3	1687.891553	1687.889334	R	K	664	678
PSM	KKIKALNHEIEELE	549	sp|O95347|SMC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7849	21.710487073333336	3	1692.942420	1692.941036	D	K	272	286
PSM	KRKDQSQVTWHEIA	550	sp|Q6IA86|ELP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7137	20.3692729864	3	1724.901994	1724.895817	W	R	419	433
PSM	RRNPDTQWITKPVH	551	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6971	20.087479124	4	1746.929007	1746.927785	I	K	143	157
PSM	RRRDISSSLNSLADSNA	552	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7959	21.947344208	3	1860.942154	1860.940201	F	R	47	64
PSM	KRLHDEKEETAGSYDS	553	sp|O60610|DIAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3926	15.017324833866667	3	1863.861125	1863.859885	L	R	196	212
PSM	KKRGFGFVTFDDHDPVD	554	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=8993	24.805858238933336	3	1978.953824	1978.953726	G	K	151	168
PSM	KRTYEEGLKHEANNPQL	555	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6683	19.546472474399998	4	2026.024778	2026.023202	A	K	92	109
PSM	KKKVEEVLEEEEEEYVVE	556	sp|P83916|CBX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9039	25.023102667733333	3	2236.103196	2236.099840	N	K	7	25
PSM	KAFVDFLSDEIKEE	557	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9819	28.327	3	1668.8247	1668.8247	D	R	80	94
PSM	KELGIKHSLH	558	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4743	16.487	3	1160.6666	1160.6666	E	R	535	545
PSM	KGFSRPDHLNGHI	559	sp|Q9HBE1-4|PATZ1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6682	19.545	3	1476.7586	1476.7586	G	K	420	433
PSM	KHAFSGGRDTIEEH	560	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4709	16.439	3	1582.7488	1582.7488	N	R	333	347
PSM	KHKELAPYDENWFYT	561	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9113	25.368	3	1939.9105	1939.9105	A	R	41	56
PSM	KHLNEIDLFHCIDPNDS	562	sp|Q15185-3|TEBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=9355	26.388	3	2065.9527	2065.9527	F	K	48	65
PSM	KHPVIGVHVR	563	sp|Q9BYC5-3|FUT8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5155	17.095	3	1140.688	1140.6880	F	R	193	203
PSM	KIKVNNHLFH	564	sp|Q8TBX8-2|PI42C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6444	19.166	3	1248.7091	1248.7091	S	R	81	91
PSM	KIRALVDHHDAEV	565	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6137	18.644	3	1501.8001	1501.8001	Q	K	202	215
PSM	KKAVSFHLVH	566	sp|Q96GA3|LTV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6290	18.9	3	1164.6768	1164.6768	K	R	13	23
PSM	KKHPDASVNFSEFS	567	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8192	22.477	3	1591.7631	1591.7631	K	K	29	43
PSM	KKNHDQHLLLLCDTC	568	sp|O94880-2|PHF14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=8260	22.641	3	1893.9189	1893.9189	C	K	447	462
PSM	KNIKLGIHEDSQN	569	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5765	18.064	3	1494.7791	1494.7791	S	R	443	456
PSM	KNVDLLSDMVQEHDEPIL	570	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=9267	26.011	3	2110.0252	2110.0252	F	K	108	126
PSM	KPHQDCHFTIRGG	571	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=5407	17.468	4	1551.7365	1551.7365	D	R	443	456
PSM	KQKYPEHAIH	572	sp|P33992|MCM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3899	14.971	3	1249.6568	1249.6568	T	K	700	710
PSM	KSFHHVTHDLV	573	sp|Q9Y4A5-2|TRRAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5631	17.841	3	1318.6782	1318.6782	E	R	1236	1247
PSM	KSQIHDIVLVGGST	574	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8388	22.917	3	1452.7936	1452.7936	D	R	328	342
PSM	KTVTAMDVVYALK	575	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9479	26.905	3	1437.7901	1437.7901	R	R	80	93
PSM	KVHLVGIDIFTGK	576	sp|Q6IS14|IF5AL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9233	25.866	2	1425.8344	1425.8344	A	K	55	68
PSM	RGFCFITYTDEEPVK	577	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=9216	25.798	3	1860.8716	1860.8716	R	K	155	170
PSM	RHESCHTGIKLVS	578	sp|Q14119|VEZF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=5448	17.52	3	1522.7674	1522.7674	R	R	91	104
PSM	RHFAHSPADRDEVVQAPSA	579	sp|Q5JTD0-4|TJAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6197	18.734	3	2089.0089	2089.0089	Q	R	369	388
PSM	RIEHPHLFHEEET	580	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6829	19.829	3	1672.7958	1672.7958	G	K	435	448
PSM	RKEALDFHVDHQS	581	sp|Q9Y5B8-2|NDK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6652	19.488	3	1580.7696	1580.7696	S	R	94	107
PSM	RKSLFINHHPPGQIA	582	sp|Q8ND76-3|CCNY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7051	20.226	3	1713.9427	1713.9427	K	R	27	42
PSM	RKSLHPIHQGITELS	583	sp|Q9H410-2|DSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6704	19.596	3	1714.9479	1714.9479	R	R	40	55
PSM	RLGNDFHTNK	584	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4758	16.505	3	1200.6	1200.6000	T	R	23	33
PSM	RNRYLSFHF	585	sp|P53004|BIEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8861	24.238	3	1238.6309	1238.6309	K	K	225	234
PSM	RPRLVFHTQLAHGSPTG	586	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7501	21.029	4	1873.0071	1873.0071	L	R	55	72
PSM	RPVFAHLDHH	587	sp|Q14156-3|EFR3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5868	18.216	3	1227.6261	1227.6261	V	K	255	265
PSM	RQAFHSHPGTHCPSPAV	588	sp|O75616|ERAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:4	ms_run[2]:scan=5003	16.877	3	1884.8802	1884.8802	M	K	267	284
PSM	RRGHSAQIA	589	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3679	14.741	2	994.54206	994.5421	A	K	913	922
PSM	RRIEHPTAGNTEAWEDTHA	590	sp|P21359-4|NF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6662	19.511	4	2190.0202	2190.0202	L	K	764	783
PSM	RRLADHFGG	591	sp|Q96HJ9-2|FMC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5415	17.478	2	1027.5312	1027.5312	D	K	270	279
