MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000422-4 -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20201022\20201022172214503394^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\180209HEK_TNSCX10mM_Nt2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20201022\20201022172214503394^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\180209HEK_TNSCX10mM_Nt2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[1]-setting	enzymes=TrypN
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=40
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20201019
MTD	software[2]-setting	CLE=[X]|[RK]
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20201019
MTD	software[3]-setting	search_enzyme_number=11
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67.0	null	2-UNIMOD:1,546-UNIMOD:4	0.09	67.0	5	3	1
PRT	sp|Q5VTL8-2|PR38B_HUMAN	Isoform 2 of Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	64.0	null	2-UNIMOD:1,29-UNIMOD:4	0.22	64.0	2	1	0
PRT	sp|Q6VN20-3|RBP10_HUMAN	Isoform 3 of Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61.0	null	2-UNIMOD:1	0.06	61.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58.0	null	2-UNIMOD:1	0.03	58.0	2	1	0
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	57.0	null	2-UNIMOD:1	0.19	57.0	2	1	0
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56.0	null	2-UNIMOD:1	0.20	56.0	6	2	0
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55.0	null	2-UNIMOD:1	0.01	55.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54.0	null		0.38	54.0	3	2	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	54.0	null	2-UNIMOD:1	0.10	54.0	20	2	0
PRT	sp|P63027|VAMP2_HUMAN	Vesicle-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=VAMP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52.0	null	2-UNIMOD:1	0.26	52.0	8	2	0
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1,17-UNIMOD:35	0.15	51.0	3	1	0
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51.0	null	2-UNIMOD:1,308-UNIMOD:4	0.07	51.0	4	2	0
PRT	sp|Q96LR5|UB2E2_HUMAN	Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	2-UNIMOD:1	0.11	51.0	2	1	0
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	2-UNIMOD:1,17-UNIMOD:4,26-UNIMOD:4	0.14	50.0	3	1	0
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	2-UNIMOD:1,641-UNIMOD:35,645-UNIMOD:4,3-UNIMOD:1	0.05	50.0	13	4	1
PRT	sp|Q5VT52-4|RPRD2_HUMAN	Isoform 4 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	2-UNIMOD:1	0.18	50.0	2	1	0
PRT	sp|O95197-6|RTN3_HUMAN	Isoform 6 of Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50.0	null	2-UNIMOD:1,34-UNIMOD:4	0.18	50.0	2	1	0
PRT	sp|Q96K37|S35E1_HUMAN	Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1	0.06	49.0	2	1	0
PRT	sp|P55210-2|CASP7_HUMAN	Isoform Beta of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	2-UNIMOD:1,7-UNIMOD:4	0.11	49.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	61-UNIMOD:4	0.39	49.0	2	1	0
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	49.0	3	1	0
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	49.0	3	1	0
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	2-UNIMOD:1	0.07	48.0	11	2	0
PRT	sp|Q86U42-2|PABP2_HUMAN	Isoform 2 of Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47.0	null	2-UNIMOD:1	0.07	47.0	3	2	1
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.13	46.0	3	1	0
PRT	sp|O75312|ZPR1_HUMAN	Zinc finger protein ZPR1 OS=Homo sapiens OX=9606 GN=ZPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.07	46.0	2	1	0
PRT	sp|Q92600-3|CNOT9_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	46.0	6	2	0
PRT	sp|Q9UIU6|SIX4_HUMAN	Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1,22-UNIMOD:35	0.04	46.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.16	46.0	6	2	0
PRT	sp|Q15543|TAF13_HUMAN	Transcription initiation factor TFIID subunit 13 OS=Homo sapiens OX=9606 GN=TAF13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	2-UNIMOD:1	0.22	46.0	2	1	0
PRT	sp|Q9BZE9|ASPC1_HUMAN	Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1	0.04	45.0	3	2	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	2-UNIMOD:1	0.18	45.0	4	1	0
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1	0.02	45.0	1	1	1
PRT	sp|Q75N03-2|HAKAI_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	45.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.01	45.0	2	2	2
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1	0.06	44.0	4	2	0
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null	2-UNIMOD:1	0.12	44.0	3	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	2-UNIMOD:1,18-UNIMOD:35	0.23	44.0	11	3	1
PRT	sp|Q9NRI5-11|DISC1_HUMAN	Isoform 11 of Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.10	44.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	2-UNIMOD:1	0.18	44.0	12	1	0
PRT	sp|Q9UID3|VPS51_HUMAN	Vacuolar protein sorting-associated protein 51 homolog OS=Homo sapiens OX=9606 GN=VPS51 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1	0.04	43.0	2	2	2
PRT	sp|Q99615|DNJC7_HUMAN	DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,7-UNIMOD:4,11-UNIMOD:35	0.05	43.0	5	1	0
PRT	sp|Q6NXT6-2|TAPT1_HUMAN	Isoform 2 of Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens OX=9606 GN=TAPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.04	43.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.16	43.0	10	2	0
PRT	sp|Q9NQC3-2|RTN4_HUMAN	Isoform B of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	43.0	6	1	0
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.10	43.0	2	2	2
PRT	sp|P68402-3|PA1B2_HUMAN	Isoform 3 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43.0	null	2-UNIMOD:1	0.17	43.0	5	1	0
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,25-UNIMOD:35	0.07	43.0	2	1	0
PRT	sp|Q9Y2K2-7|SIK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.02	42.0	1	1	1
PRT	sp|Q9UBF6-3|RBX2_HUMAN	Isoform 3 of RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,11-UNIMOD:4	0.24	42.0	1	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.06	42.0	8	1	0
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.09	42.0	2	1	0
PRT	sp|Q8IWT0-2|ARCH_HUMAN	Isoform 2 of Protein archease OS=Homo sapiens OX=9606 GN=ZBTB8OS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.13	42.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	716-UNIMOD:35	0.05	42.0	12	2	1
PRT	sp|Q13613-2|MTMR1_HUMAN	Isoform 1A of Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,12-UNIMOD:4	0.05	42.0	2	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	42.0	13	2	0
PRT	sp|P35520|CBS_HUMAN	Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	15-UNIMOD:4	0.03	42.0	3	1	0
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1,25-UNIMOD:35	0.08	42.0	7	2	0
PRT	sp|Q6NSI4-2|RADX_HUMAN	Isoform 2 of RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42.0	null	2-UNIMOD:1	0.04	42.0	4	2	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	3-UNIMOD:1,815-UNIMOD:35	0.08	42.0	3	2	1
PRT	sp|Q4ZIN3|MBRL_HUMAN	Membralin OS=Homo sapiens OX=9606 GN=TMEM259 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.04	42.0	2	1	0
PRT	sp|Q9NR33|DPOE4_HUMAN	DNA polymerase epsilon subunit 4 OS=Homo sapiens OX=9606 GN=POLE4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.31	41.0	3	1	0
PRT	sp|P78381-3|S35A2_HUMAN	Isoform 3 of UDP-galactose translocator OS=Homo sapiens OX=9606 GN=SLC35A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.13	41.0	2	1	0
PRT	sp|Q9P2K5-4|MYEF2_HUMAN	Isoform 4 of Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.23	41.0	2	1	0
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	2-UNIMOD:1,20-UNIMOD:35,22-UNIMOD:4	0.17	41.0	14	2	0
PRT	sp|Q5VWJ9|SNX30_HUMAN	Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.04	41.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1	0.09	41.0	2	1	0
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	254-UNIMOD:4,239-UNIMOD:35	0.10	41.0	6	3	0
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	274-UNIMOD:35	0.10	41.0	1	1	0
PRT	sp|Q15714-2|T22D1_HUMAN	Isoform 2 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.33	41.0	1	1	1
PRT	sp|Q16644|MAPK3_HUMAN	MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	41.0	5	2	1
PRT	sp|O95999|BCL10_HUMAN	B-cell lymphoma/leukemia 10 OS=Homo sapiens OX=9606 GN=BCL10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	41.0	3	1	0
PRT	sp|O43347|MSI1H_HUMAN	RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:4	0.06	41.0	2	1	0
PRT	sp|Q7Z6I8-2|CE024_HUMAN	Isoform 2 of UPF0461 protein C5orf24 OS=Homo sapiens OX=9606 GN=C5orf24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	0.17	41.0	1	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null		0.15	41.0	8	2	0
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1,9-UNIMOD:4,11-UNIMOD:35,15-UNIMOD:4,29-UNIMOD:35	0.11	40.0	13	2	0
PRT	sp|Q96EV2-2|RBM33_HUMAN	Isoform 2 of RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.10	40.0	2	2	1
PRT	sp|Q16831|UPP1_HUMAN	Uridine phosphorylase 1 OS=Homo sapiens OX=9606 GN=UPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1,17-UNIMOD:4	0.06	40.0	1	1	1
PRT	sp|Q96L92-3|SNX27_HUMAN	Isoform 2 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.03	40.0	3	1	0
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.04	40.0	3	2	1
PRT	sp|Q9Y4L5|RN115_HUMAN	E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens OX=9606 GN=RNF115 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.06	40.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1,9-UNIMOD:35	0.05	40.0	9	2	0
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.13	40.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	40.0	5	2	0
PRT	sp|Q9P1F3|ABRAL_HUMAN	Costars family protein ABRACL OS=Homo sapiens OX=9606 GN=ABRACL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35	0.20	40.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null		0.27	40.0	7	3	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.08	40.0	2	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1	0.12	40.0	2	1	0
PRT	sp|O75582|KS6A5_HUMAN	Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	40.0	1	1	1
PRT	sp|Q13613|MTMR1_HUMAN	Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.04	40.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.07	39.0	5	2	1
PRT	sp|Q8TCF1-4|ZFAN1_HUMAN	Isoform 4 of AN1-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=ZFAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,10-UNIMOD:4,15-UNIMOD:4	0.07	39.0	1	1	1
PRT	sp|Q9H098|F107B_HUMAN	Protein FAM107B OS=Homo sapiens OX=9606 GN=FAM107B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.14	39.0	2	1	0
PRT	sp|Q9BZX2|UCK2_HUMAN	Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.12	39.0	2	1	0
PRT	sp|O15357|SHIP2_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,5-UNIMOD:4	0.02	39.0	2	1	0
PRT	sp|Q99755-2|PI51A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,24-UNIMOD:4	0.07	39.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	2	2
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	2	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:35	0.10	39.0	27	5	2
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|A0AVT1-4|UBA6_HUMAN	Isoform 4 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,17-UNIMOD:4,1-UNIMOD:35	0.08	39.0	2	1	0
PRT	sp|Q9NX76|CKLF6_HUMAN	CKLF-like MARVEL transmembrane domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CMTM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	39.0	7	2	1
PRT	sp|Q96ET8-2|TV23C_HUMAN	Isoform 2 of Golgi apparatus membrane protein TVP23 homolog C OS=Homo sapiens OX=9606 GN=TVP23C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	39.0	2	1	0
PRT	sp|P11908|PRPS2_HUMAN	Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1	0.11	39.0	3	1	0
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.08	39.0	3	2	1
PRT	sp|Q99729-2|ROAA_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,10-UNIMOD:35	0.21	39.0	13	2	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	39.0	14	1	0
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,3-UNIMOD:1	0.02	38.0	3	2	1
PRT	sp|O15514|RPB4_HUMAN	DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.16	38.0	4	1	0
PRT	sp|Q6PCB5|RSBNL_HUMAN	Lysine-specific demethylase RSBN1L OS=Homo sapiens OX=9606 GN=RSBN1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	38.0	2	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.05	38.0	2	1	0
PRT	sp|Q9BYP7-3|WNK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.01	38.0	1	1	1
PRT	sp|Q8TEB1-2|DCA11_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 11 OS=Homo sapiens OX=9606 GN=DCAF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.04	38.0	2	1	0
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	4	2	1
PRT	sp|Q9HCD5|NCOA5_HUMAN	Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.13	38.0	3	2	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.30	38.0	5	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.05	38.0	5	1	0
PRT	sp|Q9NQ92|COPRS_HUMAN	Coordinator of PRMT5 and differentiation stimulator OS=Homo sapiens OX=9606 GN=COPRS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	38.0	3	1	0
PRT	sp|Q8WUD4|CCD12_HUMAN	Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	38.0	3	1	0
PRT	sp|Q9NWK9-2|BCD1_HUMAN	Isoform 2 of Box C/D snoRNA protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	38.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	38.0	4	2	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.05	38.0	4	2	0
PRT	sp|Q9NSK0-2|KLC4_HUMAN	Isoform 2 of Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1	0.11	38.0	2	1	0
PRT	sp|P08397-3|HEM3_HUMAN	Isoform 3 of Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,18-UNIMOD:35	0.06	38.0	2	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:4,617-UNIMOD:35,621-UNIMOD:35	0.13	38.0	29	3	0
PRT	sp|Q96JN8|NEUL4_HUMAN	Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.03	38.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	38.0	2	1	0
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,5-UNIMOD:35	0.18	37.0	4	1	0
PRT	sp|Q02978-2|M2OM_HUMAN	Isoform 2 of Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.06	37.0	4	2	1
PRT	sp|P49354-2|FNTA_HUMAN	Isoform 2 of Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.11	37.0	4	1	0
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,18-UNIMOD:4	0.05	37.0	6	2	0
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null		0.14	37.0	9	2	0
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,9-UNIMOD:4	0.10	37.0	1	1	1
PRT	sp|O95670-2|VATG2_HUMAN	Isoform 2 of V-type proton ATPase subunit G 2 OS=Homo sapiens OX=9606 GN=ATP6V1G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.21	37.0	3	2	0
PRT	sp|O15294-3|OGT1_HUMAN	Isoform 1 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.02	37.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	305-UNIMOD:35,2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:1	0.13	37.0	133	5	1
PRT	sp|O43815-2|STRN_HUMAN	Isoform 2 of Striatin OS=Homo sapiens OX=9606 GN=STRN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	37.0	4	1	0
PRT	sp|P55060-2|XPO2_HUMAN	Isoform 2 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	37.0	3	1	0
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	1-UNIMOD:1,1-UNIMOD:35	0.19	37.0	10	2	0
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.15	37.0	20	1	0
PRT	sp|P05423|RPC4_HUMAN	DNA-directed RNA polymerase III subunit RPC4 OS=Homo sapiens OX=9606 GN=POLR3D PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1	0.06	37.0	2	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.08	37.0	2	1	0
PRT	sp|Q92522|H1X_HUMAN	Histone H1.10 OS=Homo sapiens OX=9606 GN=H1-10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:35	0.09	37.0	10	2	0
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,21-UNIMOD:4	0.10	36.0	2	1	0
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.04	36.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,10-UNIMOD:35,706-UNIMOD:35	0.05	36.0	9	3	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,17-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9GZT9-3|EGLN1_HUMAN	Isoform 3 of Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.05	36.0	3	2	1
PRT	sp|Q5RL73|RBM48_HUMAN	RNA-binding protein 48 OS=Homo sapiens OX=9606 GN=RBM48 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.05	36.0	2	1	0
PRT	sp|O15294|OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.02	36.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	110-UNIMOD:35,125-UNIMOD:35,144-UNIMOD:35	0.08	36.0	1	1	0
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.22	36.0	3	2	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	0.06	36.0	5	1	0
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	36.0	3	2	1
PRT	sp|Q9NY93-2|DDX56_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens OX=9606 GN=DDX56	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,12-UNIMOD:35,1-UNIMOD:35	0.03	36.0	7	1	0
PRT	sp|Q96JC9|EAF1_HUMAN	ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	0.06	36.0	1	1	1
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.16	36.0	2	2	2
PRT	sp|Q15555-2|MARE2_HUMAN	Isoform 2 of Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	3	2	1
PRT	sp|Q15008|PSMD6_HUMAN	26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	5	2	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.09	36.0	13	3	1
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1,16-UNIMOD:4	0.08	36.0	3	1	0
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,9-UNIMOD:35,13-UNIMOD:4	0.06	36.0	19	2	0
PRT	sp|O43768-8|ENSA_HUMAN	Isoform 8 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.16	36.0	2	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.03	36.0	7	2	0
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.07	36.0	3	1	0
PRT	sp|Q6IA86-4|ELP2_HUMAN	Isoform 4 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	13-UNIMOD:4,14-UNIMOD:4,2-UNIMOD:1	0.02	36.0	3	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36.0	null	1-UNIMOD:35	0.08	36.0	3	2	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	5	2	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,16-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.08	35.0	2	2	2
PRT	sp|Q6P1K2-3|PMF1_HUMAN	Isoform 3 of Polyamine-modulated factor 1 OS=Homo sapiens OX=9606 GN=PMF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,13-UNIMOD:4	0.09	35.0	2	2	2
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1,18-UNIMOD:35	0.00	35.0	1	1	1
PRT	sp|Q86TI2-4|DPP9_HUMAN	Isoform 3 of Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,3-UNIMOD:1	0.05	35.0	45	2	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	6	3	2
PRT	sp|Q9UKY7|CDV3_HUMAN	Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	164-UNIMOD:35,2-UNIMOD:1	0.16	35.0	6	2	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.13	35.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	35.0	5	3	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	35.0	3	1	0
PRT	sp|Q15369|ELOC_HUMAN	Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:35	0.18	35.0	4	1	0
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	35.0	9	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	156-UNIMOD:35,162-UNIMOD:35	0.07	35.0	3	2	1
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	4	2	0
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.03	35.0	2	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.09	35.0	2	1	0
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,5-UNIMOD:4,16-UNIMOD:4	0.05	35.0	3	1	0
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.05	35.0	2	2	2
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.02	35.0	2	1	0
PRT	sp|Q99707|METH_HUMAN	Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|Q16585|SGCB_HUMAN	Beta-sarcoglycan OS=Homo sapiens OX=9606 GN=SGCB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1	0.06	35.0	1	1	1
PRT	sp|Q7Z7E8|UB2Q1_HUMAN	Ubiquitin-conjugating enzyme E2 Q1 OS=Homo sapiens OX=9606 GN=UBE2Q1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	1-UNIMOD:1,40-UNIMOD:4,1-UNIMOD:35	0.10	35.0	5	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	0.16	35.0	2	2	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35.0	null		0.08	35.0	1	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,13-UNIMOD:4,3-UNIMOD:1	0.09	34.0	7	4	2
PRT	sp|P53609-2|PGTB1_HUMAN	Isoform 2 of Geranylgeranyl transferase type-1 subunit beta OS=Homo sapiens OX=9606 GN=PGGT1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.05	34.0	1	1	1
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.09	34.0	2	1	0
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.28	34.0	6	2	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	34.0	3	1	0
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.06	34.0	5	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q6S8J3|POTEE_HUMAN	POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	10	1	0
PRT	sp|O43504|LTOR5_HUMAN	Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,13-UNIMOD:35,1-UNIMOD:35	0.15	34.0	5	1	0
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.05	34.0	6	3	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	0.02	34.0	4	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	34.0	5	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	3-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|Q12996-3|CSTF3_HUMAN	Isoform 3 of Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.41	34.0	3	2	1
PRT	sp|Q13867|BLMH_HUMAN	Bleomycin hydrolase OS=Homo sapiens OX=9606 GN=BLMH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.04	34.0	3	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,905-UNIMOD:4	0.03	34.0	2	2	2
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.06	34.0	4	2	1
PRT	sp|Q7Z6I8|CE024_HUMAN	UPF0461 protein C5orf24 OS=Homo sapiens OX=9606 GN=C5orf24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	0.14	34.0	1	1	0
PRT	sp|Q9UBL3|ASH2L_HUMAN	Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Homo sapiens OX=9606 GN=ASH2L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,32-UNIMOD:35	0.05	34.0	3	1	0
PRT	sp|O75157|T22D2_HUMAN	TSC22 domain family protein 2 OS=Homo sapiens OX=9606 GN=TSC22D2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,3-UNIMOD:1	0.18	33.0	9	3	0
PRT	sp|Q15554-4|TERF2_HUMAN	Isoform 2 of Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.09	33.0	2	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	3	2	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,37-UNIMOD:35	0.10	33.0	2	1	0
PRT	sp|Q9H9E3-2|COG4_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens OX=9606 GN=COG4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.07	33.0	1	1	1
PRT	sp|P47755-2|CAZA2_HUMAN	Isoform 2 of F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.08	33.0	3	2	1
PRT	sp|Q9NQ48|LZTL1_HUMAN	Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,18-UNIMOD:35	0.06	33.0	3	1	0
PRT	sp|O75182-2|SIN3B_HUMAN	Isoform 2 of Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.02	33.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.07	33.0	2	1	0
PRT	sp|Q9H7Z3|NRDE2_HUMAN	Nuclear exosome regulator NRDE2 OS=Homo sapiens OX=9606 GN=NRDE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.02	33.0	3	2	1
PRT	sp|Q99755-4|PI51A_HUMAN	Isoform 4 of Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,24-UNIMOD:4	0.07	33.0	2	1	0
PRT	sp|Q9UK61-3|TASOR_HUMAN	Isoform 3 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,10-UNIMOD:4,27-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.03	33.0	5	2	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,12-UNIMOD:35,14-UNIMOD:35,8-UNIMOD:35	0.02	33.0	12	1	0
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	33.0	2	1	0
PRT	sp|Q7RTP0|NIPA1_HUMAN	Magnesium transporter NIPA1 OS=Homo sapiens OX=9606 GN=NIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.06	33.0	1	1	1
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	144-UNIMOD:35,147-UNIMOD:35	0.11	33.0	8	1	0
PRT	sp|P27694|RFA1_HUMAN	Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	14-UNIMOD:35,1-UNIMOD:35	0.08	33.0	10	3	0
PRT	sp|Q9UHD8-3|SEPT9_HUMAN	Isoform 3 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	33.0	5	1	0
PRT	sp|O95677-3|EYA4_HUMAN	Isoform 3 of Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=EYA4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	33.0	3	1	0
PRT	sp|P53384-2|NUBP1_HUMAN	Isoform 2 of Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,8-UNIMOD:4,1-UNIMOD:35	0.06	33.0	3	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	33.0	21	2	0
PRT	sp|Q9UJA5-3|TRM6_HUMAN	Isoform 3 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	33.0	2	1	0
PRT	sp|Q9BT23|LIMD2_HUMAN	LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.20	33.0	3	2	1
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.03	33.0	4	1	0
PRT	sp|O15116|LSM1_HUMAN	U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens OX=9606 GN=LSM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.13	33.0	4	1	0
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	33.0	4	1	0
PRT	sp|Q9NZL9-4|MAT2B_HUMAN	Isoform 4 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	4-UNIMOD:35,8-UNIMOD:35	0.06	33.0	3	1	0
PRT	sp|Q96EK4|THA11_HUMAN	THAP domain-containing protein 11 OS=Homo sapiens OX=9606 GN=THAP11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	6-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q8N5W9|RFLB_HUMAN	Refilin-B OS=Homo sapiens OX=9606 GN=RFLNB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	81-UNIMOD:4	0.16	33.0	2	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.06	33.0	10	1	0
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.07	33.0	3	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.09	33.0	12	3	1
PRT	sp|Q16352|AINX_HUMAN	Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	3	2	1
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,17-UNIMOD:35	0.03	33.0	5	1	0
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.06	33.0	3	1	0
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,13-UNIMOD:35	0.08	33.0	16	1	0
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.09	33.0	2	2	1
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.10	33.0	1	1	0
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,18-UNIMOD:4	0.11	33.0	2	1	0
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1,5-UNIMOD:35	0.06	33.0	3	1	0
PRT	sp|P78406|RAE1L_HUMAN	mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,17-UNIMOD:35,29-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.03	32.0	4	2	1
PRT	sp|Q05397-7|FAK1_HUMAN	Isoform 7 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.02	32.0	1	1	1
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,19-UNIMOD:35	0.07	32.0	2	1	0
PRT	sp|Q9NY33-2|DPP3_HUMAN	Isoform 2 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,19-UNIMOD:4	0.06	32.0	3	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,10-UNIMOD:4	0.00	32.0	1	1	1
PRT	sp|Q6P1Q9|MET2B_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	2	1	0
PRT	sp|Q96IZ6|MET2A_HUMAN	tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	1	1	1
PRT	sp|Q9C0D9|EPT1_HUMAN	Ethanolaminephosphotransferase 1 OS=Homo sapiens OX=9606 GN=SELENOI PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.05	32.0	4	2	0
PRT	sp|P52655|TF2AA_HUMAN	Transcription initiation factor IIA subunit 1 OS=Homo sapiens OX=9606 GN=GTF2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.04	32.0	2	1	0
PRT	sp|Q16514-2|TAF12_HUMAN	Isoform TAFII15 of Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.14	32.0	3	1	0
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.03	32.0	3	1	0
PRT	sp|Q9Y530|OARD1_HUMAN	ADP-ribose glycohydrolase OARD1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.11	32.0	1	1	1
PRT	sp|Q13228-3|SBP1_HUMAN	Isoform 3 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,5-UNIMOD:4,8-UNIMOD:4,19-UNIMOD:35	0.05	32.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,7-UNIMOD:35	0.03	32.0	3	2	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.13	32.0	2	1	0
PRT	sp|Q99504-5|EYA3_HUMAN	Isoform 5 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	32.0	4	1	0
PRT	sp|O95573|ACSL3_HUMAN	Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.02	32.0	2	1	0
PRT	sp|Q7L266|ASGL1_HUMAN	Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens OX=9606 GN=ASRGL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	32.0	2	2	2
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q86SK9-2|SCD5_HUMAN	Isoform 2 of Stearoyl-CoA desaturase 5 OS=Homo sapiens OX=9606 GN=SCD5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	14-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|Q7Z7K6-3|CENPV_HUMAN	Isoform 3 of Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.16	32.0	2	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	339-UNIMOD:35,342-UNIMOD:35	0.08	32.0	3	2	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.03	32.0	2	2	2
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.15	32.0	2	1	0
PRT	sp|Q14353|GAMT_HUMAN	Guanidinoacetate N-methyltransferase OS=Homo sapiens OX=9606 GN=GAMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,16-UNIMOD:4	0.14	32.0	1	1	1
PRT	sp|Q12962|TAF10_HUMAN	Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,3-UNIMOD:4	0.19	32.0	2	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.02	32.0	3	1	0
PRT	sp|Q13542|4EBP2_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 2 OS=Homo sapiens OX=9606 GN=EIF4EBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1	0.12	32.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.11	32.0	7	3	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.16	32.0	4	2	0
PRT	sp|P20290-2|BTF3_HUMAN	Isoform 2 of Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.08	32.0	8	2	0
PRT	sp|Q6PI98|IN80C_HUMAN	INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.10	31.0	2	1	0
PRT	sp|Q9Y5X3-2|SNX5_HUMAN	Isoform 2 of Sorting nexin-5 OS=Homo sapiens OX=9606 GN=SNX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.13	31.0	4	2	0
PRT	sp|P00167-2|CYB5_HUMAN	Isoform 2 of Cytochrome b5 OS=Homo sapiens OX=9606 GN=CYB5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.18	31.0	1	1	1
PRT	sp|Q9BTD8-4|RBM42_HUMAN	Isoform 4 of RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.07	31.0	3	1	0
PRT	sp|P85298-2|RHG08_HUMAN	Isoform 2 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.06	31.0	2	1	0
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	2	1	0
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	31.0	3	1	0
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,15-UNIMOD:4	0.02	31.0	2	1	0
PRT	sp|P49321-4|NASP_HUMAN	Isoform 4 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1,3-UNIMOD:35,629-UNIMOD:35	0.12	31.0	4	4	3
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	79-UNIMOD:4	0.14	31.0	3	2	1
PRT	sp|P54819-3|KAD2_HUMAN	Isoform 3 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	31.0	7	3	0
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	31.0	4	1	0
PRT	sp|Q9Y462|ZN711_HUMAN	Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	31.0	3	1	0
PRT	sp|Q8WYA6|CTBL1_HUMAN	Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	31.0	10	2	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	31.0	3	1	0
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	31.0	8	3	0
PRT	sp|Q13627-4|DYR1A_HUMAN	Isoform 3 of Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.04	31.0	20	4	0
PRT	sp|Q92879-2|CELF1_HUMAN	Isoform 2 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	31.0	4	1	0
PRT	sp|Q8WUH6|TM263_HUMAN	Transmembrane protein 263 OS=Homo sapiens OX=9606 GN=TMEM263 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	0.22	31.0	8	1	0
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	5-UNIMOD:35,7-UNIMOD:35	0.01	31.0	6	1	0
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null		0.09	31.0	5	1	0
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	2	1	0
PRT	sp|P30519|HMOX2_HUMAN	Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.05	31.0	3	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	16	1	0
PRT	sp|Q13492-3|PICAL_HUMAN	Isoform 3 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.04	31.0	1	1	1
PRT	sp|Q8TBZ6|TM10A_HUMAN	tRNA methyltransferase 10 homolog A OS=Homo sapiens OX=9606 GN=TRMT10A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,5-UNIMOD:35	0.05	31.0	5	1	0
PRT	sp|Q6NSI4|RADX_HUMAN	RPA-related protein RADX OS=Homo sapiens OX=9606 GN=RADX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.03	31.0	1	1	0
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1	0.02	31.0	2	1	0
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	182-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|Q7L7V1|DHX32_HUMAN	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens OX=9606 GN=DHX32 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	31.0	1	1	0
PRT	sp|Q05519|SRS11_HUMAN	Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,49-UNIMOD:35	0.10	31.0	3	1	0
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,4-UNIMOD:4	0.02	31.0	3	1	0
PRT	sp|Q13049|TRI32_HUMAN	E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.02	30.0	1	1	1
PRT	sp|Q16576-2|RBBP7_HUMAN	Isoform 2 of Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	1	1	1
PRT	sp|Q9NRY2-2|SOSSC_HUMAN	Isoform 2 of SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.32	30.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	2	1	0
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,5-UNIMOD:4	0.04	30.0	2	1	0
PRT	sp|Q92599-2|SEPT8_HUMAN	Isoform 2 of Septin-8 OS=Homo sapiens OX=9606 GN=SEPTIN8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.03	30.0	4	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:4,12-UNIMOD:35	0.01	30.0	4	2	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,135-UNIMOD:4	0.11	30.0	3	2	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:35	0.03	30.0	8	2	0
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,12-UNIMOD:35	0.03	30.0	3	1	0
PRT	sp|Q14CS0|UBX2B_HUMAN	UBX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=UBXN2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.04	30.0	1	1	1
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.15	30.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.03	30.0	4	1	0
PRT	sp|Q9NYJ8-2|TAB2_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Homo sapiens OX=9606 GN=TAB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.03	30.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:4	0.01	30.0	2	1	0
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.01	30.0	2	2	2
PRT	sp|Q16600|ZN239_HUMAN	Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,11-UNIMOD:4	0.03	30.0	2	1	0
PRT	sp|Q9P0P0|RN181_HUMAN	E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens OX=9606 GN=RNF181 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:4	0.12	30.0	2	1	0
PRT	sp|Q7LG56-5|RIR2B_HUMAN	Isoform 5 of Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.37	30.0	2	1	0
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P10809-2|CH60_HUMAN	Isoform 2 of 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.16	30.0	2	1	0
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	30.0	23	2	0
PRT	sp|Q9H871-2|RMD5A_HUMAN	Isoform 2 of E3 ubiquitin-protein transferase RMND5A OS=Homo sapiens OX=9606 GN=RMND5A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,4-UNIMOD:4,1-UNIMOD:35	0.13	30.0	2	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	30.0	5	2	0
PRT	sp|Q7L7V1-2|DHX32_HUMAN	Isoform 2 of Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens OX=9606 GN=DHX32	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	30.0	1	1	0
PRT	sp|Q8WV99-2|ZFN2B_HUMAN	Isoform 2 of AN1-type zinc finger protein 2B OS=Homo sapiens OX=9606 GN=ZFAND2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,10-UNIMOD:4,15-UNIMOD:4,1-UNIMOD:35	0.10	30.0	2	1	0
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	30.0	1	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,2-UNIMOD:1	0.03	30.0	6	2	0
PRT	sp|O43715|TRIA1_HUMAN	TP53-regulated inhibitor of apoptosis 1 OS=Homo sapiens OX=9606 GN=TRIAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	0.17	30.0	5	1	0
PRT	sp|Q9H1I8-3|ASCC2_HUMAN	Isoform 3 of Activating signal cointegrator 1 complex subunit 2 OS=Homo sapiens OX=9606 GN=ASCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	8-UNIMOD:4,17-UNIMOD:4	0.03	30.0	3	1	0
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	312-UNIMOD:35,330-UNIMOD:35,331-UNIMOD:35	0.10	30.0	1	1	0
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:35	0.05	30.0	5	2	0
PRT	sp|O75528-2|TADA3_HUMAN	Isoform 2 of Transcriptional adapter 3 OS=Homo sapiens OX=9606 GN=TADA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,7-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:35	0.05	30.0	10	2	0
PRT	sp|Q15596|NCOA2_HUMAN	Nuclear receptor coactivator 2 OS=Homo sapiens OX=9606 GN=NCOA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,4-UNIMOD:35	0.01	30.0	2	1	0
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.05	30.0	2	2	2
PRT	sp|Q96GD4-4|AURKB_HUMAN	Isoform 4 of Aurora kinase B OS=Homo sapiens OX=9606 GN=AURKB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.05	30.0	1	1	1
PRT	sp|P07197|NFM_HUMAN	Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.02	30.0	2	2	2
PRT	sp|Q9BV86-2|NTM1A_HUMAN	Isoform 2 of N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=NTMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.10	30.0	3	2	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|Q9Y664|KPTN_HUMAN	KICSTOR complex protein kaptin OS=Homo sapiens OX=9606 GN=KPTN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:1,12-UNIMOD:4	0.04	30.0	2	2	2
PRT	sp|Q9NZL9-2|MAT2B_HUMAN	Isoform 2 of Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	4-UNIMOD:35	0.06	30.0	1	1	0
PRT	sp|P08397|HEM3_HUMAN	Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,18-UNIMOD:35	0.05	30.0	8	1	0
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.02	30.0	2	1	0
PRT	sp|Q8TB52|FBX30_HUMAN	F-box only protein 30 OS=Homo sapiens OX=9606 GN=FBXO30 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,10-UNIMOD:4,13-UNIMOD:4,1-UNIMOD:35	0.02	30.0	2	1	0
PRT	sp|Q8N0Z6|TTC5_HUMAN	Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:1	0.03	30.0	2	1	0
PRT	sp|Q9H7Z6|KAT8_HUMAN	Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1	0.09	30.0	2	1	0
PRT	sp|O43598-2|DNPH1_HUMAN	Isoform 2 of 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,5-UNIMOD:35	0.09	29.0	3	1	0
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	2	1	0
PRT	sp|Q9Y5Q8-2|TF3C5_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.04	29.0	2	2	2
PRT	sp|Q9BW30|TPPP3_HUMAN	Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens OX=9606 GN=TPPP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.09	29.0	1	1	1
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.04	29.0	3	1	0
PRT	sp|P29083|T2EA_HUMAN	General transcription factor IIE subunit 1 OS=Homo sapiens OX=9606 GN=GTF2E1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.03	29.0	2	2	2
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,14-UNIMOD:35	0.04	29.0	5	2	1
PRT	sp|Q9UHD9|UBQL2_HUMAN	Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.02	29.0	7	1	0
PRT	sp|Q8TAG9|EXOC6_HUMAN	Exocyst complex component 6 OS=Homo sapiens OX=9606 GN=EXOC6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	2	1	0
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.09	29.0	4	2	0
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,3-UNIMOD:35,17-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|Q9HB71-2|CYBP_HUMAN	Isoform 2 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.16	29.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	3	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.02	29.0	2	1	0
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPTIN11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.03	29.0	2	1	0
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,369-UNIMOD:4	0.07	29.0	6	3	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	527-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	29.0	5	2	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	276-UNIMOD:35	0.04	29.0	3	1	0
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	264-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.12	29.0	7	2	0
PRT	sp|Q9H0L4|CSTFT_HUMAN	Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1,11-UNIMOD:35	0.07	29.0	4	2	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	2	2	2
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	3	1	0
PRT	sp|Q5BKZ1-2|ZN326_HUMAN	Isoform 2 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.19	29.0	5	1	0
PRT	sp|Q8IWJ2-3|GCC2_HUMAN	Isoform 2 of GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.42	29.0	4	1	0
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	3	1	0
PRT	sp|Q9P035-2|HACD3_HUMAN	Isoform 2 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|O43299-2|AP5Z1_HUMAN	Isoform 2 of AP-5 complex subunit zeta-1 OS=Homo sapiens OX=9606 GN=AP5Z1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,3-UNIMOD:4,1-UNIMOD:35,2-UNIMOD:35	0.24	29.0	8	1	0
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	29.0	16	1	0