PSM	RSSFSHYSGLKHED	592	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5344	17.383	4	1648.7594	1648.7594	D	K	201	215
PSM	RTATESFASDPILY	593	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9374	26.463	2	1569.7675	1569.7675	V	R	92	106
PSM	RTFIAIKPDGVQ	594	sp|P22392|NDKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8314	22.765	3	1343.7561	1343.7561	E	R	6	18
PSM	RTHHPDVFAAQNH	595	sp|Q9NUA8|ZBT40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5098	17.011	3	1528.7284	1528.7284	N	R	1026	1039
PSM	RVKTLHPAVHAGILA	596	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7207	20.492	4	1581.9467	1581.9467	G	R	63	78
PSM	RVRGVAMNPVEHPFGGGNHQHIG	597	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=6568	19.366	3	2481.2196	2481.2196	P	K	198	221
PSM	RVSFELFADKVP	598	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9569	27.282	3	1406.7558	1406.7558	G	K	19	31
PSM	RVVDLMAHMASKE	599	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5180	17.126	3	1517.733	1517.7330	N	-	281	294
PSM	RLNFSHGTHEYHAETI	600	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9380	26.487747077599998	4	1910.902633	1910.902359	A	K	73	89
PSM	RHPNTHVPSHLGSYY	601	sp|Q01543|FLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7019	20.172613986666665	3	1764.861904	1763.849201	P	-	438	453
PSM	RNIKSHLGNVHDQDN	602	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4429	15.985751770399999	3	1746.840858	1745.855743	E	-	164	179
PSM	KKSESEVEEAAAIIAQ	603	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8995	24.8165665296	3	1701.909044	1701.878495	M	R	270	286
PSM	RYYVLYIRPSHIH	604	sp|Q7Z6K5|ARPIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8345	22.82602372346667	3	1715.933630	1715.925995	E	R	58	71
PSM	RKQGLDNVHKQ	605	sp|Q07866|KLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3582	14.646529555466666	3	1321.725606	1321.721481	S	R	494	505
PSM	RKKTATAVAHC	606	sp|P62249|RS16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=3395	14.419422693600001	3	1241.664910	1241.666275	G	K	15	26
PSM	RKQGLDNVHKQ	607	sp|Q07866|KLC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3604	14.668025297066666	3	1321.725606	1321.721481	S	R	494	505
PSM	KRRWGASTATTQ	608	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4365	15.859229669600001	2	1361.714832	1361.716396	R	K	848	860
PSM	KRAQSELAAHQK	609	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3598	14.661200094933333	3	1365.769275	1365.747696	L	K	50	62
PSM	RKSSTSPKWAHD	610	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4110	15.279141855999999	3	1398.701058	1398.700411	F	K	914	926
PSM	RKSSTSPKWAHD	611	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4105	15.268344209866665	2	1398.703928	1398.700411	F	K	914	926
PSM	RVDGPKHSLLMR	612	sp|Q7L523|RRAGA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:35	ms_run[1]:scan=5363	17.415796490666665	4	1423.770244	1423.771802	E	-	302	314
PSM	RKAYLEPEHTKA	613	sp|Q70IA6|MOB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4379	15.889429472	3	1441.768386	1441.767763	E	R	22	34
PSM	RKKTELIMDAIH	614	sp|Q9H939|PPIP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35	ms_run[1]:scan=6304	18.92381585173333	3	1469.802125	1469.802434	Q	K	116	128
PSM	RKVLSPYDLTHKG	615	sp|Q9NX20|RM16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7102	20.3080462056	3	1512.841838	1512.841262	I	K	227	240
PSM	RKKLDAQVQELHA	616	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6817	19.8110455424	3	1535.843714	1534.857975	K	K	1254	1267
PSM	KKKTTHFVEGGDAGN	617	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4020	15.133607481866667	3	1587.779444	1587.800519	M	R	221	236
PSM	KKHSVSTSDRNQEE	618	sp|Q9H8H2|DDX31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3366	14.388631076800001	3	1643.785298	1643.786326	P	R	182	196
PSM	RRPITVHFGQVRPP	619	sp|Q8TEH3|DEN1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7948	21.918583670933334	4	1658.948308	1658.948127	D	R	487	501
PSM	KRKNIEPTHAPFIE	620	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7156	20.3991665256	3	1678.916611	1678.915489	Y	K	6945	6959
PSM	KKKHPDASVNFSEFS	621	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7640	21.2856980392	3	1719.857824	1719.858034	H	K	28	43
PSM	RKDKHIEELQQALIV	622	sp|Q8IY18|SMC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8762	23.882574683466665	3	1819.032712	1819.031582	E	K	347	362
PSM	RKKTQEKDDDMLFAL	623	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8799	24.0266573152	3	1836.941838	1836.940384	P	-	478	493
PSM	RKRGPSEETGGAVFDHPA	624	sp|O60563|CCNT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5896	18.271762030933335	4	1909.940095	1909.939472	T	K	572	590
PSM	KRVKHEVSGETVVFQGGALG	625	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7878	21.7632887616	3	2097.135770	2097.133087	G	K	1036	1056
PSM	KRTSSAQVEGGVHSLHSYEK	626	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5712	17.977684530133335	4	2199.107312	2199.103243	E	R	492	512
PSM	RVGLTHTMEHEDVIQIVKK	627	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35	ms_run[1]:scan=7364	20.776147247466668	4	2248.201116	2248.199787	Q	-	346	365
PSM	RRPHKEEEEEAYYPPAPPPYSETDSQAS	628	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7724	21.453515748799997	4	3259.473344	3259.469415	R	R	604	632
PSM	KDKDFAIDII	629	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9369	26.443	2	1176.639	1176.6390	F	K	211	221
PSM	KEHLHIVK	630	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4383	15.896	2	1002.5974	1002.5974	I	R	440	448
PSM	KELTEEKESAFEFLSSA	631	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9546	27.185	3	1943.9364	1943.9364	A	-	229	246
PSM	KFHPDKNHAPGATEAF	632	sp|Q9NXW2|DJB12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6241	18.814	3	1765.8536	1765.8536	L	K	136	152
PSM	KGHQFSCVCLHGDR	633	sp|Q92499-3|DDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=5908	18.286	3	1699.7671	1699.7671	K	K	408	422