PRT	sp|O95758-6|PTBP3_HUMAN	Isoform 6 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q9BXJ9-4|NAA15_HUMAN	Isoform 2 of N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	20	1	0
PRT	sp|Q9Y6B7-2|AP4B1_HUMAN	Isoform 2 of AP-4 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP4B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.15	29.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.07	29.0	4	1	0
PRT	sp|P07108|ACBP_HUMAN	Acyl-CoA-binding protein OS=Homo sapiens OX=9606 GN=DBI PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.15	29.0	1	1	1
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.01	29.0	2	1	0
PRT	sp|Q15836|VAMP3_HUMAN	Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.13	29.0	2	2	2
PRT	sp|Q8N6T7-2|SIR6_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens OX=9606 GN=SIRT6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	2-UNIMOD:1	0.05	29.0	2	2	2
PRT	sp|Q9Y3D0|CIA2B_HUMAN	Cytosolic iron-sulfur assembly component 2B OS=Homo sapiens OX=9606 GN=CIAO2B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	29.0	5	2	1
PRT	sp|Q5VTL8|PR38B_HUMAN	Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,29-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q96NB2|SFXN2_HUMAN	Sideroflexin-2 OS=Homo sapiens OX=9606 GN=SFXN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	29.0	2	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	653-UNIMOD:35,657-UNIMOD:35,658-UNIMOD:35,662-UNIMOD:35	0.05	29.0	39	1	0
PRT	sp|Q9H4I3|TRABD_HUMAN	TraB domain-containing protein OS=Homo sapiens OX=9606 GN=TRABD PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	29.0	2	1	0
PRT	sp|Q9Y262|EIF3L_HUMAN	Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,25-UNIMOD:35	0.05	29.0	6	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	28.0	5	1	0
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	2	1	0
PRT	sp|P23610|HAP40_HUMAN	40-kDa huntingtin-associated protein OS=Homo sapiens OX=9606 GN=F8A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.06	28.0	3	1	0
PRT	sp|Q9HCJ3-2|RAVR2_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 2 OS=Homo sapiens OX=9606 GN=RAVER2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.00	28.0	3	2	1
PRT	sp|O95249|GOSR1_HUMAN	Golgi SNAP receptor complex member 1 OS=Homo sapiens OX=9606 GN=GOSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.05	28.0	2	1	0
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.01	28.0	4	2	0
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,10-UNIMOD:35	0.04	28.0	4	2	0
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,14-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q53HC0-2|CCD92_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 92 OS=Homo sapiens OX=9606 GN=CCDC92	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.01	28.0	2	1	0
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.03	28.0	3	2	1
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,15-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P36873|PP1G_HUMAN	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.04	28.0	2	1	0
PRT	sp|Q9UK97-2|FBX9_HUMAN	Isoform 2 of F-box only protein 9 OS=Homo sapiens OX=9606 GN=FBXO9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,8-UNIMOD:4	0.03	28.0	2	1	0
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.08	28.0	4	1	0
PRT	sp|P33240-2|CSTF2_HUMAN	Isoform 2 of Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	2	1	0
PRT	sp|A6NKD9|CC85C_HUMAN	Coiled-coil domain-containing protein 85C OS=Homo sapiens OX=9606 GN=CCDC85C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	1	1	1
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,12-UNIMOD:35	0.07	28.0	3	1	0
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,15-UNIMOD:35	0.02	28.0	3	2	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|Q96NC0|ZMAT2_HUMAN	Zinc finger matrin-type protein 2 OS=Homo sapiens OX=9606 GN=ZMAT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	2	1	0
PRT	sp|Q8WWZ3-2|EDAD_HUMAN	Isoform B of Ectodysplasin-A receptor-associated adapter protein OS=Homo sapiens OX=9606 GN=EDARADD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,13-UNIMOD:35	0.07	28.0	2	1	0
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.12	28.0	2	1	0
PRT	sp|Q99614|TTC1_HUMAN	Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,8-UNIMOD:4	0.06	28.0	7	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	12-UNIMOD:35	0.03	28.0	4	1	0
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q9UHX1-6|PUF60_HUMAN	Isoform 6 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,15-UNIMOD:35	0.08	28.0	3	2	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	28.0	2	1	0
PRT	sp|Q8N3P4-2|VPS8_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens OX=9606 GN=VPS8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q5VSL9-4|STRP1_HUMAN	Isoform 4 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	28.0	3	1	0
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.02	28.0	4	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.04	28.0	6	3	1
PRT	sp|Q9Y2Y1|RPC10_HUMAN	DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens OX=9606 GN=POLR3K PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:4	0.18	28.0	1	1	1
PRT	sp|Q6ZTU2-4|E400N_HUMAN	Isoform 3 of Putative EP400-like protein OS=Homo sapiens OX=9606 GN=EP400P1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|Q14657|LAGE3_HUMAN	EKC/KEOPS complex subunit LAGE3 OS=Homo sapiens OX=9606 GN=LAGE3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	28.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.16	28.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null		0.10	28.0	3	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	1-UNIMOD:35	0.07	28.0	11	3	1
PRT	sp|Q9Y666-2|S12A7_HUMAN	Isoform 2 of Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	270-UNIMOD:4,274-UNIMOD:4	0.08	28.0	3	1	0
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|P30260|CDC27_HUMAN	Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|P22102-2|PUR2_HUMAN	Isoform Short of Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	233-UNIMOD:35,237-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|P63165|SUMO1_HUMAN	Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.15	28.0	1	1	1
PRT	sp|Q9NUJ3|T11L1_HUMAN	T-complex protein 11-like protein 1 OS=Homo sapiens OX=9606 GN=TCP11L1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.03	28.0	2	1	0
PRT	sp|P41212|ETV6_HUMAN	Transcription factor ETV6 OS=Homo sapiens OX=9606 GN=ETV6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,8-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.06	28.0	2	1	0
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.12	28.0	5	2	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.03	28.0	3	1	0
PRT	sp|Q8TAE6|PP14C_HUMAN	Protein phosphatase 1 regulatory subunit 14C OS=Homo sapiens OX=9606 GN=PPP1R14C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.12	28.0	1	1	1
PRT	sp|Q99717|SMAD5_HUMAN	Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1,4-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|Q16611|BAK_HUMAN	Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,14-UNIMOD:4	0.17	28.0	3	1	0
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.03	28.0	2	1	0
PRT	sp|Q9BXW6|OSBL1_HUMAN	Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	28.0	2	1	0
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	364-UNIMOD:35	0.06	28.0	2	1	0
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	306-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|O95104|SCAF4_HUMAN	SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:1,12-UNIMOD:4	0.02	28.0	1	1	0
PRT	sp|Q9NX46|ADPRS_HUMAN	ADP-ribose glycohydrolase ARH3 OS=Homo sapiens OX=9606 GN=ADPRS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,6-UNIMOD:35	0.05	27.0	2	1	0
PRT	sp|Q99942|RNF5_HUMAN	E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.09	27.0	5	2	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	2	1	0
PRT	sp|Q9NP79|VTA1_HUMAN	Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens OX=9606 GN=VTA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	3	1	0
PRT	sp|Q9Y5J7|TIM9_HUMAN	Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens OX=9606 GN=TIMM9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.16	27.0	3	1	0
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.07	27.0	2	1	0
PRT	sp|Q8ND24-2|RN214_HUMAN	Isoform 2 of RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,23-UNIMOD:4	0.05	27.0	2	1	0
PRT	sp|Q13404-8|UB2V1_HUMAN	Isoform 6 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.11	27.0	4	1	0
PRT	sp|Q8NEM2|SHCBP_HUMAN	SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,16-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q96G46-3|DUS3L_HUMAN	Isoform 3 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.06	27.0	2	1	0
PRT	sp|Q8IXJ6-4|SIR2_HUMAN	Isoform 4 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.06	27.0	2	1	0
PRT	sp|Q9Y5N5-2|N6MT1_HUMAN	Isoform 2 of Methyltransferase N6AMT1 OS=Homo sapiens OX=9606 GN=N6AMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.08	27.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	27.0	5	1	0
PRT	sp|Q86X76-2|NIT1_HUMAN	Isoform 1 of Deaminated glutathione amidase OS=Homo sapiens OX=9606 GN=NIT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,8-UNIMOD:4,16-UNIMOD:4	0.10	27.0	4	1	0
PRT	sp|Q96DG6|CMBL_HUMAN	Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:4	0.06	27.0	3	1	0
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,16-UNIMOD:35	0.04	27.0	2	1	0
PRT	sp|Q9BUP0|EFHD1_HUMAN	EF-hand domain-containing protein D1 OS=Homo sapiens OX=9606 GN=EFHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.05	27.0	2	2	2
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.03	27.0	2	1	0
PRT	sp|Q99627-2|CSN8_HUMAN	Isoform 2 of COP9 signalosome complex subunit 8 OS=Homo sapiens OX=9606 GN=COPS8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1037-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.03	27.0	3	2	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	9	5	3
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	27.0	4	2	1
PRT	sp|O43399-2|TPD54_HUMAN	Isoform 2 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	27.0	4	1	0
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	27.0	3	1	0
PRT	sp|P06132|DCUP_HUMAN	Uroporphyrinogen decarboxylase OS=Homo sapiens OX=9606 GN=UROD PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	27.0	3	1	0
PRT	sp|P19622|HME2_HUMAN	Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:35	0.02	27.0	6	1	0
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.04	27.0	7	1	0
PRT	sp|Q8WVX3|CD003_HUMAN	Uncharacterized protein C4orf3 OS=Homo sapiens OX=9606 GN=C4orf3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.23	27.0	5	1	0
PRT	sp|O00422-2|SAP18_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP18 OS=Homo sapiens OX=9606 GN=SAP18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	27.0	3	1	0
PRT	sp|O95758-1|PTBP3_HUMAN	Isoform 1 of Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q8N138-4|ORML3_HUMAN	Isoform 2 of ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.11	27.0	1	1	1
PRT	sp|Q9P0S3|ORML1_HUMAN	ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	27.0	3	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	27.0	3	1	0
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:4	0.04	27.0	4	3	2
PRT	sp|P58876|H2B1D_HUMAN	Histone H2B type 1-D OS=Homo sapiens OX=9606 GN=H2BC5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.03	27.0	5	1	0
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.02	27.0	2	1	0
PRT	sp|P63218|GBG5_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,10-UNIMOD:35	0.16	27.0	5	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,49-UNIMOD:35	0.10	27.0	1	1	0
PRT	sp|Q2M2Z5-3|KIZ_HUMAN	Isoform 3 of Centrosomal protein kizuna OS=Homo sapiens OX=9606 GN=KIZ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.03	27.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	27.0	5	2	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.01	27.0	2	1	0
PRT	sp|Q96D09|GASP2_HUMAN	G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	3	2	1
PRT	sp|Q9UM13|APC10_HUMAN	Anaphase-promoting complex subunit 10 OS=Homo sapiens OX=9606 GN=ANAPC10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.07	27.0	2	1	0
PRT	sp|P61968|LMO4_HUMAN	LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.20	27.0	3	2	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.07	27.0	6	3	1
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.02	27.0	1	1	0
PRT	sp|Q9NV96|CC50A_HUMAN	Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	3-UNIMOD:1,3-UNIMOD:35,17-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	1-UNIMOD:1	0.04	27.0	2	2	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1	0.15	27.0	6	1	0
PRT	sp|Q13155|AIMP2_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	3-UNIMOD:1,3-UNIMOD:35	0.05	27.0	2	1	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	401-UNIMOD:35,419-UNIMOD:35,420-UNIMOD:35	0.08	27.0	7	1	0
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,16-UNIMOD:4	0.06	27.0	4	1	0
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27.0	null	191-UNIMOD:35	0.09	27.0	1	1	1
PRT	sp|Q9BV44|THUM3_HUMAN	THUMP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THUMPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,2-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,8-UNIMOD:35,21-UNIMOD:35,25-UNIMOD:4	0.09	27.0	9	1	0
PRT	sp|Q96E14|RMI2_HUMAN	RecQ-mediated genome instability protein 2 OS=Homo sapiens OX=9606 GN=RMI2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.10	26.0	2	1	0
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q9H9A5-4|CNO10_HUMAN	Isoform 4 of CCR4-NOT transcription complex subunit 10 OS=Homo sapiens OX=9606 GN=CNOT10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	1	1	1
PRT	sp|P30566-2|PUR8_HUMAN	Isoform 2 of Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	2	1	0
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,11-UNIMOD:35	0.06	26.0	2	1	0
PRT	sp|Q9H2C0|GAN_HUMAN	Gigaxonin OS=Homo sapiens OX=9606 GN=GAN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.02	26.0	3	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,10-UNIMOD:35	0.04	26.0	3	1	0
PRT	sp|Q9NTX7-2|RN146_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF146 OS=Homo sapiens OX=9606 GN=RNF146	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,4-UNIMOD:4,13-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q96FN4|CPNE2_HUMAN	Copine-2 OS=Homo sapiens OX=9606 GN=CPNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,17-UNIMOD:35,22-UNIMOD:4,24-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	2	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	5-UNIMOD:35	0.02	26.0	4	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.08	26.0	2	1	0
PRT	sp|Q9P1Q0-4|VPS54_HUMAN	Isoform 4 of Vacuolar protein sorting-associated protein 54 OS=Homo sapiens OX=9606 GN=VPS54	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.01	26.0	3	2	1
PRT	sp|Q15723-4|ELF2_HUMAN	Isoform 4 of ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.03	26.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	99-UNIMOD:35,110-UNIMOD:35,111-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.05	26.0	2	2	2
PRT	sp|Q7L311|ARMX2_HUMAN	Armadillo repeat-containing X-linked protein 2 OS=Homo sapiens OX=9606 GN=ARMCX2 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,13-UNIMOD:35	0.02	26.0	1	1	0
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|Q9Y6I4-2|UBP3_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,11-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q96GX2|A7L3B_HUMAN	Ataxin-7-like protein 3B OS=Homo sapiens OX=9606 GN=ATXN7L3B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	26.0	3	1	0
PRT	sp|Q8WW01-2|SEN15_HUMAN	Isoform 2 of tRNA-splicing endonuclease subunit Sen15 OS=Homo sapiens OX=9606 GN=TSEN15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.17	26.0	1	1	0
PRT	sp|P10155-2|RO60_HUMAN	Isoform Short of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.07	26.0	6	1	0
PRT	sp|P09601|HMOX1_HUMAN	Heme oxygenase 1 OS=Homo sapiens OX=9606 GN=HMOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|O75781-2|PALM_HUMAN	Isoform 2 of Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	3	1	0
PRT	sp|Q7Z2K6|ERMP1_HUMAN	Endoplasmic reticulum metallopeptidase 1 OS=Homo sapiens OX=9606 GN=ERMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	26.0	3	1	0
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	26.0	3	1	0
PRT	sp|P26367|PAX6_HUMAN	Paired box protein Pax-6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	26.0	4	1	0
PRT	sp|Q9BXY0|MAK16_HUMAN	Protein MAK16 homolog OS=Homo sapiens OX=9606 GN=MAK16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	26.0	2	1	0
PRT	sp|Q16778|H2B2E_HUMAN	Histone H2B type 2-E OS=Homo sapiens OX=9606 GN=H2BC21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	3	1	0
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	2	1	0
PRT	sp|P16220|CREB1_HUMAN	Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	254-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|Q68CZ6-2|HAUS3_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 3 OS=Homo sapiens OX=9606 GN=HAUS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,3-UNIMOD:4	0.02	26.0	2	2	2
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,3-UNIMOD:4	0.07	26.0	5	2	0
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.02	26.0	2	2	2
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.04	26.0	3	2	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.09	26.0	3	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1	0.08	26.0	2	1	0
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:1,1-UNIMOD:35	0.07	26.0	2	2	2
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.14	26.0	3	2	0
PRT	sp|Q99873-3|ANM1_HUMAN	Isoform 3 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,9-UNIMOD:4,15-UNIMOD:4,11-UNIMOD:35	0.09	26.0	3	2	0
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.03	26.0	4	1	0
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	49-UNIMOD:35,54-UNIMOD:35,59-UNIMOD:35	0.04	26.0	2	1	0
PRT	sp|Q9NWD9|BEX4_HUMAN	Protein BEX4 OS=Homo sapiens OX=9606 GN=BEX4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:1,1-UNIMOD:35	0.30	26.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|Q96S52|PIGS_HUMAN	GPI transamidase component PIG-S OS=Homo sapiens OX=9606 GN=PIGS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.07	25.0	2	1	0
PRT	sp|Q96BP3|PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.09	25.0	2	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.04	25.0	2	1	0
PRT	sp|O60832-2|DKC1_HUMAN	Isoform 3 of H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	5	2	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,10-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|O15428|PINL_HUMAN	Putative PIN1-like protein OS=Homo sapiens OX=9606 GN=PIN1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.12	25.0	7	1	0
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	5	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	0.05	25.0	11	1	0
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:35	0.32	25.0	11	1	0
PRT	sp|P57088|TMM33_HUMAN	Transmembrane protein 33 OS=Homo sapiens OX=9606 GN=TMEM33 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,19-UNIMOD:35,18-UNIMOD:35	0.09	25.0	2	1	0
PRT	sp|Q16254|E2F4_HUMAN	Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	2	1	0
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,7-UNIMOD:4,10-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q9NQT5-2|EXOS3_HUMAN	Isoform 2 of Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.09	25.0	2	1	0
PRT	sp|Q9NRR5-2|UBQL4_HUMAN	Isoform 2 of Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.06	25.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q12788|TBL3_HUMAN	Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.01	25.0	3	2	1
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	2	1	0
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,10-UNIMOD:4,13-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,14-UNIMOD:35	0.03	25.0	4	1	0
PRT	sp|Q15208|STK38_HUMAN	Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,3-UNIMOD:35,9-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q6ZMI0-4|PPR21_HUMAN	Isoform 4 of Protein phosphatase 1 regulatory subunit 21 OS=Homo sapiens OX=9606 GN=PPP1R21	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|Q96S90|LYSM1_HUMAN	LysM and putative peptidoglycan-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LYSMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	1	1	1
PRT	sp|Q7Z4H3-3|HDDC2_HUMAN	Isoform 3 of 5'-deoxynucleotidase HDDC2 OS=Homo sapiens OX=9606 GN=HDDC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.20	25.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	2	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.08	25.0	2	1	0
PRT	sp|Q92990-2|GLMN_HUMAN	Isoform 2 of Glomulin OS=Homo sapiens OX=9606 GN=GLMN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,13-UNIMOD:4	0.05	25.0	2	1	0
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,2-UNIMOD:4,8-UNIMOD:4	0.05	25.0	2	1	0
PRT	sp|Q9NRG9-2|AAAS_HUMAN	Isoform 2 of Aladin OS=Homo sapiens OX=9606 GN=AAAS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,2-UNIMOD:4	0.02	25.0	8	1	0
PRT	sp|Q3B7T1-4|EDRF1_HUMAN	Isoform 3 of Erythroid differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDRF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|Q9Y265-2|RUVB1_HUMAN	Isoform 2 of RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	141-UNIMOD:4,147-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.11	25.0	3	2	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	288-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9BTC0-2|DIDO1_HUMAN	Isoform 2 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	3	1	0
PRT	sp|Q9NY27-2|PP4R2_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	1	1	0
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	25.0	5	1	0
PRT	sp|Q9Y5L4|TIM13_HUMAN	Mitochondrial import inner membrane translocase subunit Tim13 OS=Homo sapiens OX=9606 GN=TIMM13 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.17	25.0	4	1	0
PRT	sp|Q8N5S9|KKCC1_HUMAN	Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|P50225|ST1A1_HUMAN	Sulfotransferase 1A1 OS=Homo sapiens OX=9606 GN=SULT1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,4-UNIMOD:35,1-UNIMOD:35	0.09	25.0	6	2	1
PRT	sp|O60610-2|DIAP1_HUMAN	Isoform 2 of Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	25.0	6	1	0
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	25.0	1	1	0
PRT	sp|Q96DF8|ESS2_HUMAN	Splicing factor ESS-2 homolog OS=Homo sapiens OX=9606 GN=ESS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	25.0	4	2	0
PRT	sp|Q86TN4-3|TRPT1_HUMAN	Isoform 3 of tRNA 2'-phosphotransferase 1 OS=Homo sapiens OX=9606 GN=TRPT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	25.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|Q15797|SMAD1_HUMAN	Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	4	2	1
PRT	sp|P62253|UB2G1_HUMAN	Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.07	25.0	5	3	2
PRT	sp|Q93079|H2B1H_HUMAN	Histone H2B type 1-H OS=Homo sapiens OX=9606 GN=H2BC9 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	2	1	0
PRT	sp|Q9NQB0-14|TF7L2_HUMAN	Isoform 14 of Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.17	25.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	1069-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P56211|ARP19_HUMAN	cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,17-UNIMOD:35	0.17	25.0	3	2	1
PRT	sp|Q6NW29|RWDD4_HUMAN	RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1,9-UNIMOD:35	0.07	25.0	3	1	0
PRT	sp|P17028-2|ZNF24_HUMAN	Isoform 2 of Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.11	25.0	2	1	0
PRT	sp|P35612-7|ADDB_HUMAN	Isoform 7 of Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.22	25.0	1	1	0
PRT	sp|Q4ZIN3-2|MBRL_HUMAN	Isoform 2 of Membralin OS=Homo sapiens OX=9606 GN=TMEM259	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.06	25.0	2	1	0
PRT	sp|O75530-3|EED_HUMAN	Isoform 3 of Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|Q9H305-3|CDIP1_HUMAN	Isoform 3 of Cell death-inducing p53-target protein 1 OS=Homo sapiens OX=9606 GN=CDIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.16	25.0	2	1	0
PRT	sp|P07196|NFL_HUMAN	Neurofilament light polypeptide OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|Q03154-2|ACY1_HUMAN	Isoform 2 of Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.05	25.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.01	25.0	1	1	1
PRT	sp|Q15436|SC23A_HUMAN	Protein transport protein Sec23A OS=Homo sapiens OX=9606 GN=SEC23A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.02	25.0	5	2	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.07	25.0	5	1	0
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.06	25.0	1	1	0
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.07	25.0	1	1	0
PRT	sp|Q8IUH3|RBM45_HUMAN	RNA-binding protein 45 OS=Homo sapiens OX=9606 GN=RBM45 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	25.0	2	1	0
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.04	25.0	1	1	1
PRT	sp|Q9UEG4|ZN629_HUMAN	Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25.0	null		0.02	25.0	3	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P09417-2|DHPR_HUMAN	Isoform 2 of Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	2	1	0
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,13-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q86U28-2|ISCA2_HUMAN	Isoform 2 of Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.23	24.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	2	1	0
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.06	24.0	2	1	0
PRT	sp|O14733|MP2K7_HUMAN	Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP2K7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|O15042-2|SR140_HUMAN	Isoform 2 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|Q14689-3|DIP2A_HUMAN	Isoform 3 of Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,6-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.08	24.0	3	1	0
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.20	24.0	6	3	1
PRT	sp|Q9NUY8-2|TBC23_HUMAN	Isoform 2 of TBC1 domain family member 23 OS=Homo sapiens OX=9606 GN=TBC1D23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	3	1	0
PRT	sp|Q9Y4E8-4|UBP15_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.07	24.0	2	2	2
PRT	sp|Q92793-2|CBP_HUMAN	Isoform 2 of CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	24.0	5	2	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	2	1	0
PRT	sp|O14569|C56D2_HUMAN	Cytochrome b561 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CYB561D2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,5-UNIMOD:35	0.06	24.0	5	2	0
PRT	sp|P40123-3|CAP2_HUMAN	Isoform 3 of Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.06	24.0	1	1	0
PRT	sp|Q6FIF0-2|ZFAN6_HUMAN	Isoform 2 of AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,12-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:4	0.12	24.0	1	1	0
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.07	24.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	24.0	6	1	0
PRT	sp|Q9UEU0|VTI1B_HUMAN	Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens OX=9606 GN=VTI1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	2	1	0
PRT	sp|Q2VPK5-5|CTU2_HUMAN	Isoform 3 of Cytoplasmic tRNA 2-thiolation protein 2 OS=Homo sapiens OX=9606 GN=CTU2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	0.14	24.0	1	1	1
PRT	sp|Q9NV56|MRGBP_HUMAN	MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.07	24.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	3	2	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,4-UNIMOD:35,1-UNIMOD:35	0.03	24.0	3	1	0
PRT	sp|P80297|MT1X_HUMAN	Metallothionein-1X OS=Homo sapiens OX=9606 GN=MT1X PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	24.0	1	1	1
PRT	sp|Q96DT6|ATG4C_HUMAN	Cysteine protease ATG4C OS=Homo sapiens OX=9606 GN=ATG4C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.07	24.0	10	1	0
PRT	sp|O95155-2|UBE4B_HUMAN	Isoform 2 of Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	2	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	0.01	24.0	5	1	0
PRT	sp|Q9UK41|VPS28_HUMAN	Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.06	24.0	3	1	0
PRT	sp|Q53HI1|UNC50_HUMAN	Protein unc-50 homolog OS=Homo sapiens OX=9606 GN=UNC50 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	5	1	0
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,21-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q6AI12|ANR40_HUMAN	Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|Q16222-2|UAP1_HUMAN	Isoform AGX1 of UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q92567-3|F168A_HUMAN	Isoform 3 of Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	24.0	1	1	0
PRT	sp|Q04637-5|IF4G1_HUMAN	Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.04	24.0	4	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,2-UNIMOD:1	0.04	24.0	8	2	0
PRT	sp|P35610|SOAT1_HUMAN	Sterol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=SOAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	0.02	24.0	3	1	0
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	12-UNIMOD:4	0.03	24.0	3	1	0
PRT	sp|Q92783-2|STAM1_HUMAN	Isoform 2 of Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|O95478|NSA2_HUMAN	Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens OX=9606 GN=NSA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|P60602-2|ROMO1_HUMAN	Isoform 2 of Reactive oxygen species modulator 1 OS=Homo sapiens OX=9606 GN=ROMO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	15-UNIMOD:4	0.29	24.0	3	1	0
PRT	sp|Q96P16|RPR1A_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	3	2	1
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	2	2	2
PRT	sp|Q9Y243-2|AKT3_HUMAN	Isoform 2 of RAC-gamma serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	1	1	1
PRT	sp|Q969E2-3|SCAM4_HUMAN	Isoform 3 of Secretory carrier-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=SCAMP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.09	24.0	11	1	0
PRT	sp|Q9BRT3|MIEN1_HUMAN	Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.20	24.0	3	1	0
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	2	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.02	24.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.03	24.0	3	1	0
PRT	sp|Q9Y2A7|NCKP1_HUMAN	Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	2	1	0
PRT	sp|O75155-2|CAND2_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	2	1	0
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.15	24.0	2	1	0
PRT	sp|O15400-2|STX7_HUMAN	Isoform 2 of Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.07	24.0	2	1	0
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1	0.05	24.0	1	1	1
PRT	sp|Q9BV57|MTND_HUMAN	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Homo sapiens OX=9606 GN=ADI1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24.0	null	7-UNIMOD:35	0.08	24.0	4	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,18-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.01	24.0	4	2	0
PRT	sp|P49354|FNTA_HUMAN	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.09	24.0	1	1	0
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	5-UNIMOD:35	0.02	24.0	3	2	0
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,14-UNIMOD:4	0.05	24.0	2	2	2
PRT	sp|P17707|DCAM_HUMAN	S-adenosylmethionine decarboxylase proenzyme OS=Homo sapiens OX=9606 GN=AMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1	0.04	24.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.01	24.0	1	1	1
PRT	sp|P68402|PA1B2_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.10	24.0	1	1	0
PRT	sp|Q9BVC4|LST8_HUMAN	Target of rapamycin complex subunit LST8 OS=Homo sapiens OX=9606 GN=MLST8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	24.0	1	1	0
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P17028|ZNF24_HUMAN	Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.06	24.0	2	1	0
PRT	sp|Q9HD26|GOPC_HUMAN	Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,7-UNIMOD:4,20-UNIMOD:4,30-UNIMOD:35	0.07	24.0	4	1	0
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	4-UNIMOD:35	0.02	24.0	3	1	0
PRT	sp|Q9HC77|CENPJ_HUMAN	Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9UH36|SRR1L_HUMAN	SRR1-like protein OS=Homo sapiens OX=9606 GN=SRRD PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	2	1	0
PRT	sp|A6NFI3|ZN316_HUMAN	Zinc finger protein 316 OS=Homo sapiens OX=9606 GN=ZNF316 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|Q9BTV4|TMM43_HUMAN	Transmembrane protein 43 OS=Homo sapiens OX=9606 GN=TMEM43 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q9Y312|AAR2_HUMAN	Protein AAR2 homolog OS=Homo sapiens OX=9606 GN=AAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,6-UNIMOD:35	0.03	23.0	3	1	0
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.08	23.0	5	3	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	2	1	0
PRT	sp|Q96EC8-2|YIPF6_HUMAN	Isoform 2 of Protein YIPF6 OS=Homo sapiens OX=9606 GN=YIPF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.08	23.0	2	1	0
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q14244-3|MAP7_HUMAN	Isoform 3 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	2	1	0
PRT	sp|Q9NQ66-2|PLCB1_HUMAN	Isoform B of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q68CP9-3|ARID2_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.01	23.0	1	1	1
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,5-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.07	23.0	1	1	1
PRT	sp|Q92797-2|SYMPK_HUMAN	Isoform 2 of Symplekin OS=Homo sapiens OX=9606 GN=SYMPK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	1	1	1
PRT	sp|O95396|MOCS3_HUMAN	Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens OX=9606 GN=MOCS3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q9BXK5-2|B2L13_HUMAN	Isoform 1 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.07	23.0	3	1	0
PRT	sp|Q9NUD5-2|ZCHC3_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|O95997|PTTG1_HUMAN	Securin OS=Homo sapiens OX=9606 GN=PTTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.08	23.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|Q9P086|MED11_HUMAN	Mediator of RNA polymerase II transcription subunit 11 OS=Homo sapiens OX=9606 GN=MED11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	2	1	0
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,6-UNIMOD:35	0.04	23.0	5	2	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.03	23.0	1	1	0
PRT	sp|P02795|MT2_HUMAN	Metallothionein-2 OS=Homo sapiens OX=9606 GN=MT2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	0.33	23.0	1	1	1
PRT	sp|Q9BW27|NUP85_HUMAN	Nuclear pore complex protein Nup85 OS=Homo sapiens OX=9606 GN=NUP85 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	5	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,9-UNIMOD:35,1-UNIMOD:35	0.00	23.0	10	1	0
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	23.0	2	1	0
PRT	sp|P19623|SPEE_HUMAN	Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,274-UNIMOD:35	0.14	23.0	5	2	1
PRT	sp|Q8IVW6-3|ARI3B_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9BWK5-4|CYREN_HUMAN	Isoform 4 of Cell cycle regulator of non-homologous end joining OS=Homo sapiens OX=9606 GN=CYREN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1	0.16	23.0	1	1	1
PRT	sp|Q9NPE3|NOP10_HUMAN	H/ACA ribonucleoprotein complex subunit 3 OS=Homo sapiens OX=9606 GN=NOP10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35	0.20	23.0	3	1	0
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	23.0	5	2	1
PRT	sp|O75663-2|TIPRL_HUMAN	Isoform 2 of TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35	0.06	23.0	2	2	1
PRT	sp|P67812-4|SC11A_HUMAN	Isoform 4 of Signal peptidase complex catalytic subunit SEC11A OS=Homo sapiens OX=9606 GN=SEC11A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:35	0.07	23.0	1	1	1
PRT	sp|Q96SK2-4|TM209_HUMAN	Isoform 4 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:35	0.07	23.0	2	1	0
PRT	sp|Q96DN5-3|TBC31_HUMAN	Isoform 3 of TBC1 domain family member 31 OS=Homo sapiens OX=9606 GN=TBC1D31	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|O15270|SPTC2_HUMAN	Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4	0.02	23.0	2	1	0
PRT	sp|Q8NEY8-9|PPHLN_HUMAN	Isoform 9 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null		0.09	23.0	2	1	0
PRT	sp|Q8NI35-4|INADL_HUMAN	Isoform 4 of InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P51003-2|PAPOA_HUMAN	Isoform 2 of Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	3	1	0
PRT	sp|Q6ZT62-2|BGIN_HUMAN	Isoform Short BGIN of Bargin OS=Homo sapiens OX=9606 GN=BARGIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|O95391|SLU7_HUMAN	Pre-mRNA-splicing factor SLU7 OS=Homo sapiens OX=9606 GN=SLU7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	2	1	0
PRT	sp|P08047-3|SP1_HUMAN	Isoform 3 of Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,8-UNIMOD:35,11-UNIMOD:35	0.02	23.0	3	1	0
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	2	1	0
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,4-UNIMOD:35,12-UNIMOD:35,14-UNIMOD:35	0.07	23.0	8	1	0
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.08	23.0	2	1	0
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,8-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|O14734|ACOT8_HUMAN	Acyl-coenzyme A thioesterase 8 OS=Homo sapiens OX=9606 GN=ACOT8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,13-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O00401|WASL_HUMAN	Neural Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.02	23.0	6	2	0
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,1-UNIMOD:35	0.03	23.0	5	2	0
PRT	sp|Q9H7C9-3|AAMDC_HUMAN	Isoform 3 of Mth938 domain-containing protein OS=Homo sapiens OX=9606 GN=AAMDC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,14-UNIMOD:35	0.16	23.0	2	1	0
PRT	sp|Q96S99|PKHF1_HUMAN	Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.05	23.0	1	1	1
PRT	sp|P60059|SC61G_HUMAN	Protein transport protein Sec61 subunit gamma OS=Homo sapiens OX=9606 GN=SEC61G PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.24	23.0	4	2	0
PRT	sp|Q15437|SC23B_HUMAN	Protein transport protein Sec23B OS=Homo sapiens OX=9606 GN=SEC23B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	2	2	2
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|Q96S94|CCNL2_HUMAN	Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.08	23.0	1	1	1
PRT	sp|Q8WW01|SEN15_HUMAN	tRNA-splicing endonuclease subunit Sen15 OS=Homo sapiens OX=9606 GN=TSEN15 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.13	23.0	2	1	0
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1	0.03	23.0	1	1	0
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23.0	null	1-UNIMOD:1,20-UNIMOD:35,1-UNIMOD:35	0.02	23.0	4	1	0
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|Q8TCY9-2|URGCP_HUMAN	Isoform 2 of Up-regulator of cell proliferation OS=Homo sapiens OX=9606 GN=URGCP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.02	23.0	2	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q9HD20|AT131_HUMAN	Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,13-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P23025|XPA_HUMAN	DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.09	22.0	3	1	0
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	2	1	0
PRT	sp|Q9UL63|MKLN1_HUMAN	Muskelin OS=Homo sapiens OX=9606 GN=MKLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,13-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,17-UNIMOD:4	0.09	22.0	2	1	0
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q96GQ5|RUSF1_HUMAN	RUS family member 1 OS=Homo sapiens OX=9606 GN=RUSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,12-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P55209-2|NP1L1_HUMAN	Isoform 2 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.08	22.0	1	1	1
PRT	sp|Q96JB2-2|COG3_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 3 OS=Homo sapiens OX=9606 GN=COG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.01	22.0	3	2	1
PRT	sp|Q92993-2|KAT5_HUMAN	Isoform 1 of Histone acetyltransferase KAT5 OS=Homo sapiens OX=9606 GN=KAT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,11-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q8NC56|LEMD2_HUMAN	LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LEMD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|P09493-5|TPM1_HUMAN	Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	2	1	0
PRT	sp|Q14186|TFDP1_HUMAN	Transcription factor Dp-1 OS=Homo sapiens OX=9606 GN=TFDP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.10	22.0	2	1	0
PRT	sp|P63272|SPT4H_HUMAN	Transcription elongation factor SPT4 OS=Homo sapiens OX=9606 GN=SUPT4H1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.09	22.0	2	1	0