PSM	KHNLLLHLK	634	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6945	20.04	3	1114.6975	1114.6975	A	K	258	267
PSM	KHQPHKVTQY	635	sp|Q969Q0|RL36L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3778	14.836	3	1264.6677	1264.6677	G	K	17	27
PSM	KHVKHELAEIVF	636	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8476	23.104	3	1448.814	1448.8140	A	K	75	87
PSM	KIWHHTFYNEL	637	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8454	23.064	3	1486.7357	1486.7357	E	R	84	95
PSM	KLLPQLTYLDGYDRDD	638	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9565	27.268	3	1923.9578	1923.9578	F	K	137	153
PSM	KQCHECIEHIR	639	sp|Q9H3G5|CPVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4426	15.982	3	1508.6977	1508.6977	Q	K	269	280
PSM	KRLSMYGVDLHHA	640	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7622	21.25	4	1525.7824	1525.7824	A	K	399	412
PSM	KSLHSIIRH	641	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4676	16.383	3	1089.6407	1089.6407	T	R	433	442
PSM	KVDNDENEHQLSL	642	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7669	21.346	3	1539.7165	1539.7165	F	R	32	45
PSM	KVHLVGIDIFTG	643	sp|Q6IS14|IF5AL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9678	27.74	2	1297.7394	1297.7394	A	K	55	67
PSM	KVREVLSYFHHQ	644	sp|Q86XI2|CNDG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8058	22.161	4	1541.8103	1541.8103	S	K	305	317
PSM	KYHIHHISEPT	645	sp|Q12923-2|PTN13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5211	17.169	3	1360.6888	1360.6888	D	R	1561	1572
PSM	KYHTINGHNAEVR	646	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3762	14.821	2	1537.775	1537.7750	Q	K	161	174
PSM	RCSHLLVKHSQS	647	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=3968	15.08	3	1450.7463	1450.7463	V	R	56	68
PSM	RGALQNIIPASTGAA	648	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8992	24.801	2	1438.7892	1438.7892	G	K	158	173
PSM	RGHTNQDHVHAVW	649	sp|Q9UNY4-2|TTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6012	18.462	4	1555.7393	1555.7393	Y	K	524	537
PSM	RGVVDSEDLPLNIS	650	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9336	26.303	2	1512.7784	1512.7784	I	R	378	392
PSM	RGYFEYIEENKYS	651	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8990	24.791	3	1696.7733	1696.7733	G	R	236	249
PSM	RHDSGYEVHHQ	652	sp|P05067-10|A4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3658	14.722	3	1363.6018	1363.6018	F	K	545	556
PSM	RHLAEHSPYYEAMK	653	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:35	ms_run[2]:scan=5176	17.123	4	1746.8148	1746.8148	N	K	452	466
PSM	RHLAEHSPYYEAMK	654	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6269	18.861	4	1730.8199	1730.8199	N	K	452	466
PSM	RKELHDLFNLPHD	655	sp|Q9NUQ7|UFSP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8708	23.697	4	1632.8372	1632.8372	Y	R	227	240
PSM	RKHETMNPAHVLFD	656	sp|Q7RTP6-5|MICA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35	ms_run[2]:scan=7408	20.857	3	1709.8308	1709.8308	E	R	4	18
PSM	RKHFEANNG	657	sp|Q9P2J5-3|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3624	14.687	2	1071.521	1071.5210	L	K	265	274
PSM	RKQSLGELIGTLNAA	658	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9342	26.328	3	1569.8839	1569.8839	G	K	18	33
PSM	RLNFSHGTHEYHAETI	659	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9153	25.536	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	660	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10025	29.184	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	661	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10110	29.522	4	1910.9024	1910.9024	A	K	73	89
PSM	RLVNHFVEEFK	662	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8468	23.09	3	1416.7514	1416.7514	N	R	181	192
PSM	RPHAPHSPIKFSE	663	sp|P52797-2|EFNA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6743	19.67	4	1501.779	1501.7790	N	K	112	125
PSM	RRHEGFAAALGDG	664	sp|Q9BYC9|RM20_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7463	20.961	3	1355.6694	1355.6694	R	K	123	136
PSM	RRHQLQEAS	665	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3636	14.7	2	1123.5847	1123.5847	A	R	1262	1271
PSM	RRIEHPTAGNTEAWEDTHA	666	sp|P21359-4|NF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6646	19.48	4	2190.0202	2190.0202	L	K	764	783
PSM	RRVLEENHVEHQP	667	sp|Q9H4L5-4|OSBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4566	16.229	3	1641.8336	1641.8336	R	R	773	786
PSM	RSVFALTNGIYPH	668	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9244	25.914	3	1473.7728	1473.7728	L	K	272	285
PSM	RVDKGGALHIYHQ	669	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5913	18.292	4	1492.7899	1492.7899	T	R	455	468
PSM	RVEHHDHAVVSG	670	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3647	14.711	3	1341.6538	1341.6538	R	R	99	111
PSM	KSKSEEAHAEDSVMDHHF	671	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:35	ms_run[1]:scan=5311	17.32833460426667	3	2100.899865	2098.901432	H	R	327	345
PSM	RLNFSHGTHEYHAETI	672	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9621	27.500029943733335	4	1910.902633	1910.902359	A	K	73	89
PSM	RCRDDSFFGETSHNYH	673	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4	ms_run[1]:scan=7550	21.11816612373333	4	2027.819277	2026.834021	E	K	229	245
PSM	RKGHNGTIEFTSLDAH	674	sp|Q86Y07|VRK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7473	20.9748022384	3	1781.879339	1781.880895	P	K	207	223
PSM	RIEHPHLFHEEET	675	sp|Q9BZE2|PUS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6796	19.7758914936	3	1672.797973	1672.795768	G	K	435	448
PSM	KTKHHSVAEEETLE	676	sp|Q03468|ERCC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4657	16.358222240533333	3	1636.812561	1636.805664	S	K	1184	1198
PSM	KRDLHDQFQHQL	677	sp|Q9H270|VPS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6816	19.8102497416	3	1564.795803	1563.790623	Q	R	877	889
PSM	KHLHHDAGIM	678	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=3725	14.786370038133333	3	1173.571674	1173.571312	L	R	2685	2695
PSM	RKSGPHCSESIH	679	sp|P42785|PCP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=3541	14.606567153866667	3	1393.654664	1393.652081	F	R	227	239
PSM	RSVHNHLTSAPAK	680	sp|Q6ZU65|UBN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3726	14.7875597728	3	1416.774924	1416.758595	S	K	665	678
PSM	KLFNLSKEDDV	681	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8557	23.2744745736	2	1306.657096	1306.676882	R	R	143	154
PSM	RLDMNHGFVHHI	682	sp|Q2NKX9|CB068_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:35	ms_run[1]:scan=6558	19.347444329066665	4	1490.719313	1490.720101	G	R	18	30
PSM	RRGWAAPIR	683	sp|Q9BXW7|HDHD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6270	18.861805948266667	3	1081.625632	1081.625730	E	K	298	307
PSM	KKKVALEDKS	684	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3591	14.653794064000001	3	1144.683739	1144.681573	S	-	590	600
PSM	RRFQDAVRL	685	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7684	21.369358035466668	3	1159.656945	1159.657424	E	R	374	383
PSM	RKKAYADFY	686	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7154	20.3957248064	2	1160.598206	1160.597844	Q	R	45	54
PSM	RRPTWAEER	687	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5385	17.442362929066668	3	1199.616010	1199.615953	E	R	381	390
PSM	RRRSAEDELAM	688	sp|Q13868|EXOS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:35	ms_run[1]:scan=4595	16.2754811264	2	1348.652791	1348.651747	L	R	121	132
PSM	KRIFHTVTTTDDPVIR	689	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7307	20.6758335464	4	1898.036910	1898.037396	I	K	221	237
PSM	RKKVMELLVHLN	690	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:35	ms_run[1]:scan=7691	21.383274777866667	3	1494.869952	1494.870454	V	K	55	67
PSM	RKAVDALLTHCKS	691	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:4	ms_run[1]:scan=6018	18.469666946933334	3	1497.809137	1497.808582	V	R	37	50
PSM	RKVDWLTEKMHA	692	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:35	ms_run[1]:scan=6714	19.608523886666667	4	1528.781740	1528.782033	R	R	283	295
PSM	KRKVTNLFCFEH	693	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:4	ms_run[1]:scan=8296	22.7177865656	4	1577.814250	1577.813667	P	R	8	20
PSM	KKRSNTENLSQHF	694	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5360	17.4114548808	3	1587.810535	1587.811753	E	R	52	65
PSM	KKKTTHFVEGGDAGN	695	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4001	15.114220246666667	3	1587.779444	1587.800519	M	R	221	236
PSM	KKKNLEEAELHSTE	696	sp|P54132|BLM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4888	16.710330606933333	3	1654.852836	1654.852615	E	K	271	285
PSM	KKDGHSKNDCPEDF	697	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4	ms_run[1]:scan=4702	16.429300971466667	3	1675.726336	1675.726034	C	R	919	933
PSM	KKKNISHDTFGTTYG	698	sp|Q9H7B2|RPF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5667	17.90433296293333	3	1695.859097	1695.858034	K	R	250	265
PSM	RRYNIPHGPVVGSTR	699	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6822	19.819264001333334	3	1707.929026	1707.928120	L	R	17	32
PSM	KRMNTNPSRGPYHF	700	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:35	ms_run[1]:scan=5840	18.177583346666665	4	1719.825455	1719.826357	R	R	60	74
PSM	KKKHPDASVNFSEFS	701	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7072	20.253929879199998	3	1719.861784	1719.858034	H	K	28	43
PSM	RRFPEEPHVPLEQR	702	sp|Q8TCD5|NT5C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7545	21.1112138632	4	1788.933876	1788.938350	R	R	28	42
PSM	RKRVSLEPHQGPGTPES	703	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=4931	16.7633155176	3	1873.977334	1873.975858	Q	K	1987	2004
PSM	RKKFGQYAGHVVPTILE	704	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8477	23.10660286506667	4	1942.083258	1942.078866	L	K	352	369
PSM	KADLINNLGTIA	705	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9251	25.945	2	1241.698	1241.6980	T	K	95	107
PSM	KEAAGKSSGPTSLFAVTVAPPGA	706	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9291	26.113	3	2142.1321	2142.1321	A	R	181	204
PSM	KHPEHAEQNIR	707	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3559	14.625	3	1357.6851	1357.6851	E	K	228	239
PSM	KHPNLVHK	708	sp|P35573-2|GDE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3703	14.765	2	971.56648	971.5665	E	R	1334	1342
PSM	KHQEFDNHINSYDHAH	709	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5541	17.683	5	1990.867	1990.8670	Q	K	69	85
PSM	KHVALHQEFHG	710	sp|Q96HJ9-2|FMC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4908	16.731	3	1301.6629	1301.6629	R	K	75	86
PSM	KKHFEEHNSMNEL	711	sp|Q9BXS6-7|NUSAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35	ms_run[2]:scan=4516	16.128	3	1657.7519	1657.7519	K	K	184	197
PSM	KKLHSLQPHACF	712	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:4	ms_run[2]:scan=6253	18.83	2	1464.766	1464.7660	E	R	4111	4123
PSM	KQRHENETHTLE	713	sp|Q8N4C6-6|NIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3709	14.77	3	1520.7332	1520.7332	M	K	655	667
PSM	KRILMEHIH	714	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5558	17.71	3	1175.6597	1175.6597	N	K	135	144
PSM	KRLSMYGVDLHHA	715	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35	ms_run[2]:scan=6737	19.656	4	1541.7773	1541.7773	A	K	399	412
PSM	KRLSMYGVDLHHA	716	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7620	21.247	3	1525.7824	1525.7824	A	K	399	412
PSM	KSFHHVTHDLV	717	sp|Q9Y4A5-2|TRRAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5599	17.781	3	1318.6782	1318.6782	E	R	1236	1247
PSM	KTYHYHCGVQDKA	718	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4	ms_run[2]:scan=4132	15.308	3	1605.7358	1605.7358	V	K	265	278