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	2	1	0
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	2	1	0
PRT	sp|Q6PJF5-2|RHDF2_HUMAN	Isoform 2 of Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	1	1	1
PRT	sp|O43264-2|ZW10_HUMAN	Isoform 2 of Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.02	22.0	2	1	0
PRT	sp|Q16611-2|BAK_HUMAN	Isoform 2 of Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.07	22.0	1	1	1
PRT	sp|P07910-3|HNRPC_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	2	1	0
PRT	sp|Q9H875|PKRI1_HUMAN	PRKR-interacting protein 1 OS=Homo sapiens OX=9606 GN=PRKRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.07	22.0	2	1	0
PRT	sp|Q9Y2P8|RCL1_HUMAN	RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens OX=9606 GN=RCL1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,13-UNIMOD:4	0.04	22.0	2	1	0
PRT	sp|Q9UQR0|SCML2_HUMAN	Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	10-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9H944-2|MED20_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 20 OS=Homo sapiens OX=9606 GN=MED20	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	5-UNIMOD:4,9-UNIMOD:35	0.11	22.0	2	1	0
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	159-UNIMOD:35	0.10	22.0	1	1	1
PRT	sp|P00374|DYR_HUMAN	Dihydrofolate reductase OS=Homo sapiens OX=9606 GN=DHFR PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	457-UNIMOD:35	0.02	22.0	3	1	0
PRT	sp|Q15393-3|SF3B3_HUMAN	Isoform 3 of Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q8WZA1|PMGT1_HUMAN	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q8N3Y1-2|FBXW8_HUMAN	Isoform 2 of F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	22.0	1	1	0
PRT	sp|Q96H22-2|CENPN_HUMAN	Isoform 2 of Centromere protein N OS=Homo sapiens OX=9606 GN=CENPN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	22.0	2	1	0
PRT	sp|Q9BZ67-2|FRMD8_HUMAN	Isoform 2 of FERM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=FRMD8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.08	22.0	3	1	0
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	22.0	2	1	0
PRT	sp|Q96RG2-4|PASK_HUMAN	Isoform 3 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	22.0	1	1	0
PRT	sp|Q96JB5|CK5P3_HUMAN	CDK5 regulatory subunit-associated protein 3 OS=Homo sapiens OX=9606 GN=CDK5RAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	2	1	0
PRT	sp|P0DPB5|RPC22_HUMAN	Protein POLR1D, isoform 2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	22.0	5	2	0
PRT	sp|Q5EBL4|RIPL1_HUMAN	RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q8IUH4|ZDH13_HUMAN	Palmitoyltransferase ZDHHC13 OS=Homo sapiens OX=9606 GN=ZDHHC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	22.0	3	1	0
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	22.0	8	3	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.08	22.0	7	2	1
PRT	sp|Q9BVC4-5|LST8_HUMAN	Isoform 4 of Target of rapamycin complex subunit LST8 OS=Homo sapiens OX=9606 GN=MLST8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	22.0	1	1	0
PRT	sp|P30046-2|DOPD_HUMAN	Isoform 2 of D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:35	0.13	22.0	8	2	0
PRT	sp|Q9NPF4|OSGEP_HUMAN	Probable tRNA N6-adenosine threonylcarbamoyltransferase OS=Homo sapiens OX=9606 GN=OSGEP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q13907|IDI1_HUMAN	Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens OX=9606 GN=IDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9NZ32|ARP10_HUMAN	Actin-related protein 10 OS=Homo sapiens OX=9606 GN=ACTR10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,7-UNIMOD:4	0.02	22.0	2	2	2
PRT	sp|P15336-7|ATF2_HUMAN	Isoform 7 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|Q8WYA0-3|IFT81_HUMAN	Isoform 2 of Intraflagellar transport protein 81 homolog OS=Homo sapiens OX=9606 GN=IFT81	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,9-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q9UMY4-3|SNX12_HUMAN	Isoform 3 of Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.06	22.0	1	1	1
PRT	sp|Q9NXX6-2|NSE4A_HUMAN	Isoform 2 of Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens OX=9606 GN=NSMCE4A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	1	1	1
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|O00560-2|SDCB1_HUMAN	Isoform 2 of Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.04	22.0	3	1	0
PRT	sp|Q8WWK9-4|CKAP2_HUMAN	Isoform 2 of Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.03	22.0	7	1	0
PRT	sp|Q96HR3-2|MED30_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 30 OS=Homo sapiens OX=9606 GN=MED30	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1,11-UNIMOD:35	0.17	22.0	1	1	1
PRT	sp|Q9NWU2|GID8_HUMAN	Glucose-induced degradation protein 8 homolog OS=Homo sapiens OX=9606 GN=GID8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	2	1	0
PRT	sp|Q13283-2|G3BP1_HUMAN	Isoform 2 of Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22.0	null	3-UNIMOD:35	0.10	22.0	2	1	0
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.03	22.0	2	1	0
PRT	sp|Q8N0X7|SPART_HUMAN	Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	22.0	5	2	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.04	22.0	2	2	1
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	15-UNIMOD:4	0.03	22.0	1	1	0
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.09	22.0	2	1	0
PRT	sp|Q96KQ7|EHMT2_HUMAN	Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,21-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,28-UNIMOD:35,32-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|A6NHG4|DDTL_HUMAN	D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.10	22.0	1	1	0
PRT	sp|P54619|AAKG1_HUMAN	5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,33-UNIMOD:35	0.10	22.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	523-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.02	22.0	4	1	0
PRT	sp|Q9H4L5|OSBL3_HUMAN	Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	3-UNIMOD:1	0.01	22.0	1	1	1
PRT	sp|Q00994-2|BEX3_HUMAN	Isoform 2 of Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.26	22.0	1	1	1
PRT	sp|Q8IWQ3|BRSK2_HUMAN	Serine/threonine-protein kinase BRSK2 OS=Homo sapiens OX=9606 GN=BRSK2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.03	22.0	1	1	1
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.29	22.0	2	1	0
PRT	sp|P49914|MTHFS_HUMAN	5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|P55263-3|ADK_HUMAN	Isoform 3 of Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	0
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|Q96HJ9|FMC1_HUMAN	Protein FMC1 homolog OS=Homo sapiens OX=9606 GN=FMC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.10	21.0	2	1	0
PRT	sp|Q9Y4Y9|LSM5_HUMAN	U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,21-UNIMOD:4	0.26	21.0	1	1	1
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	2-UNIMOD:1	0.28	21.0	3	2	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P14859-5|PO2F1_HUMAN	Isoform 5 of POU domain, class 2, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU2F1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P52306-6|GDS1_HUMAN	Isoform 6 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q92917|GPKOW_HUMAN	G-patch domain and KOW motifs-containing protein OS=Homo sapiens OX=9606 GN=GPKOW PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q53GT1|KLH22_HUMAN	Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,11-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	2	1	0
PRT	sp|P13984|T2FB_HUMAN	General transcription factor IIF subunit 2 OS=Homo sapiens OX=9606 GN=GTF2F2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	2	1	0
PRT	sp|Q3ZCW2|LEGL_HUMAN	Galectin-related protein OS=Homo sapiens OX=9606 GN=LGALSL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.07	21.0	1	1	1
PRT	sp|Q16637-4|SMN_HUMAN	Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:35	0.08	21.0	5	1	0
PRT	sp|O00743-2|PPP6_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens OX=9606 GN=PPP6C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.12	21.0	1	1	1
PRT	sp|O75964|ATP5L_HUMAN	ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.10	21.0	1	1	1
PRT	sp|Q9BU02-2|THTPA_HUMAN	Isoform 2 of Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.10	21.0	2	2	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	2	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,11-UNIMOD:35,12-UNIMOD:35	0.02	21.0	3	1	0
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q96BN2|TADA1_HUMAN	Transcriptional adapter 1 OS=Homo sapiens OX=9606 GN=TADA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	2	1	0
PRT	sp|Q7L5Y9-5|MAEA_HUMAN	Isoform 5 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,12-UNIMOD:35	0.06	21.0	2	1	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.07	21.0	5	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	2	1	0
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,2-UNIMOD:4,7-UNIMOD:35	0.08	21.0	4	1	0
PRT	sp|Q9NP61-2|ARFG3_HUMAN	Isoform 2 of ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.03	21.0	2	1	0
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35	0.02	21.0	3	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	3	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.16	21.0	7	2	0
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	1	0
PRT	sp|Q8ND82|Z280C_HUMAN	Zinc finger protein 280C OS=Homo sapiens OX=9606 GN=ZNF280C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	530-UNIMOD:4	0.04	21.0	2	1	0
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.04	21.0	2	2	2
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	732-UNIMOD:4	0.01	21.0	2	1	0
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	21.0	3	1	0
PRT	sp|Q14232-2|EI2BA_HUMAN	Isoform 2 of Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	2	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	21.0	2	1	0
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	21.0	2	1	0
PRT	sp|P52306-2|GDS1_HUMAN	Isoform 2 of Rap1 GTPase-GDP dissociation stimulator 1 OS=Homo sapiens OX=9606 GN=RAP1GDS1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	2	1	0
PRT	sp|O14653-3|GOSR2_HUMAN	Isoform 3 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	2	1	0
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	3	1	0
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	21.0	3	1	0
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1	0.04	21.0	2	1	0
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	21.0	2	1	0
PRT	sp|Q8TBM8|DJB14_HUMAN	DnaJ homolog subfamily B member 14 OS=Homo sapiens OX=9606 GN=DNAJB14 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1	0.03	21.0	1	1	1
PRT	sp|P30279-2|CCND2_HUMAN	Isoform 2 of G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q9NX08|COMD8_HUMAN	COMM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=COMMD8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	21.0	1	1	1
PRT	sp|Q9BU64|CENPO_HUMAN	Centromere protein O OS=Homo sapiens OX=9606 GN=CENPO PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	21.0	3	1	0
PRT	sp|Q96RS6|NUDC1_HUMAN	NudC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NUDCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	5	1	0
PRT	sp|Q5BJH7-4|YIF1B_HUMAN	Isoform 4 of Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|P20248|CCNA2_HUMAN	Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|Q9Y371|SHLB1_HUMAN	Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	21.0	4	1	0
PRT	sp|P20810-4|ICAL_HUMAN	Isoform 4 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1	0.10	21.0	3	2	0
PRT	sp|O75190-2|DNJB6_HUMAN	Isoform B of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:35,2-UNIMOD:1	0.05	21.0	4	2	0
PRT	sp|Q9NP08|HMX1_HUMAN	Homeobox protein HMX1 OS=Homo sapiens OX=9606 GN=HMX1 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|O75886-2|STAM2_HUMAN	Isoform 2 of Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	5	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	179-UNIMOD:35,186-UNIMOD:35,194-UNIMOD:4	0.07	21.0	3	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.01	21.0	1	1	1
PRT	sp|P53350|PLK1_HUMAN	Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	1
PRT	sp|Q7Z7F0-4|KHDC4_HUMAN	Isoform 4 of KH homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KHDC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q9BRL6-2|SRSF8_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 8 OS=Homo sapiens OX=9606 GN=SRSF8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:35	0.06	21.0	4	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,6-UNIMOD:35,12-UNIMOD:35	0.04	21.0	2	2	2
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,15-UNIMOD:4	0.06	21.0	2	1	0
PRT	sp|P62308|RUXG_HUMAN	Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.12	21.0	1	1	1
PRT	sp|Q16539-5|MK14_HUMAN	Isoform 5 of Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|P22307-3|NLTP_HUMAN	Isoform 3 of Non-specific lipid-transfer protein OS=Homo sapiens OX=9606 GN=SCP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|O43805|SSNA1_HUMAN	Sjoegren syndrome nuclear autoantigen 1 OS=Homo sapiens OX=9606 GN=SSNA1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.14	21.0	3	2	1
PRT	sp|Q9BQ15|SOSB1_HUMAN	SOSS complex subunit B1 OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|A4D1U4|DEN11_HUMAN	DENN domain-containing protein 11 OS=Homo sapiens OX=9606 GN=DENND11 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.02	21.0	3	1	0
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	3-UNIMOD:1	0.05	21.0	1	1	1
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.02	21.0	1	1	0
PRT	sp|Q9UBF6|RBX2_HUMAN	RING-box protein 2 OS=Homo sapiens OX=9606 GN=RNF7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,11-UNIMOD:4	0.19	21.0	1	1	0
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,18-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|P26368|U2AF2_HUMAN	Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	110-UNIMOD:35,125-UNIMOD:35,144-UNIMOD:35	0.08	21.0	1	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	3-UNIMOD:1,3-UNIMOD:35	0.02	21.0	3	1	0
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	60-UNIMOD:4	0.27	21.0	3	1	0
PRT	sp|P48426|PI42A_HUMAN	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.04	21.0	1	1	1
PRT	sp|P35250|RFC2_HUMAN	Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.07	21.0	2	1	0
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	0
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,13-UNIMOD:35	0.07	21.0	3	1	0
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.03	21.0	2	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.02	21.0	5	1	0
PRT	sp|P40123|CAP2_HUMAN	Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,4-UNIMOD:35	0.03	21.0	1	1	0
PRT	sp|Q9NWT6|HIF1N_HUMAN	Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:1	0.05	21.0	4	1	0
PRT	sp|Q16222|UAP1_HUMAN	UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	21.0	1	1	0
PRT	sp|P42771|CDN2A_HUMAN	Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.14	21.0	2	1	0
PRT	sp|Q2M2I8|AAK1_HUMAN	AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	569-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|Q9UMX0|UBQL1_HUMAN	Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.06	21.0	2	1	0
PRT	sp|Q9UNY4|TTF2_HUMAN	Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,13-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q02930-2|CREB5_HUMAN	Isoform 2 of Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,16-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|O43324-2|MCA3_HUMAN	Isoform 2 of Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	3	1	0
PRT	sp|Q86YN1-2|DOPP1_HUMAN	Isoform 2 of Dolichyldiphosphatase 1 OS=Homo sapiens OX=9606 GN=DOLPP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,7-UNIMOD:4	0.07	20.0	2	1	0
PRT	sp|O75352-2|MPU1_HUMAN	Isoform 2 of Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens OX=9606 GN=MPDU1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q96G01-4|BICD1_HUMAN	Isoform 4 of Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	2	1	0
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|O60925|PFD1_HUMAN	Prefoldin subunit 1 OS=Homo sapiens OX=9606 GN=PFDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	2	1	0
PRT	sp|Q9H5Z1-2|DHX35_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens OX=9606 GN=DHX35	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.05	20.0	5	2	1
PRT	sp|Q96DE5|APC16_HUMAN	Anaphase-promoting complex subunit 16 OS=Homo sapiens OX=9606 GN=ANAPC16 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.28	20.0	1	1	1
PRT	sp|P17858|PFKAL_HUMAN	ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q93100-4|KPBB_HUMAN	Isoform 4 of Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,3-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P62140|PP1B_HUMAN	Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	2	1	0
PRT	sp|Q96BT3-3|CENPT_HUMAN	Isoform 3 of Centromere protein T OS=Homo sapiens OX=9606 GN=CENPT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|Q09028-2|RBBP4_HUMAN	Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.02	20.0	2	1	0
PRT	sp|P14854|CX6B1_HUMAN	Cytochrome c oxidase subunit 6B1 OS=Homo sapiens OX=9606 GN=COX6B1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,5-UNIMOD:35	0.10	20.0	1	1	1
PRT	sp|Q9NXV2|KCTD5_HUMAN	BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,6-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|Q9BXR0-2|TGT_HUMAN	Isoform 2 of Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.06	20.0	2	1	0
PRT	sp|Q8N584-3|TT39C_HUMAN	Isoform 3 of Tetratricopeptide repeat protein 39C OS=Homo sapiens OX=9606 GN=TTC39C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.12	20.0	1	1	1
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,3-UNIMOD:35,10-UNIMOD:4	0.01	20.0	2	1	0
PRT	sp|P48059|LIMS1_HUMAN	LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,10-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.06	20.0	2	1	0
PRT	sp|O43148|MCES_HUMAN	mRNA cap guanine-N7 methyltransferase OS=Homo sapiens OX=9606 GN=RNMT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q712K3|UB2R2_HUMAN	Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|Q92888-3|ARHG1_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	2	1	0
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q16513-3|PKN2_HUMAN	Isoform 3 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|O00762-3|UBE2C_HUMAN	Isoform 3 of Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens OX=9606 GN=UBE2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.11	20.0	1	1	1
PRT	sp|Q92968|PEX13_HUMAN	Peroxisomal membrane protein PEX13 OS=Homo sapiens OX=9606 GN=PEX13 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.07	20.0	1	1	1
PRT	sp|Q99541|PLIN2_HUMAN	Perilipin-2 OS=Homo sapiens OX=9606 GN=PLIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.03	20.0	2	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,7-UNIMOD:4	0.06	20.0	2	1	0
PRT	sp|Q8N9Q2|SR1IP_HUMAN	Protein SREK1IP1 OS=Homo sapiens OX=9606 GN=SREK1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,6-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	2	1	0
PRT	sp|Q9NR56-3|MBNL1_HUMAN	Isoform 3 of Muscleblind-like protein 1 OS=Homo sapiens OX=9606 GN=MBNL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|Q9Y4F1-3|FARP1_HUMAN	Isoform 3 of FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.09	20.0	1	1	1
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|P62491-2|RB11A_HUMAN	Isoform 2 of Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.08	20.0	3	1	0
PRT	sp|P52294|IMA5_HUMAN	Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	2	2	2
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	462-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	2	1	0
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q8N4C6-6|NIN_HUMAN	Isoform 6 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	2	1	0
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	3	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35	0.05	20.0	4	1	0
PRT	sp|Q9BYE7-3|PCGF6_HUMAN	Isoform 3 of Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|Q9UI09-2|NDUAC_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.14	20.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	20.0	3	1	0
PRT	sp|Q8TDP1|RNH2C_HUMAN	Ribonuclease H2 subunit C OS=Homo sapiens OX=9606 GN=RNASEH2C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	20.0	1	1	1