PSM	RASFNHFDKDHGGALGPEEF	719	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8428	23.002	3	2230.0192	2230.0192	F	K	552	572
PSM	RAVFPSIVGRP	720	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8688	23.63	3	1197.6982	1197.6982	P	R	28	39
PSM	RENYSHHTQDDR	721	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3440	14.5	4	1556.6716	1556.6716	Q	R	150	162
PSM	RERLEHPVLHVSWNDA	722	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8424	22.993	4	1956.9918	1956.9918	I	R	137	153
PSM	RFKMDVHITPGTHASEHAVN	723	sp|Q9Y3D0|CIA2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=5801	18.117	4	2262.0964	2262.0964	Q	K	114	134
PSM	RHKNMSVHLSPCF	724	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=7059	20.238	3	1627.7711	1627.7712	K	R	105	118
PSM	RHLHFTLVKD	725	sp|P11217-2|PYGM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7438	20.926	3	1264.704	1264.7040	N	R	34	44
PSM	RHPSGHLEH	726	sp|Q9UDR5|AASS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3475	14.536	3	1068.5213	1068.5213	I	K	845	854
PSM	RHSGSDRSSFSHYSGL	727	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6891	19.952	3	1778.8085	1778.8085	D	K	195	211
PSM	RILMEHIHKL	728	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:35	ms_run[2]:scan=6337	19.003	3	1304.7387	1304.7387	K	K	136	146
PSM	RKGDVLHMHYTG	729	sp|P26885|FKBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6413	19.126	3	1412.6983	1412.6983	S	K	47	59
PSM	RPRGVSLTNHHFYDES	730	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7265	20.609	4	1913.9133	1913.9133	K	K	19	35
PSM	RRALHFVF	731	sp|Q9HC38-3|GLOD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8654	23.53	2	1044.5981	1044.5981	A	K	4	12
PSM	RRLLEVHQLVVHAG	732	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8039	22.112	4	1625.9478	1625.9478	L	R	619	633
PSM	RRYPAHLA	733	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4718	16.448	2	982.54608	982.5461	R	R	127	135
PSM	RVQVHKNGDHFSYFS	734	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7434	20.921	4	1819.8754	1819.8754	E	R	426	441
PSM	KSKSEEAHAEDSVMDHHF	735	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6941	20.0294023176	5	2082.906424	2082.906517	H	R	327	345
PSM	KSKSEEAHAEDSVMDHHF	736	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:35	ms_run[1]:scan=5526	17.66472198106667	4	2098.895855	2098.901432	H	R	327	345
PSM	KYHTVNGHNCEVR	737	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=3900	14.973167111733334	3	1613.738798	1612.752858	Q	K	166	179
PSM	RLNFSHGTHEYHAETI	738	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9540	27.1600155696	4	1910.902633	1910.902359	A	K	73	89
PSM	KHPVIGVHVR	739	sp|Q9BYC5|FUT8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5139	17.0743635304	3	1140.687655	1140.687996	F	R	356	366
PSM	RHILEAPQHGLER	740	sp|Q9NVK5|FGOP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6012	18.462058348533333	4	1554.837314	1554.837908	S	R	150	163
PSM	RSHSAHFFEFLT	741	sp|A6NHG4|DDTL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=9202	25.7438126416	3	1477.710309	1477.710248	N	K	75	87
PSM	KGRPHLTQHMSMYDG	742	sp|Q96PQ6|ZN317_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=4302	15.712055698933334	3	1790.817734	1788.803573	F	R	204	219
PSM	RHHAQETLHYQNLA	743	sp|Q7Z5J4|RAI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6379	19.066175378399997	3	1718.840584	1716.844450	S	K	296	310
PSM	RKPHTNGDAPSH	744	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3270	14.2841588256	3	1316.620793	1315.638145	K	R	108	120
PSM	KKKLEEHLE	745	sp|Q86VS8|HOOK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4011	15.125870368266668	3	1152.650882	1152.650273	L	K	545	554
PSM	KKHEDSAIPR	746	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3782	14.840553141333334	3	1179.636649	1179.636020	L	R	756	766
PSM	RRLENIRFL	747	sp|Q9Y5A7|NUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8521	23.199617061333335	3	1215.720075	1215.720024	R	K	431	440
PSM	RRGLDEDRGSW	748	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6623	19.446985463466667	2	1345.650840	1345.648710	P	R	1019	1030
PSM	RRIDWEKLEN	749	sp|P17252|KPCA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7960	21.949631479733334	3	1357.710175	1357.710248	F	R	598	608
PSM	KRAQSELAAHQK	750	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3573	14.637923328533333	3	1365.769275	1365.747696	L	K	50	62
PSM	RRLGELPADHPKG	751	sp|Q16512|PKN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5165	17.107794693866666	4	1444.790486	1444.789895	E	R	273	286
PSM	RKKTELIMDAIH	752	sp|Q9H939|PPIP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7654	21.320668920266666	4	1453.806434	1453.807519	Q	K	116	128
PSM	RKVLSPYDLTHKG	753	sp|Q9NX20|RM16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7118	20.33660434746667	3	1512.841838	1512.841262	I	K	227	240
PSM	KRKGEIAASIATHM	754	sp|O75880|SCO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:35	ms_run[1]:scan=5175	17.121911202133333	3	1527.813293	1527.819147	N	R	281	295
PSM	RKLHELTVMQDR	755	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:35	ms_run[1]:scan=5044	16.939066526933335	4	1540.815701	1540.814396	S	R	763	775
PSM	RKKLFNPPEESEK	756	sp|Q9NRP2|COXM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5678	17.917689059466667	4	1600.857100	1600.857306	M	-	67	80
PSM	RKHFEANNGKLPDN	757	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=4905	16.7289031832	3	1639.807330	1638.822652	L	K	956	970
PSM	RRISHEGSPVKPVAI	758	sp|Q96II8|LRCH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=6220	18.77678365066667	4	1644.942077	1644.942373	Q	R	412	427
PSM	RRRTLLEQLDDDQ	759	sp|O75400|PR40A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8743	23.814014770933333	3	1656.855631	1656.854346	K	-	945	958
PSM	RHLISSLQNHNHQL	760	sp|Q5VTR2|BRE1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7161	20.405885446666666	3	1696.879262	1695.891734	M	K	477	491