PRT	sp|Q92759|TF2H4_HUMAN	General transcription factor IIH subunit 4 OS=Homo sapiens OX=9606 GN=GTF2H4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	2	1	0
PRT	sp|Q5T1M5-3|FKB15_HUMAN	Isoform 3 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	20.0	1	1	0
PRT	sp|P53990-2|IST1_HUMAN	Isoform 2 of IST1 homolog OS=Homo sapiens OX=9606 GN=IST1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q86X83-2|COMD2_HUMAN	Isoform 2 of COMM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=COMMD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:35	0.06	20.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	2	1	0
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:35,3-UNIMOD:35	0.10	20.0	50	2	0
PRT	sp|Q9NT62-2|ATG3_HUMAN	Isoform 2 of Ubiquitin-like-conjugating enzyme ATG3 OS=Homo sapiens OX=9606 GN=ATG3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|Q9BXJ8-2|TACAN_HUMAN	Isoform 2 of Ion channel TACAN OS=Homo sapiens OX=9606 GN=TMEM120A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.04	20.0	2	1	0
PRT	sp|Q9H840|GEMI7_HUMAN	Gem-associated protein 7 OS=Homo sapiens OX=9606 GN=GEMIN7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	20.0	3	1	0
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.00	20.0	6	1	0
PRT	sp|Q99569-2|PKP4_HUMAN	Isoform 2 of Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q99877|H2B1N_HUMAN	Histone H2B type 1-N OS=Homo sapiens OX=9606 GN=H2BC15 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|O43422-2|P52K_HUMAN	Isoform Short of 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	5-UNIMOD:4,10-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q5T7W7|TSTD2_HUMAN	Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TSTD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	16-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q8TF71|MOT10_HUMAN	Monocarboxylate transporter 10 OS=Homo sapiens OX=9606 GN=SLC16A10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P0CG35|TB15B_HUMAN	Thymosin beta-15B OS=Homo sapiens OX=9606 GN=TMSB15B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.24	20.0	2	1	0
PRT	sp|Q6PL24|TMED8_HUMAN	Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|Q7Z3E2|CC186_HUMAN	Coiled-coil domain-containing protein 186 OS=Homo sapiens OX=9606 GN=CCDC186 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q6UX04-2|CWC27_HUMAN	Isoform 2 of Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	3	1	0
PRT	sp|O43164-2|PJA2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,12-UNIMOD:35	0.02	20.0	2	1	0
PRT	sp|Q7L5N7|PCAT2_HUMAN	Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,4-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|O95685|PPR3D_HUMAN	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	2	1	0
PRT	sp|Q16537-2|2A5E_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|P84022|SMAD3_HUMAN	Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9UBI6|GBG12_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Homo sapiens OX=9606 GN=GNG12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.19	20.0	1	1	1
PRT	sp|P07864|LDHC_HUMAN	L-lactate dehydrogenase C chain OS=Homo sapiens OX=9606 GN=LDHC PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.03	20.0	1	1	1
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|Q10567-4|AP1B1_HUMAN	Isoform 4 of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.01	20.0	1	1	1
PRT	sp|O95139-2|NDUB6_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1	0.09	20.0	3	1	0
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,1-UNIMOD:1,1-UNIMOD:35	0.03	20.0	3	2	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|O43264|ZW10_HUMAN	Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.02	20.0	1	1	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,22-UNIMOD:35	0.17	20.0	3	1	0
PRT	sp|O75663|TIPRL_HUMAN	TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.04	20.0	1	1	0
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:1	0.06	20.0	3	2	0
PRT	sp|O95433|AHSA1_HUMAN	Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	163-UNIMOD:35,168-UNIMOD:35	0.08	20.0	1	1	1
PRT	sp|Q96CX2|KCD12_HUMAN	BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|O60879|DIAP2_HUMAN	Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1	0.02	20.0	1	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	2	1	0
PRT	sp|Q32P28|P3H1_HUMAN	Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	696-UNIMOD:35,703-UNIMOD:35	0.05	20.0	2	1	0
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:1,12-UNIMOD:35	0.17	20.0	3	1	0
PRT	sp|P49069|CAMLG_HUMAN	Calcium signal-modulating cyclophilin ligand OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.09	20.0	2	1	0
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q7L1V2|MON1B_HUMAN	Vacuolar fusion protein MON1 homolog B OS=Homo sapiens OX=9606 GN=MON1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.06	20.0	1	1	1
PRT	sp|Q9BRF8|CPPED_HUMAN	Serine/threonine-protein phosphatase CPPED1 OS=Homo sapiens OX=9606 GN=CPPED1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.04	20.0	1	1	1
PRT	sp|Q01970|PLCB3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.02	20.0	2	1	0
PRT	sp|P58557|YBEY_HUMAN	Endoribonuclease YbeY OS=Homo sapiens OX=9606 GN=YBEY PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.05	20.0	1	1	0
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,3-UNIMOD:4	0.06	20.0	1	1	0
PRT	sp|Q13620-1|CUL4B_HUMAN	Isoform 2 of Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q86UZ6|ZBT46_HUMAN	Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q96RG2|PASK_HUMAN	PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	20.0	3	1	0
PRT	sp|P42773|CDN2C_HUMAN	Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.08	20.0	1	1	1
PRT	sp|Q8TDH9|BL1S5_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 5 OS=Homo sapiens OX=9606 GN=BLOC1S5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,12-UNIMOD:4	0.11	20.0	1	1	1
PRT	sp|A6NK53|ZN233_HUMAN	Zinc finger protein 233 OS=Homo sapiens OX=9606 GN=ZNF233 PE=2 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O95801|TTC4_HUMAN	Tetratricopeptide repeat protein 4 OS=Homo sapiens OX=9606 GN=TTC4 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	0.05	20.0	4	1	0
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q5SRE5-2|NU188_HUMAN	Isoform 2 of Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	3	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q9H3Y8-2|PPDPF_HUMAN	Isoform 2 of Pancreatic progenitor cell differentiation and proliferation factor OS=Homo sapiens OX=9606 GN=PPDPF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.24	19.0	1	1	1
PRT	sp|O14744-5|ANM5_HUMAN	Isoform 5 of Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,4-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|O60518|RNBP6_HUMAN	Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q6AI08|HEAT6_HUMAN	HEAT repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=HEATR6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q8TBC4|UBA3_HUMAN	NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q12986-3|NFX1_HUMAN	Isoform 3 of Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q5TKA1-3|LIN9_HUMAN	Isoform 3 of Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	2	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.11	19.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	2	1	0
PRT	sp|Q9H9Y4|GPN2_HUMAN	GPN-loop GTPase 2 OS=Homo sapiens OX=9606 GN=GPN2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.07	19.0	2	1	0
PRT	sp|O95433-2|AHSA1_HUMAN	Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	2	1	0
PRT	sp|Q96K19-5|RN170_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens OX=9606 GN=RNF170	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.09	19.0	1	1	1
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.09	19.0	2	1	0
PRT	sp|Q5TA31|RN187_HUMAN	E3 ubiquitin-protein ligase RNF187 OS=Homo sapiens OX=9606 GN=RNF187 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,12-UNIMOD:4,15-UNIMOD:4	0.07	19.0	2	1	0
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.13	19.0	2	2	2
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9NUI1-2|DECR2_HUMAN	Isoform 2 of Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens OX=9606 GN=DECR2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|Q8IXQ4-4|GPAM1_HUMAN	Isoform 4 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.08	19.0	2	1	0
PRT	sp|O95273-2|CCDB1_HUMAN	Isoform 2 of Cyclin-D1-binding protein 1 OS=Homo sapiens OX=9606 GN=CCNDBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.07	19.0	1	1	1
PRT	sp|P56134-3|ATPK_HUMAN	Isoform 3 of ATP synthase subunit f, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:4	0.27	19.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	2	1	0
PRT	sp|P48637-2|GSHB_HUMAN	Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	2	1	0
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|Q6I9Y2|THOC7_HUMAN	THO complex subunit 7 homolog OS=Homo sapiens OX=9606 GN=THOC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|Q92620-2|PRP16_HUMAN	Isoform 2 of Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	1	1	1
PRT	sp|O94953-2|KDM4B_HUMAN	Isoform 2 of Lysine-specific demethylase 4B OS=Homo sapiens OX=9606 GN=KDM4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	19.0	2	2	2
PRT	sp|Q99576-4|T22D3_HUMAN	Isoform 3 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	100-UNIMOD:4	0.23	19.0	2	1	0
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.22	19.0	2	1	0
PRT	sp|P10515|ODP2_HUMAN	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	103-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q8N5P1|ZC3H8_HUMAN	Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	19.0	1	1	1
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|Q9H7B2|RPF2_HUMAN	Ribosome production factor 2 homolog OS=Homo sapiens OX=9606 GN=RPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	3	1	0
PRT	sp|Q96EA4-2|SPDLY_HUMAN	Isoform 2 of Protein Spindly OS=Homo sapiens OX=9606 GN=SPDL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q9Y6D9|MD1L1_HUMAN	Mitotic spindle assembly checkpoint protein MAD1 OS=Homo sapiens OX=9606 GN=MAD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|Q6P4H8-2|ACKMT_HUMAN	Isoform 2 of ATP synthase subunit C lysine N-methyltransferase OS=Homo sapiens OX=9606 GN=ATPSCKMT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	19.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	19.0	6	1	0
PRT	sp|P24941-2|CDK2_HUMAN	Isoform 2 of Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	1	1	0
PRT	sp|Q8NEZ5-2|FBX22_HUMAN	Isoform 2 of F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	0.24	19.0	1	1	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|Q9BQC3-2|DPH2_HUMAN	Isoform 2 of 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.06	19.0	2	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|Q9NZN3-2|EHD3_HUMAN	Isoform 2 of EH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=EHD3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.06	19.0	2	1	0
PRT	sp|Q8NBM4-5|UBAC2_HUMAN	Isoform 5 of Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:35	0.09	19.0	1	1	1
PRT	sp|Q15036-2|SNX17_HUMAN	Isoform 2 of Sorting nexin-17 OS=Homo sapiens OX=9606 GN=SNX17	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	3	1	0
PRT	sp|O95232-2|LC7L3_HUMAN	Isoform 2 of Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.18	19.0	1	1	1
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	3	1	0
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	6	1	0
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|P17480-2|UBF1_HUMAN	Isoform UBF2 of Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	0.02	19.0	3	1	0
PRT	sp|Q93009|UBP7_HUMAN	Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|A1KXE4-2|F168B_HUMAN	Isoform 2 of Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.15	19.0	3	1	0
PRT	sp|O75146-2|HIP1R_HUMAN	Isoform 2 of Huntingtin-interacting protein 1-related protein OS=Homo sapiens OX=9606 GN=HIP1R	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q58FF6|H90B4_HUMAN	Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens OX=9606 GN=HSP90AB4P PE=5 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	1-UNIMOD:35	0.02	19.0	3	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	2	2	2
PRT	sp|Q6PEV8-2|F199X_HUMAN	Isoform 2 of Protein FAM199X OS=Homo sapiens OX=9606 GN=FAM199X	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|O95630-2|STABP_HUMAN	Isoform 2 of STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	6	1	0
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.05	19.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,11-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.14	19.0	2	1	0
PRT	sp|P58557-4|YBEY_HUMAN	Isoform D of Endoribonuclease YbeY OS=Homo sapiens OX=9606 GN=YBEY	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.11	19.0	2	1	0
PRT	sp|A8CG34|P121C_HUMAN	Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9UPR3|SMG5_HUMAN	Protein SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|P63010|AP2B1_HUMAN	AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.01	19.0	1	1	1
PRT	sp|O94788-2|AL1A2_HUMAN	Isoform 2 of Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,8-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|P15104|GLNA_HUMAN	Glutamine synthetase OS=Homo sapiens OX=9606 GN=GLUL PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.03	19.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.04	19.0	3	1	0
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,5-UNIMOD:35,1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.09	19.0	12	2	0
PRT	sp|Q15758|AAAT_HUMAN	Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	39-UNIMOD:4,1-UNIMOD:1,1-UNIMOD:35	0.08	19.0	3	2	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	19.0	3	1	0
PRT	sp|Q8TDX7|NEK7_HUMAN	Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.08	19.0	2	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,11-UNIMOD:35	0.02	19.0	8	1	0
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,23-UNIMOD:4	0.04	19.0	2	1	0
PRT	sp|Q9H074-3|PAIP1_HUMAN	Isoform 3 of Polyadenylate-binding protein-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAIP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1,13-UNIMOD:35	0.04	19.0	4	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.08	19.0	1	1	1
PRT	sp|P07741|APT_HUMAN	Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.06	19.0	1	1	0
PRT	sp|P24941|CDK2_HUMAN	Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	19.0	1	1	0
PRT	sp|Q92686|NEUG_HUMAN	Neurogranin OS=Homo sapiens OX=9606 GN=NRGN PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4	0.41	19.0	1	1	1
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,12-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:4	0.11	19.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	0.03	19.0	1	1	1
PRT	sp|Q8TB72|PUM2_HUMAN	Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	19.0	1	1	0
PRT	sp|Q8NCA9|ZN784_HUMAN	Zinc finger protein 784 OS=Homo sapiens OX=9606 GN=ZNF784 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	2	1	0
PRT	sp|Q9Y4X0-2|AMMR1_HUMAN	Isoform 2 of AMME syndrome candidate gene 1 protein OS=Homo sapiens OX=9606 GN=AMMECR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:4,6-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|Q8NBT0-2|POC1A_HUMAN	Isoform 2 of POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q5RI15|COX20_HUMAN	Cytochrome c oxidase assembly protein COX20, mitochondrial OS=Homo sapiens OX=9606 GN=COX20 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.10	18.0	2	1	0
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:4,8-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9NZ52-2|GGA3_HUMAN	Isoform Short of ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q9NW68-9|BSDC1_HUMAN	Isoform 9 of BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|O60493-3|SNX3_HUMAN	Isoform 3 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.08	18.0	1	1	1
PRT	sp|Q9NP97-2|DLRB1_HUMAN	Isoform 2 of Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.19	18.0	2	1	0
PRT	sp|Q96EN8|MOCOS_HUMAN	Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|O94760|DDAH1_HUMAN	N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|Q5VZF2-3|MBNL2_HUMAN	Isoform 3 of Muscleblind-like protein 2 OS=Homo sapiens OX=9606 GN=MBNL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	2	1	0
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	2	1	0
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.05	18.0	2	1	0
PRT	sp|Q9UNS2|CSN3_HUMAN	COP9 signalosome complex subunit 3 OS=Homo sapiens OX=9606 GN=COPS3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P59768|GBG2_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Homo sapiens OX=9606 GN=GNG2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.17	18.0	1	1	1
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	2	1	0
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.08	18.0	3	1	0
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,8-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q6NUQ4-2|TM214_HUMAN	Isoform 2 of Transmembrane protein 214 OS=Homo sapiens OX=9606 GN=TMEM214	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.00	18.0	1	1	1
PRT	sp|Q9NW64-2|RBM22_HUMAN	Isoform 2 of Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:4	0.08	18.0	2	1	0
PRT	sp|Q13535-2|ATR_HUMAN	Isoform 2 of Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,11-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P68106-2|FKB1B_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens OX=9606 GN=FKBP1B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.16	18.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.14	18.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1260-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q9Y4P1-6|ATG4B_HUMAN	Isoform 6 of Cysteine protease ATG4B OS=Homo sapiens OX=9606 GN=ATG4B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	4	1	0
PRT	sp|P55957-3|BID_HUMAN	Isoform 3 of BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	0.09	18.0	1	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	18.0	8	1	0
PRT	sp|Q8TDX7-2|NEK7_HUMAN	Isoform 2 of Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.17	18.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q8N3F0-4|MTURN_HUMAN	Isoform 4 of Maturin OS=Homo sapiens OX=9606 GN=MTURN	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	18.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	2	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	2	1	0
PRT	sp|O00161-2|SNP23_HUMAN	Isoform SNAP-23b of Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	18.0	3	1	0
PRT	sp|P55327-2|TPD52_HUMAN	Isoform 2 of Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	18.0	2	1	0
PRT	sp|Q96BT7-3|ALKB8_HUMAN	Isoform 3 of Alkylated DNA repair protein alkB homolog 8 OS=Homo sapiens OX=9606 GN=ALKBH8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q8N8K9|K1958_HUMAN	Uncharacterized protein KIAA1958 OS=Homo sapiens OX=9606 GN=KIAA1958 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	0.02	18.0	2	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	2	1	0
PRT	sp|Q9H1Z4-2|WDR13_HUMAN	Isoform 2 of WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	3	1	0
PRT	sp|O75832-2|PSD10_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	0.12	18.0	2	1	0
PRT	sp|Q15050|RRS1_HUMAN	Ribosome biogenesis regulatory protein homolog OS=Homo sapiens OX=9606 GN=RRS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	4	1	0
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Lipid droplet-regulating VLDL assembly factor AUP1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1	0.03	18.0	2	1	0
PRT	sp|P36954|RPB9_HUMAN	DNA-directed RNA polymerase II subunit RPB9 OS=Homo sapiens OX=9606 GN=POLR2I PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	18.0	1	1	1
PRT	sp|O00159-2|MYO1C_HUMAN	Isoform 2 of Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P51790-4|CLCN3_HUMAN	Isoform 3 of H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens OX=9606 GN=CLCN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|P46734|MP2K3_HUMAN	Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	0.05	18.0	2	1	0
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.00	18.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	11	1	0
PRT	sp|O60256-3|KPRB_HUMAN	Isoform 3 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|O75147-2|OBSL1_HUMAN	Isoform 2 of Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9UNI6|DUS12_HUMAN	Dual specificity protein phosphatase 12 OS=Homo sapiens OX=9606 GN=DUSP12 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	0.06	18.0	2	1	0