PSM	RKLHNILGVETGGPGGR	761	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=7318	20.690552061866665	3	1759.981558	1759.980549	T	R	421	438
PSM	KRLEEKHEALL	762	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=5732	18.026442876266668	3	1364.777514	1364.777599	M	K	400	411
PSM	RRPSLLSEFHPGSDRPQE	763	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8286	22.698270058133335	4	2107.066208	2107.055899	R	R	67	85
PSM	RKSKSNSLIHTECLSQVQ	764	sp|O43929|ORC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:4	ms_run[1]:scan=7039	20.211661393333333	4	2114.091409	2114.090236	S	R	4	22
PSM	KKFQGIKHECQANGPEDLN	765	sp|P60981|DEST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:4	ms_run[1]:scan=5893	18.2653700744	3	2213.049329	2212.069501	K	R	126	145
PSM	RLNFSHGTHEYHAETI	766	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=8904	24.4129962728	4	1910.902745	1910.902359	A	K	73	89
PSM	KEIQHHLK	767	sp|Q99961-3|SH3G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3534	14.598	2	1031.5876	1031.5876	L	K	88	96
PSM	KGQKCEFQDAYVLLSE	768	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:4	ms_run[2]:scan=9424	26.672	3	1913.9193	1913.9193	S	K	233	249
PSM	KHKHETFITSSG	769	sp|Q69YN4-3|VIR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4729	16.466	3	1370.6943	1370.6943	G	K	1593	1605
PSM	KHLHNDVEKE	770	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3519	14.585	3	1247.6258	1247.6258	T	R	896	906
PSM	KHNGPEHWH	771	sp|P00918|CAH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3915	15.001	3	1140.5213	1140.5213	G	K	9	18
PSM	KIDTIEIITD	772	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9090	25.261	2	1159.6336	1159.6336	G	R	125	135
PSM	KIREQVLHHPQLGE	773	sp|Q9P2D1|CHD7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6447	19.17	3	1682.9216	1682.9216	R	R	2063	2077
PSM	KKHHTSSVYSISE	774	sp|Q6XZF7|DNMBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5264	17.251	3	1501.7525	1501.7525	T	R	507	520
PSM	KLIIHKNHF	775	sp|Q9NRZ9-6|HELLS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5484	17.587	3	1148.6818	1148.6818	E	K	614	623
PSM	KQCHECIEHIR	776	sp|Q9H3G5|CPVL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=4432	15.992	4	1508.6977	1508.6977	Q	K	269	280
PSM	KQPAENVNQYLTDPKFVE	777	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9064	25.14	3	2119.0586	2119.0586	F	R	617	635
PSM	KSHIRTDDVHA	778	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3929	15.02	2	1277.6476	1277.6476	G	K	333	344
PSM	KTEWLDGKHVVFG	779	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8657	23.535	3	1514.7882	1514.7882	A	K	118	131
PSM	RDLISHDEMFSDIY	780	sp|P13693|TCTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=9065	25.146	3	1755.7774	1755.7774	Y	K	5	19
PSM	RERPAYAVHGNMLHYV	781	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8197	22.486	4	1911.9526	1911.9526	E	K	321	337
PSM	RGAGHHHTLDSC	782	sp|Q14574-2|DSC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=3618	14.68	3	1346.5898	1346.5898	C	R	793	805
PSM	RGCGPEKDHVYLQLHHLPPEQLAT	783	sp|P31040-3|SDHA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4	ms_run[2]:scan=8379	22.901	5	2794.3973	2794.3973	G	R	210	234
PSM	RHHLQIPIHFP	784	sp|Q9Y2Q3-3|GSTK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8915	24.457	3	1393.7731	1393.7731	L	K	74	85
PSM	RKHFGAGGNQ	785	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3670	14.734	3	1070.537	1070.5370	A	R	514	524
PSM	RKHQITYLIHQA	786	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6996	20.126	4	1506.8419	1506.8419	R	K	453	465
PSM	RKHTGFLEISQHSQEFIN	787	sp|Q7L0Y3|TM10C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8525	23.206	4	2170.0919	2170.0919	K	R	379	397
PSM	RKSENTAIHHYLEAL	788	sp|Q13325-2|IFIT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8531	23.216	3	1780.922	1780.9220	H	K	342	357
PSM	RKSNHLNHVSPGQLT	789	sp|Q8N7R7-3|CCYL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5182	17.129	3	1686.8914	1686.8914	K	K	33	48
PSM	RLNFSHGTHEYHAETI	790	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8884	24.329	4	1910.9024	1910.9024	A	K	73	89
PSM	RLNFSHGTHEYHAETI	791	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=9943	28.848	4	1910.9024	1910.9024	A	K	73	89
PSM	RLRHEEEE	792	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3528	14.594	2	1096.5261	1096.5261	A	R	868	876
PSM	RNHLLHVFDEYK	793	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8437	23.021	4	1569.8052	1569.8052	N	R	120	132
PSM	RPQNYLFGCEL	794	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:4	ms_run[2]:scan=9561	27.25	2	1395.6605	1395.6605	L	K	13	24
PSM	RRLLWHGS	795	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6626	19.454	2	1023.5726	1023.5726	N	R	857	865
PSM	RRTVEGVLIVHEH	796	sp|O43809|CPSF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7007	20.146	4	1543.8583	1543.8583	M	R	77	90
PSM	RSAYHSHKDQALLS	797	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4790	16.556	4	1611.8118	1611.8118	S	K	2547	2561
PSM	RTREVGIQEIHH	798	sp|Q9H9T3-4|ELP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5341	17.38	3	1473.7801	1473.7801	V	K	283	295
PSM	RKHEAFESDLAAHQD	799	sp|P35609|ACTN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6436	19.154607991466666	3	1753.802524	1752.817960	L	R	442	457
PSM	RTKAEHLDHVMF	800	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:35	ms_run[1]:scan=6840	19.849349241600002	4	1498.734483	1498.735083	F	R	29	41
PSM	KEDLTEIRDMLLAN	801	sp|Q8NHW5|RLA0L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:35	ms_run[1]:scan=9346	26.346531425600002	3	1675.847365	1675.845087	T	K	92	106
PSM	RTDLVHHFEKGT	802	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6398	19.098966695466668	3	1438.739966	1438.731711	S	K	2045	2057
PSM	KRAVDLIQKH	803	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5014	16.898079081866666	3	1206.720252	1206.719690	P	K	244	254
PSM	KKQNLLHSEK	804	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3858	14.92631914	3	1223.706609	1223.698620	Q	R	285	295
PSM	RTMSHHAAALK	805	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:35	ms_run[1]:scan=3501	14.564121761066668	2	1237.618048	1237.634975	G	R	4788	4799
PSM	KKTKHMLPSGF	806	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35	ms_run[1]:scan=5741	18.034850965866667	3	1288.695896	1288.696178	N	R	64	75
PSM	RRREQEEAAAP	807	sp|Q8IYI6|EXOC8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3749	14.8092617	2	1311.667408	1311.664360	K	R	288	299
PSM	RKREAFLEQF	808	sp|P23258|TBG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8542	23.2448039408	3	1322.709736	1322.709519	L	R	399	409
PSM	KKHKPDFISLF	809	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8977	24.734254627466665	3	1358.771126	1358.771057	L	K	44	55
PSM	RVVDLMAHMASKE	810	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=5157	17.09696946613333	3	1517.731238	1517.733034	N	-	323	336
PSM	RRRGETESEEFE	811	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=4821	16.599501905066667	3	1523.696358	1523.696448	R	K	541	553
PSM	RRIEELQHNLQK	812	sp|Q96ED9|HOOK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=5646	17.861593911466667	4	1562.865142	1562.864123	A	K	577	589
PSM	KRKTVTAMDVVYAL	813	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9193	25.706764869866667	3	1593.893117	1593.891249	A	K	78	92
PSM	KKRSHPVIIDLDEED	814	sp|Q9Y4B4|ARIP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7880	21.7670720176	3	1792.935318	1792.931927	T	R	425	440
PSM	KRKNSTGSGHSAQELPTI	815	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6674	19.5282805432	3	1909.997685	1909.996987	R	R	368	386
PSM	RKFAIHGDPKASGQEMNG	816	sp|Q9BW30|TPPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:35	ms_run[1]:scan=4886	16.706809652	3	1957.942667	1957.942844	F	K	15	33
PSM	KRTKENDAHLVEVNLNNI	817	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=8559	23.2781640856	4	2106.119140	2106.118165	L	K	191	209
PSM	KLHHCPGNHSWDSTISGSQ	818	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:4	ms_run[1]:scan=6341	19.0075755992	3	2146.960434	2146.960285	M	R	384	403
PSM	RRGKDPTEHIPEIILNNFTT	819	sp|Q9H9Y2|RPF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9445	26.759668314133332	4	2350.243530	2350.239343	K	R	234	254
PSM	RRKEGTSVLEHTSDGFPEN	820	sp|Q8TED0|UTP15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7069	20.24999244853333	3	2158.044655	2158.040309	M	K	495	514
PSM	KHAMHQTGHL	821	sp|Q9NYH9|UTP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:35	ms_run[2]:scan=3560	14.626	3	1174.5666	1174.5666	A	-	588	598
PSM	KHKSLAFH	822	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4348	15.826	2	966.53993	966.5399	E	R	471	479
PSM	KHLLPEHIR	823	sp|Q99797|MIPEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5611	17.802	2	1141.672	1141.6720	E	R	231	240
PSM	KLGIHEDSTN	824	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4855	16.653	2	1112.5462	1112.5462	L	R	438	448
PSM	KNALESYAFNM	825	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35	ms_run[2]:scan=8934	24.541	2	1302.5914	1302.5914	A	K	484	495
PSM	KNIEDVIAQGIG	826	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9584	27.342	2	1255.6772	1255.6772	G	K	49	61
PSM	KRHGIPMSHVA	827	sp|P24666-4|PPAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:35	ms_run[2]:scan=3957	15.064	3	1247.6557	1247.6557	M	R	65	76
PSM	KRILMEHIH	828	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:35	ms_run[2]:scan=4619	16.307	2	1191.6546	1191.6546	N	K	135	144
PSM	RDLLHNEDRHDDYFQE	829	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7974	21.976	3	2100.9249	2100.9249	H	R	430	446
PSM	RERPPDHQHSAQV	830	sp|A0FGR8-4|ESYT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3705	14.767	3	1555.7604	1555.7604	K	K	456	469
PSM	RFNIHNNR	831	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4610	16.298	3	1069.553	1069.5530	Q	K	1041	1049
PSM	RGEQGYGFHLHGEKG	832	sp|Q15599-2|NHRF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6459	19.185	3	1670.7914	1670.7914	V	R	16	31
PSM	RGFCFLEYEDH	833	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=9301	26.156	3	1471.619	1471.6190	N	K	134	145
PSM	RGFCFLEYEDH	834	sp|O60506-5|HNRPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:4	ms_run[2]:scan=9306	26.178	3	1471.619	1471.6190	N	K	134	145
PSM	RHKQVIHPGLQEVGL	835	sp|Q8IWI9-3|MGAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8017	22.071	3	1709.9689	1709.9689	L	K	718	733
PSM	RHMLVHSGERPY	836	sp|Q92766-6|RREB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:35	ms_run[2]:scan=4867	16.67	4	1496.7307	1496.7307	D	K	114	126
PSM	RHSAISPKSSLH	837	sp|Q8N5P1|ZC3H8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4032	15.147	3	1318.7106	1318.7106	F	R	54	66
PSM	RIESPLKHQH	838	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4434	15.995	2	1243.6786	1243.6786	R	R	206	216
PSM	RIPPHHPHTS	839	sp|Q92530|PSMF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3449	14.513	3	1177.6105	1177.6105	L	R	170	180
PSM	RIRQPLLPHINVH	840	sp|Q5W0V3-2|F16B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8117	22.3	4	1591.9423	1591.9423	G	R	117	130
PSM	RKESYSIYVY	841	sp|Q16778|H2B2E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8532	23.218	2	1306.6558	1306.6558	S	K	34	44
PSM	RKHNNCMASHLTPAVYA	842	sp|P12532|KCRU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	6-UNIMOD:4,7-UNIMOD:35	ms_run[2]:scan=6038	18.495	3	1984.936	1984.9360	L	R	57	74
PSM	RKLHVSVEALVCH	843	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	12-UNIMOD:4	ms_run[2]:scan=8133	22.336	4	1546.8402	1546.8402	L	R	204	217
PSM	RKSGPHCSESIH	844	sp|P42785|PCP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	7-UNIMOD:4	ms_run[2]:scan=3561	14.627	3	1393.6521	1393.6521	F	R	227	239