PRT	sp|Q13111-2|CAF1A_HUMAN	Isoform 2 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	18.0	2	1	0
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	2	1	0
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	0
PRT	sp|Q9UPQ3-3|AGAP1_HUMAN	Isoform 3 of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|P78332-3|RBM6_HUMAN	Isoform 3 of RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q9NX47|MARH5_HUMAN	E3 ubiquitin-protein ligase MARCHF5 OS=Homo sapiens OX=9606 GN=MARCHF5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	9-UNIMOD:35	0.04	18.0	3	1	0
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.10	18.0	2	1	0
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	2	1	0
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:35	0.25	18.0	1	1	1
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|P48634-2|PRC2A_HUMAN	Isoform 2 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.00	18.0	1	1	1
PRT	sp|Q13480|GAB1_HUMAN	GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,8-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q16774|KGUA_HUMAN	Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.08	18.0	1	1	1
PRT	sp|Q7Z3U7-2|MON2_HUMAN	Isoform 2 of Protein MON2 homolog OS=Homo sapiens OX=9606 GN=MON2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.06	18.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	2	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,12-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q8TAC2-2|JOS2_HUMAN	Isoform 2 of Josephin-2 OS=Homo sapiens OX=9606 GN=JOSD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.12	18.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q86U70|LDB1_HUMAN	LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	2	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	2	1	0
PRT	sp|Q0VGL1|LTOR4_HUMAN	Ragulator complex protein LAMTOR4 OS=Homo sapiens OX=9606 GN=LAMTOR4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.10	18.0	2	1	0
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|Q13371|PHLP_HUMAN	Phosducin-like protein OS=Homo sapiens OX=9606 GN=PDCL PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.04	18.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.01	18.0	2	1	0
PRT	sp|Q8WY91|THAP4_HUMAN	Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18.0	null	4-UNIMOD:4,5-UNIMOD:4,10-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P55735|SEC13_HUMAN	Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,15-UNIMOD:35,21-UNIMOD:35	0.08	18.0	3	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,3-UNIMOD:35,3-UNIMOD:1	0.04	18.0	2	2	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:35,3-UNIMOD:1	0.08	18.0	2	2	1
PRT	sp|Q13129|RLF_HUMAN	Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,13-UNIMOD:4	0.01	18.0	1	1	0
PRT	sp|O95772|STR3N_HUMAN	STARD3 N-terminal-like protein OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.10	18.0	1	1	1
PRT	sp|Q6FIF0|ZFAN6_HUMAN	AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,14-UNIMOD:4,18-UNIMOD:4	0.12	18.0	1	1	0
PRT	sp|P27544|CERS1_HUMAN	Ceramide synthase 1 OS=Homo sapiens OX=9606 GN=CERS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,16-UNIMOD:35	0.07	18.0	3	1	0
PRT	sp|Q8WWK9|CKAP2_HUMAN	Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.02	18.0	4	1	0
PRT	sp|Q6ZT12|UBR3_HUMAN	E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens OX=9606 GN=UBR3 PE=2 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.01	18.0	1	1	1
PRT	sp|Q9HAB8|PPCS_HUMAN	Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.05	18.0	3	1	0
PRT	sp|P35612|ADDB_HUMAN	Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	0
PRT	sp|O00165-3|HAX1_HUMAN	Isoform 3 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.08	18.0	1	1	1
PRT	sp|Q8N3Y1|FBXW8_HUMAN	F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|Q86YN1|DOPP1_HUMAN	Dolichyldiphosphatase 1 OS=Homo sapiens OX=9606 GN=DOLPP1 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,7-UNIMOD:4	0.05	18.0	1	1	0
PRT	sp|P62310|LSM3_HUMAN	U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.21	18.0	1	1	1
PRT	sp|P10589|COT1_HUMAN	COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,3-UNIMOD:35	0.07	18.0	1	1	1
PRT	sp|P55263|ADK_HUMAN	Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	0
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,26-UNIMOD:4	0.06	18.0	3	1	0
PRT	sp|Q6UX04|CWC27_HUMAN	Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	0
PRT	sp|Q96RU2|UBP28_HUMAN	Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	21-UNIMOD:4,23-UNIMOD:35	0.03	18.0	1	1	1
PRT	sp|Q02447-3|SP3_HUMAN	Isoform 3 of Transcription factor Sp3 OS=Homo sapiens OX=9606 GN=SP3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	18-UNIMOD:35	0.05	18.0	1	1	1
PRT	sp|Q09019|DMWD_HUMAN	Dystrophia myotonica WD repeat-containing protein OS=Homo sapiens OX=9606 GN=DMWD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,16-UNIMOD:35,19-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q12778|FOXO1_HUMAN	Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.03	18.0	1	1	1
PRT	sp|P27540|ARNT_HUMAN	Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,10-UNIMOD:35	0.05	18.0	1	1	1
PRT	sp|Q9Y6M7-6|S4A7_HUMAN	Isoform 6 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|Q9Y6Q2|STON1_HUMAN	Stonin-1 OS=Homo sapiens OX=9606 GN=STON1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q9BQC3|DPH2_HUMAN	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Homo sapiens OX=9606 GN=DPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	0.03	18.0	1	1	0
PRT	sp|P17480|UBF1_HUMAN	Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	0.02	18.0	1	1	0
PRT	sp|Q9UL40|ZN346_HUMAN	Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,1-UNIMOD:35	0.13	18.0	1	1	1
PRT	sp|A0AVT1|UBA6_HUMAN	Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,17-UNIMOD:4	0.03	18.0	1	1	0
PRT	sp|Q7L5D6|GET4_HUMAN	Golgi to ER traffic protein 4 homolog OS=Homo sapiens OX=9606 GN=GET4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:35	0.04	17.0	2	1	0
PRT	sp|Q6ZN18-2|AEBP2_HUMAN	Isoform 2 of Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,8-UNIMOD:35	0.03	17.0	2	1	0
PRT	sp|P12955-3|PEPD_HUMAN	Isoform 3 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q9Y3C7|MED31_HUMAN	Mediator of RNA polymerase II transcription subunit 31 OS=Homo sapiens OX=9606 GN=MED31 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.11	17.0	1	1	1
PRT	sp|A2RTX5-2|SYTC2_HUMAN	Isoform 2 of Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	2	1	0
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q9H9F9|ARP5_HUMAN	Actin-related protein 5 OS=Homo sapiens OX=9606 GN=ACTR5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	2	1	0
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	3	1	0
PRT	sp|Q03188-2|CENPC_HUMAN	Isoform 2 of Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|O95684-2|CEP43_HUMAN	Isoform 2 of Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|P61758|PFD3_HUMAN	Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,8-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,3-UNIMOD:4	0.09	17.0	1	1	1
PRT	sp|L0R6Q1|S35U4_HUMAN	SLC35A4 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=SLC35A4 PE=3 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.09	17.0	1	1	1
PRT	sp|Q8IZP0-11|ABI1_HUMAN	Isoform 11 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,6-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q7Z6K3|PTAR1_HUMAN	Protein prenyltransferase alpha subunit repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PTAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.05	17.0	4	1	0
PRT	sp|Q8N371-2|KDM8_HUMAN	Isoform 2 of Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P14927|QCR7_HUMAN	Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.10	17.0	1	1	1
PRT	sp|Q9NRG1-3|PRDC1_HUMAN	Isoform 3 of Phosphoribosyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PRTFDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.07	17.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,4-UNIMOD:4,9-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|O60232|ZNRD2_HUMAN	Protein ZNRD2 OS=Homo sapiens OX=9606 GN=ZNRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.11	17.0	1	1	1
PRT	sp|P11766|ADHX_HUMAN	Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,8-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q96EK5|KBP_HUMAN	KIF-binding protein OS=Homo sapiens OX=9606 GN=KIFBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,10-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q4V328-2|GRAP1_HUMAN	Isoform 2 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	2	1	0
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,12-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q96B49|TOM6_HUMAN	Mitochondrial import receptor subunit TOM6 homolog OS=Homo sapiens OX=9606 GN=TOMM6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.38	17.0	1	1	1
PRT	sp|Q9BTX1-4|NDC1_HUMAN	Isoform 4 of Nucleoporin NDC1 OS=Homo sapiens OX=9606 GN=NDC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,9-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P18583-3|SON_HUMAN	Isoform B of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.00	17.0	2	1	0
PRT	sp|Q9NUQ3-2|TXLNG_HUMAN	Isoform 2 of Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q92769|HDAC2_HUMAN	Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	72-UNIMOD:35,76-UNIMOD:35	0.05	17.0	1	1	0
PRT	sp|Q9BVQ7-3|SPA5L_HUMAN	Isoform 3 of Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens OX=9606 GN=SPATA5L1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	17.0	1	1	0
PRT	sp|Q13418-2|ILK_HUMAN	Isoform 2 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	17.0	2	1	0
PRT	sp|Q9HD42|CHM1A_HUMAN	Charged multivesicular body protein 1a OS=Homo sapiens OX=9606 GN=CHMP1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	2	1	0
PRT	sp|Q9NP72-3|RAB18_HUMAN	Isoform 3 of Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	17.0	2	1	0
PRT	sp|P10074|TZAP_HUMAN	Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q9UL15|BAG5_HUMAN	BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	0.03	17.0	2	1	0
PRT	sp|Q8IX90-2|SKA3_HUMAN	Isoform 2 of Spindle and kinetochore-associated protein 3 OS=Homo sapiens OX=9606 GN=SKA3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.29	17.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	2	1	0
PRT	sp|Q9NVZ3-3|NECP2_HUMAN	Isoform 3 of Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	0.08	17.0	2	1	0
PRT	sp|Q96QG7|MTMR9_HUMAN	Myotubularin-related protein 9 OS=Homo sapiens OX=9606 GN=MTMR9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|O43252|PAPS1_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	0.02	17.0	3	1	0
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q9BTE1-3|DCTN5_HUMAN	Isoform 3 of Dynactin subunit 5 OS=Homo sapiens OX=9606 GN=DCTN5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	17.0	2	1	0
PRT	sp|Q96EM0|T3HPD_HUMAN	Trans-3-hydroxy-L-proline dehydratase OS=Homo sapiens OX=9606 GN=L3HYPDH PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|P54252-3|ATX3_HUMAN	Isoform 3 of Ataxin-3 OS=Homo sapiens OX=9606 GN=ATXN3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q9NXW2|DJB12_HUMAN	DnaJ homolog subfamily B member 12 OS=Homo sapiens OX=9606 GN=DNAJB12 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q5JTC6-2|AMER1_HUMAN	Isoform 2 of APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q92934|BAD_HUMAN	Bcl2-associated agonist of cell death OS=Homo sapiens OX=9606 GN=BAD PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.12	17.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|P49005|DPOD2_HUMAN	DNA polymerase delta subunit 2 OS=Homo sapiens OX=9606 GN=POLD2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	2	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q96H55-2|MYO19_HUMAN	Isoform 2 of Unconventional myosin-XIX OS=Homo sapiens OX=9606 GN=MYO19	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1	0.05	17.0	1	1	1
PRT	sp|Q9ULR5|PAI2B_HUMAN	Polyadenylate-binding protein-interacting protein 2B OS=Homo sapiens OX=9606 GN=PAIP2B PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	0.11	17.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q9H0U4|RAB1B_HUMAN	Ras-related protein Rab-1B OS=Homo sapiens OX=9606 GN=RAB1B PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q96K17-3|BT3L4_HUMAN	Isoform 3 of Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.10	17.0	2	1	0
PRT	sp|P33121-2|ACSL1_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens OX=9606 GN=ACSL1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q8IUI8|CRLF3_HUMAN	Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	0.04	17.0	2	1	0
PRT	sp|Q14BN4-2|SLMAP_HUMAN	Isoform 2 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	10-UNIMOD:4	0.01	17.0	1	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q6ZW49|PAXI1_HUMAN	PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|Q8NEV1|CSK23_HUMAN	Casein kinase II subunit alpha 3 OS=Homo sapiens OX=9606 GN=CSNK2A3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,5-UNIMOD:35	0.10	17.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,6-UNIMOD:35	0.01	17.0	2	1	0
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q96FV9-2|THOC1_HUMAN	Isoform 2 of THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|A2RU49-2|HYKK_HUMAN	Isoform 2 of Hydroxylysine kinase OS=Homo sapiens OX=9606 GN=HYKK	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.08	17.0	1	1	1
PRT	sp|P62820-3|RAB1A_HUMAN	Isoform 3 of Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1,4-UNIMOD:35	0.09	17.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|P49959-2|MRE11_HUMAN	Isoform 2 of Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.19	17.0	1	1	1
PRT	sp|P31271|HXA13_HUMAN	Homeobox protein Hox-A13 OS=Homo sapiens OX=9606 GN=HOXA13 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.02	17.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.00	17.0	1	1	1
PRT	sp|Q9H410|DSN1_HUMAN	Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	3-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|Q9BU02|THTPA_HUMAN	Thiamine-triphosphatase OS=Homo sapiens OX=9606 GN=THTPA PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	0
PRT	sp|Q9BXJ8|TACAN_HUMAN	Ion channel TACAN OS=Homo sapiens OX=9606 GN=TMEM120A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	0.04	17.0	2	1	0
PRT	sp|O14979-2|HNRDL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1	0.06	17.0	1	1	0
PRT	sp|Q5TKA1|LIN9_HUMAN	Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	165-UNIMOD:35,169-UNIMOD:35	0.04	17.0	1	1	0
PRT	sp|O95630|STABP_HUMAN	STAM-binding protein OS=Homo sapiens OX=9606 GN=STAMBP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.03	17.0	1	1	0
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1	0.03	17.0	1	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|P17252|KPCA_HUMAN	Protein kinase C alpha type OS=Homo sapiens OX=9606 GN=PRKCA PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.03	17.0	2	1	0
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	0
PRT	sp|Q9GZV4|IF5A2_HUMAN	Eukaryotic translation initiation factor 5A-2 OS=Homo sapiens OX=9606 GN=EIF5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,20-UNIMOD:35,22-UNIMOD:4	0.16	17.0	1	1	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	3-UNIMOD:1,10-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q9Y3C0|WASC3_HUMAN	WASH complex subunit 3 OS=Homo sapiens OX=9606 GN=WASHC3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	0.09	17.0	1	1	1
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q7L1T6|NB5R4_HUMAN	Cytochrome b5 reductase 4 OS=Homo sapiens OX=9606 GN=CYB5R4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|Q99496|RING2_HUMAN	E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q9BVQ7|SPA5L_HUMAN	Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens OX=9606 GN=SPATA5L1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	17.0	1	1	0
PRT	sp|Q8TED1|GPX8_HUMAN	Probable glutathione peroxidase 8 OS=Homo sapiens OX=9606 GN=GPX8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17.0	null	10-UNIMOD:4	0.01	17.0	1	1	0
PRT	sp|Q8N8E3|CE112_HUMAN	Centrosomal protein of 112 kDa OS=Homo sapiens OX=9606 GN=CEP112 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|O95772-2|STR3N_HUMAN	Isoform 2 of STARD3 N-terminal-like protein OS=Homo sapiens OX=9606 GN=STARD3NL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	17.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	119-UNIMOD:35,135-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|Q9NR22|ANM8_HUMAN	Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17.0	null	295-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q6QNY1|BL1S2_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.08	16.0	2	1	0
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.05	16.0	1	1	1
PRT	sp|Q9NZM5|NOP53_HUMAN	Ribosome biogenesis protein NOP53 OS=Homo sapiens OX=9606 GN=NOP53 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q92979|NEP1_HUMAN	Ribosomal RNA small subunit methyltransferase NEP1 OS=Homo sapiens OX=9606 GN=EMG1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.04	16.0	2	1	0
PRT	sp|Q13144|EI2BE_HUMAN	Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q8IUX1-3|T126B_HUMAN	Isoform 3 of Complex I assembly factor TMEM126B, mitochondrial OS=Homo sapiens OX=9606 GN=TMEM126B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,5-UNIMOD:35	0.15	16.0	1	1	1
PRT	sp|Q7Z406-5|MYH14_HUMAN	Isoform 5 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,6-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|O43861-2|ATP9B_HUMAN	Isoform 2 of Probable phospholipid-transporting ATPase IIB OS=Homo sapiens OX=9606 GN=ATP9B	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q9BYT3-2|STK33_HUMAN	Isoform 2 of Serine/threonine-protein kinase 33 OS=Homo sapiens OX=9606 GN=STK33	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q5T447|HECD3_HUMAN	E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.01	16.0	2	1	0
PRT	sp|P42696-2|RBM34_HUMAN	Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,6-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|O60683|PEX10_HUMAN	Peroxisome biogenesis factor 10 OS=Homo sapiens OX=9606 GN=PEX10 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q8N7H5-3|PAF1_HUMAN	Isoform 3 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P49427|UB2R1_HUMAN	Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens OX=9606 GN=CDC34 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|Q99622|C10_HUMAN	Protein C10 OS=Homo sapiens OX=9606 GN=C12orf57 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.13	16.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.07	16.0	1	1	1
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,12-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q9H6R4-3|NOL6_HUMAN	Isoform 3 of Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8N4P3-2|MESH1_HUMAN	Isoform 2 of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 OS=Homo sapiens OX=9606 GN=HDDC3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.11	16.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8N5A5-3|ZGPAT_HUMAN	Isoform 3 of Zinc finger CCCH-type with G patch domain-containing protein OS=Homo sapiens OX=9606 GN=ZGPAT	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	3	1	0
PRT	sp|Q8N2Z9-3|CENPS_HUMAN	Isoform 3 of Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	16.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q8IUI8-2|CRLF3_HUMAN	Isoform 2 of Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	2	1	0
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.16	16.0	1	1	1
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,7-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P42574|CASP3_HUMAN	Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|P54687|BCAT1_HUMAN	Branched-chain-amino-acid aminotransferase, cytosolic OS=Homo sapiens OX=9606 GN=BCAT1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|Q9BSU1|CP070_HUMAN	UPF0183 protein C16orf70 OS=Homo sapiens OX=9606 GN=C16orf70 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:35,1-UNIMOD:1	0.02	16.0	2	1	0