PSM	RLAHYNK	845	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=3680	14.744	2	900.49298	900.4930	S	R	80	87
PSM	RLPGRFNGGHSPTHSPE	846	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5390	17.447	3	1844.903	1844.9030	R	K	500	517
PSM	RQATKDAGVIAGLNVL	847	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9243	25.909	3	1624.9261	1624.9261	Q	R	100	116
PSM	RQHHLLNDRGSEEPPGS	848	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5104	17.019	3	1927.9249	1927.9249	H	K	383	400
PSM	RRASHTAPQVLFSH	849	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=6771	19.735	4	1605.8488	1605.8488	G	R	189	203
PSM	RRNYAHALDGLY	850	sp|Q9UBX3|DIC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8269	22.662	3	1447.732	1447.7320	Q	R	138	150
PSM	RRWIHPPSG	851	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=5961	18.379	3	1104.5941	1104.5941	S	R	125	134
PSM	RSEHPPLCGRDHLSF	852	sp|Q15393-3|SF3B3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	8-UNIMOD:4	ms_run[2]:scan=7706	21.411	4	1806.8584	1806.8584	L	R	331	346
PSM	KYHTINGHNAEVR	853	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4597	16.280443572	4	1538.758721	1537.774973	Q	K	173	186
PSM	KYHTINGHNAEVR	854	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4393	15.917811165866668	4	1538.758092	1537.774973	Q	K	173	186
PSM	RSAYHSHKDQALLS	855	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4771	16.5259232328	4	1611.811488	1611.811753	S	K	2536	2550
PSM	KSRPHLAGTHTSL	856	sp|Q8IYD8|FANCM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5167	17.109902705066666	3	1404.760037	1403.763346	S	R	1797	1810
PSM	RVRGVAMNPVEHPFGGGNHQHIG	857	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:35	ms_run[1]:scan=6571	19.3699356968	5	2481.219022	2481.219628	P	K	198	221
PSM	RVRGVAMNPVEHPFGGGNHQHIG	858	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7695	21.3936681896	4	2466.209034	2465.224713	P	K	198	221
PSM	REKIHHLDDML	859	sp|Q9NNX1|TUFT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:35	ms_run[1]:scan=6062	18.529816409866665	3	1421.707701	1421.708534	L	K	285	296
PSM	RLVQKFNHSH	860	sp|Q9UNZ2|NSF1C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=4450	16.015862029333334	3	1265.663718	1264.678888	G	R	307	317
PSM	RKPRGIDN	861	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3526	14.592015476266665	2	954.536512	954.535912	W	R	36	44
PSM	RRIKADVE	862	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3924	15.0157623168	2	985.566700	985.566878	L	K	394	402
PSM	RRAKQTEL	863	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3923	15.015062862666667	2	1000.578128	1000.577777	E	R	199	207
PSM	KRKFSSFF	864	sp|Q96GM5|SMRD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8400	22.946239540799997	2	1045.572580	1045.570901	Q	K	230	238
PSM	RRKEYDAL	865	sp|Q96AG4|LRC59_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5219	17.180067037066667	2	1049.562582	1049.561792	R	K	199	207
PSM	KRKYNWSA	866	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5416	17.4798527832	2	1051.556449	1051.556313	R	K	44	52
PSM	RRPYDLDR	867	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=5297	17.3063060784	3	1089.567205	1089.567940	V	R	711	719
PSM	RKHQITYLIHQA	868	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6982	20.10398293946667	4	1506.841926	1506.841931	R	K	453	465
PSM	RRELFEER	869	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6029	18.481979150933334	3	1133.594906	1133.594155	E	R	192	200
PSM	RRIKLYAVE	870	sp|O14744|ANM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7186	20.45283918186667	3	1146.687455	1146.687327	D	K	384	393
PSM	KKPVKPHSSF	871	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3890	14.963361316799999	3	1153.666247	1153.660778	N	K	1296	1306
PSM	KKHEDSAIPR	872	sp|Q99459|CDC5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3794	14.851871769066666	3	1179.636649	1179.636020	L	R	756	766
PSM	RKVREFNFE	873	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7358	20.7687976248	3	1223.641361	1223.641105	K	K	344	353
PSM	RRRGLEEYLE	874	sp|Q96L92|SNX27_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8082	22.210339998666665	2	1319.696053	1319.694598	A	K	235	245
PSM	RRGLDDDRGPW	875	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=7361	20.772945281866665	3	1343.685819	1341.653795	P	R	1110	1121
PSM	KKKELEHVNLSV	876	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6854	19.8819907576	3	1422.819956	1422.819464	T	K	1604	1616
PSM	RRRTEEGPTLSYG	877	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6073	18.5540204944	3	1520.770200	1520.769553	K	R	147	160
PSM	RREREQQDLEFA	878	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=6936	20.021385859466665	3	1575.775666	1575.775367	E	K	511	523
PSM	KKKHPDASVNFSEFS	879	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=9162	25.576465633599998	3	1719.855568	1719.858034	H	K	28	43
PSM	KKKHPDASVNFSEFS	880	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8105	22.264335476	3	1720.844589	1719.858034	H	K	28	43
PSM	RRPGHDDGQRPSGGAAAAP	881	sp|Q8N726|ARF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=3791	14.849657522133333	3	1871.913371	1871.909904	P	R	62	81
PSM	KGVMIRCMLNIWGVILYL	882	sp|P55017|S12A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4	ms_run[1]:scan=8380	22.901325212533333	4	2178.155250	2178.187965	V	R	140	158
PSM	KKYEDICPSTHNMDVPNIK	883	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=7387	20.809788803733333	4	2306.086769	2304.087853	G	R	67	86
PSM	RRGEDMMHPLKVSLEDLYNG	884	sp|O60884|DNJA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	6-UNIMOD:35,7-UNIMOD:35	ms_run[1]:scan=8857	24.221728689066666	4	2391.130926	2391.131115	R	K	111	131
PSM	KKKMQAHIQDLEEQLDEEEGA	885	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=8580	23.329759666933334	4	2468.186013	2468.185318	E	R	945	966