PRT	sp|Q9NPA3|M1IP1_HUMAN	Mid1-interacting protein 1 OS=Homo sapiens OX=9606 GN=MID1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|P53004|BIEA_HUMAN	Biliverdin reductase A OS=Homo sapiens OX=9606 GN=BLVRA PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q9NVT9|ARMC1_HUMAN	Armadillo repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=ARMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.08	16.0	2	1	0
PRT	sp|O75400-3|PR40A_HUMAN	Isoform 3 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q9HBM1|SPC25_HUMAN	Kinetochore protein Spc25 OS=Homo sapiens OX=9606 GN=SPC25 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	16.0	2	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,14-UNIMOD:4	0.04	16.0	2	1	0
PRT	sp|O75914-2|PAK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 3 OS=Homo sapiens OX=9606 GN=PAK3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|P31749|AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|O60825-2|F262_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q9NZC9|SMAL1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|Q6ZVH7-3|ESPNL_HUMAN	Isoform 3 of Espin-like protein OS=Homo sapiens OX=9606 GN=ESPNL	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,7-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|Q16851|UGPA_HUMAN	UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.04	16.0	1	1	1
PRT	sp|Q15796-2|SMAD2_HUMAN	Isoform Short of Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	2	1	0
PRT	sp|P51397|DAP1_HUMAN	Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.11	16.0	1	1	1
PRT	sp|Q15398-3|DLGP5_HUMAN	Isoform 3 of Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|Q9H000-2|MKRN2_HUMAN	Isoform 2 of Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens OX=9606 GN=MKRN2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1,8-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q96HN2-2|SAHH3_HUMAN	Isoform 2 of Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|O95777|LSM8_HUMAN	U6 snRNA-associated Sm-like protein LSm8 OS=Homo sapiens OX=9606 GN=LSM8 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null	2-UNIMOD:1	0.10	16.0	1	1	1
PRT	sp|Q9Y6D0|SELK_HUMAN	Selenoprotein K OS=Homo sapiens OX=9606 GN=SELENOK PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.13	16.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	0
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9NR50|EI2BG_HUMAN	Translation initiation factor eIF-2B subunit gamma OS=Homo sapiens OX=9606 GN=EIF2B3 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q92567|F168A_HUMAN	Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.07	16.0	1	1	0
PRT	sp|O75956|CDKA2_HUMAN	Cyclin-dependent kinase 2-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK2AP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.35	16.0	1	1	1
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	0
PRT	sp|P62491|RB11A_HUMAN	Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.06	16.0	1	1	0
PRT	sp|Q86Y56|DAAF5_HUMAN	Dynein assembly factor 5, axonemal OS=Homo sapiens OX=9606 GN=DNAAF5 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q12765|SCRN1_HUMAN	Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,9-UNIMOD:4	0.04	16.0	2	1	0
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,19-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P10155|RO60_HUMAN	60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=RO60 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	0
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,17-UNIMOD:35	0.12	16.0	1	1	1
PRT	sp|Q15287|RNPS1_HUMAN	RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|P60953|CDC42_HUMAN	Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|P17098|ZNF8_HUMAN	Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.03	16.0	1	1	1
PRT	sp|Q68D20|PMS2L_HUMAN	Protein PMS2CL OS=Homo sapiens OX=9606 GN=PMS2CL PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	3-UNIMOD:1,10-UNIMOD:35	0.06	16.0	1	1	1
PRT	sp|O60427|FADS1_HUMAN	Acyl-CoA (8-3)-desaturase OS=Homo sapiens OX=9606 GN=FADS1 PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.04	16.0	1	1	1
PRT	sp|Q2QGD7|ZXDC_HUMAN	Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.02	16.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,5-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9Y5Z4|HEBP2_HUMAN	Heme-binding protein 2 OS=Homo sapiens OX=9606 GN=HEBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.12	16.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.05	16.0	1	1	1
PRT	sp|Q7Z388|D19L4_HUMAN	Probable C-mannosyltransferase DPY19L4 OS=Homo sapiens OX=9606 GN=DPY19L4 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.02	16.0	1	1	1
PRT	sp|Q96G74-2|OTUD5_HUMAN	Isoform 2 of OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9Y2I7|FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1	0.01	16.0	1	1	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	0.09	16.0	1	1	1
PRT	sp|Q8WVX3-2|CD003_HUMAN	Isoform 2 of Uncharacterized protein C4orf3 OS=Homo sapiens OX=9606 GN=C4orf3	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.00	16.0	1	1	0
PRT	sp|Q9NNW5|WDR6_HUMAN	WD repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=WDR6 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q6Q759|SPG17_HUMAN	Sperm-associated antigen 17 OS=Homo sapiens OX=9606 GN=SPAG17 PE=2 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	763-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q9NYB9|ABI2_HUMAN	Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1	null	null	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1,6-UNIMOD:35	0.03	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	67	1-UNIMOD:1	ms_run[2]:scan=16393	64.525	2	2428.1102	2428.1102	M	R	2	32
PSM	ANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSG	2	sp|Q5VTL8-2|PR38B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	64	1-UNIMOD:1,28-UNIMOD:4	ms_run[2]:scan=11722	47.51	3	3870.8052	3870.8052	M	K	2	42
PSM	AAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSR	3	sp|Q6VN20-3|RBP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	61	1-UNIMOD:1	ms_run[2]:scan=16051	63.313	3	3231.4665	3231.4665	M	R	2	38
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	4	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	60	1-UNIMOD:1	ms_run[2]:scan=16531	64.99	3	2428.1102	2428.1102	M	R	2	32
PSM	AETLSGLGDSGAAGAAALSSASSETGTR	5	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	58	1-UNIMOD:1	ms_run[2]:scan=23288	88.487	3	2536.1889	2536.1889	M	R	2	30
PSM	SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGA	6	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	57	1-UNIMOD:1	ms_run[1]:scan=27898	107.24165594746667	4	5470.3782	5470.3482	M	K	2	67
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	7	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	56	1-UNIMOD:1	ms_run[2]:scan=22465	85.439	3	3477.5808	3477.5808	M	K	2	33
PSM	AAADGGGPGGASVGTEEDGGGVGH	8	sp|A6NHR9-2|SMHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	55	1-UNIMOD:1	ms_run[2]:scan=10174	41.871	2	2022.8515	2022.8515	M	R	2	26
PSM	KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	9	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	54		ms_run[2]:scan=10883	44.638	3	3752.6409	3752.6409	A	-	157	196
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	10	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	54	1-UNIMOD:1	ms_run[1]:scan=18136	70.33357111653332	4	5340.4582	5340.4222	M	R	2	70
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	11	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	52	1-UNIMOD:1	ms_run[2]:scan=15249	60.457	3	2679.3253	2679.3253	M	R	2	31
PSM	ADVLDLHEAGGEDFAMDEDGDESIH	12	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=23286	88.476	3	2744.1032	2744.1032	M	K	2	27
PSM	ADVLDLHEAGGEDFAMDEDGDESIH	13	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=23406	88.949	3	2744.1032	2744.1032	M	K	2	27
PSM	AETLPGSGDSGPGTASLGPGVAETGTR	14	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1	ms_run[2]:scan=17919	69.633	2	2483.1776	2483.1776	M	R	2	29
PSM	STEAQRVDDSPSTSGGSSDGDQ	15	sp|Q96LR5|UB2E2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	51	1-UNIMOD:1	ms_run[2]:scan=7229	30.308	2	2223.9	2223.9000	M	R	2	24
PSM	AAAAVQGGRSGGSGGCSGAGGASNCGTGSG	16	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1,16-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=7197	30.184	2	2524.0415	2524.0415	M	R	2	32
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRL	17	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1	ms_run[2]:scan=24632	93.891	3	2720.4093	2720.4093	M	R	2	34
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRL	18	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1	ms_run[2]:scan=24743	94.354	3	2720.4093	2720.4093	M	R	2	34
PSM	AAGGGGGSSKASSSSASSAGALESSLD	19	sp|Q5VT52-4|RPRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1	ms_run[2]:scan=13396	53.788	2	2297.0255	2297.0255	M	R	2	29
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGT	20	sp|O95197-6|RTN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1,33-UNIMOD:4	ms_run[2]:scan=19076	73.543	3	3483.5485	3483.5485	M	K	2	40
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	21	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:1	ms_run[2]:scan=15390	60.942	2	2679.3253	2679.3253	M	R	2	31
PSM	AAAAVGAGHGAGGPGAASSSGGA	22	sp|Q96K37|S35E1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=8608	35.842	2	1749.803	1749.8030	M	R	2	25
PSM	AAGGGGGSSKASSSSASSAGALESSLD	23	sp|Q5VT52-4|RPRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=13401	53.807	2	2297.0255	2297.0255	M	R	2	29
PSM	ADDQGCIEEQGVEDSANEDSVDAKPD	24	sp|P55210-2|CASP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=15135	60.031	3	2834.1308	2834.1308	M	R	2	28
PSM	KALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEE	25	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	13-UNIMOD:4	ms_run[2]:scan=23649	89.884	3	3807.9214	3807.9214	A	K	49	92
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	26	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13188	53.007	3	2911.1825	2911.1825	-	R	1	26
PSM	MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEK	27	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23933	91.003	3	3747.5696	3747.5696	-	K	1	38
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	28	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:1	ms_run[2]:scan=15383	60.928	3	2679.3253	2679.3253	M	R	2	31
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	29	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:1	ms_run[2]:scan=26502	101.58	3	3263.375	3263.3750	M	K	2	33
PSM	AAAAAAAAAAGAAGGRGSGPG	30	sp|Q86U42-2|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47	1-UNIMOD:1	ms_run[2]:scan=17281	67.581	2	1594.7812	1594.7812	M	R	2	23
PSM	KGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	31	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=11006	45.093	3	3752.6409	3752.6409	A	-	157	196
PSM	SEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGA	32	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	47	1-UNIMOD:1	ms_run[1]:scan=27848	107.03539505093333	4	5470.3782	5470.3482	M	K	2	67
PSM	AAAAAAAGDSDSWDADAFSVEDPVR	33	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=25887	99.036	2	2506.0884	2506.0884	M	K	2	27
PSM	AASGAVEPGPPGAAVAPSPAPAPPPAPDHLF	34	sp|O75312|ZPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=24302	92.552	3	2854.429	2854.4290	M	R	2	33
PSM	AETLSGLGDSGAAGAAALSSASSETGTR	35	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1	ms_run[2]:scan=23405	88.947	3	2536.1889	2536.1889	M	R	2	30
PSM	MHSLATAAPVPTTLAQVDRE	36	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17738	69.04	2	2165.0787	2165.0787	-	K	1	21
PSM	MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEK	37	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23976	91.183	3	3747.5696	3747.5696	-	K	1	38
PSM	SSSSPTGQIASAADIKQENGMESASEGQEAH	38	sp|Q9UIU6|SIX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:1,21-UNIMOD:35	ms_run[2]:scan=13098	52.669	3	3161.3691	3161.3691	M	R	2	33
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	39	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46	1-UNIMOD:1	ms_run[1]:scan=18411	71.26323274106667	4	4385.0792	4385.0522	M	K	2	52
PSM	ADEEEDPTFEEENEEIGGGAEGGQGK	40	sp|Q15543|TAF13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	46	1-UNIMOD:1	ms_run[1]:scan=16911	66.33099549013333	2	2765.1312	2764.1102	M	R	2	28
PSM	AAAAAAAGDSDSWDADAFSVEDPVR	41	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=25901	99.093	2	2506.0884	2506.0884	M	K	2	27
PSM	AAAAVQGGRSGGSGGCSGAGGASNCGTGSG	42	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,16-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=7179	30.118	3	2524.0415	2524.0415	M	R	2	32
PSM	AAPAGGGGSAVSVLAPNGR	43	sp|Q9BZE9|ASPC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=14878	59.084	2	1649.8485	1649.8485	M	R	2	21
PSM	AASGAVEPGPPGAAVAPSPAPAPPPAPDHLF	44	sp|O75312|ZPR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=24416	92.994	3	2854.429	2854.4290	M	R	2	33
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	45	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=16735	65.727	3	2001.9392	2001.9392	M	R	2	27
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	46	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=26395	101.13	3	3263.375	3263.3750	M	K	2	33
PSM	AERGGAGGGPGGAGGGSGQ	47	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1	ms_run[2]:scan=4347	18.497	2	1497.6556	1497.6556	M	R	2	21
PSM	MDHTDNELQGTNSSGSLGGLDVR	48	sp|Q75N03-2|HAKAI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15275	60.551	3	2460.0823	2460.0823	-	R	1	24
PSM	PSSSDTALGGGGGLSWAEK	49	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=15133	60.022	2	1775.8326	1775.8326	M	K	2	21
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	50	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:1	ms_run[1]:scan=18664	72.099643372	4	5340.4582	5340.4222	M	R	2	70
PSM	AAPEEHDSPTEASQPIVEEEETKTF	51	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=17745	69.058	3	2812.2563	2812.2563	M	K	2	27
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	52	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=16717	65.664	2	2001.9392	2001.9392	M	R	2	27
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	53	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=16849	66.143	2	2001.9392	2001.9392	M	R	2	27
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPK	54	sp|O00148-3|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=25058	95.668	3	3424.4954	3424.4954	M	K	2	32
PSM	ASGVAVSDGVIKVFNDM	55	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=25459	97.251	2	1765.8557	1765.8557	M	K	2	19
PSM	ASGVAVSDGVIKVFNDM	56	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=30094	115.5	2	1749.8607	1749.8607	M	K	2	19
PSM	PGGGPQGAPAAAGGGGVSH	57	sp|Q9NRI5-11|DISC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=5115	21.651	2	1500.707	1500.7070	M	R	2	21
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	58	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=15514	61.385	3	2679.3253	2679.3253	M	R	2	31
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	59	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:1	ms_run[2]:scan=15819	62.485	3	2633.3085	2633.3085	M	R	2	27
PSM	AAAAAAGPSPGSGPGDSPEGPEGEAPER	60	sp|Q9UID3|VPS51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=11995	48.548	3	2530.1208	2530.1208	M	R	2	30
PSM	AAAAECDVVMAATEPELLDDQEAK	61	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=26386	101.09	3	2604.1571	2604.1571	M	R	2	26
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	62	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=26288	100.67	3	3263.375	3263.3750	M	K	2	33
PSM	AEQEPTAEQLAQIAAENEEDEHSVNY	63	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=25396	97.012	3	2956.2846	2956.2846	M	K	2	28
PSM	AGVGDAAAPGEGGGGGVDGPQRDG	64	sp|Q6NXT6-2|TAPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=10539	43.296	3	2064.9097	2064.9097	M	R	2	26
PSM	ASGVAVSDGVIKVFNDM	65	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=25335	96.78	2	1765.8557	1765.8557	M	K	2	19
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	66	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=19350	74.462	3	3820.7439	3820.7439	M	K	2	36
PSM	MEDLDQSPLVSSSDSPPRPQPAF	67	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22688	86.238	3	2557.1642	2557.1642	-	K	1	24
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	68	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13060	52.519	3	2911.1825	2911.1825	-	R	1	26
PSM	MEVAEPSSPTEEEEEEEEHSAEPRP	69	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=15552	61.539	3	2895.1876	2895.1876	-	R	1	26
PSM	MHSLATAAPVPTTLAQVDRE	70	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17752	69.077	2	2165.0787	2165.0787	-	K	1	21
PSM	SEGDSVGESVHGKPSVVY	71	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=11979	48.485	2	1873.8694	1873.8694	M	R	2	20
PSM	SQGDSNPAAIPHAAEDIQGDD	72	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=15316	60.696	2	2148.9196	2148.9196	M	R	2	23
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	73	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:1	ms_run[2]:scan=15948	62.935	3	2633.3085	2633.3085	M	R	2	27
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	74	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=11152	45.629015948799996	2	2681.2052	2680.1802	M	R	2	29
PSM	AAAAASGAGGAAGAGTGGAGPAG	75	sp|Q9Y2K2-7|SIK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=10668	43.8	2	1639.755	1639.7550	M	R	2	25
PSM	ADVEDGEETCALASHSGSSGS	76	sp|Q9UBF6-3|RBX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=13385	53.748	2	2106.8284	2106.8284	M	K	2	23
PSM	ADVLDLHEAGGEDFAMDEDGDESIH	77	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=25099	95.856	3	2728.1082	2728.1082	M	K	2	27
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	78	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=21968	83.545	3	3105.3912	3105.3912	M	R	2	37
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	79	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=23715	90.152	3	3263.375	3263.3750	M	K	2	33
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPK	80	sp|O00148-3|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=25030	95.549	3	3424.4954	3424.4954	M	K	2	32
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPK	81	sp|O00148-3|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=25167	96.127	3	3424.4954	3424.4954	M	K	2	32
PSM	APPAPGPASGGSGEVDELFDV	82	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=24866	94.87	2	1967.9113	1967.9113	M	K	2	23
PSM	AQEEEDVRDYNLTEEQ	83	sp|Q8IWT0-2|ARCH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=16545	65.036	2	2008.8498	2008.8498	M	K	2	18
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	84	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=24282	92.474	3	3518.5254	3518.5254	I	R	693	727
PSM	MDRPAAAAAAGCEGGGGPNPGPAGG	85	sp|Q13613-2|MTMR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=12287	49.657	2	2206.9484	2206.9484	-	R	1	26
PSM	METEQPEETFPNTETNGEFGK	86	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16727	65.702	2	2472.0275	2472.0275	-	R	1	22
PSM	PSETPQAEVGPTGCPH	87	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	14-UNIMOD:4	ms_run[2]:scan=7171	30.083	2	1662.7308	1662.7308	M	R	2	18
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	88	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=14298	57.045	2	2664.1861	2664.1861	M	R	2	29
PSM	SGESGQPEAGPSHAGLDWPNPERN	89	sp|Q6NSI4-2|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:1	ms_run[2]:scan=15766	62.293	3	2530.1109	2530.1109	M	R	2	26
PSM	ASAAAASAAAASAASGSPGPGEGSAGGEK	90	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=15026	59.625298229066665	3	2357.0932	2357.0722	A	R	3	32
PSM	SEHVEPAAPGPGPNGGGGGPAPA	91	sp|Q4ZIN3|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=10442	42.94770621786667	2	2021.9382	2020.9232	M	R	2	25
PSM	AAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGA	92	sp|Q9NR33|DPOE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=15505	61.358	3	3173.4861	3173.4861	M	R	2	37
PSM	AAAAECDVVMAATEPELLDDQEAK	93	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=26489	101.52	3	2604.1571	2604.1571	M	R	2	26
PSM	AAVGAGGSTAAPGPGAVSAGALEPGTASAAH	94	sp|P78381-3|S35A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=17528	68.395	3	2572.2518	2572.2518	M	R	2	33
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEP	95	sp|Q9P2K5-4|MYEF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=14423	57.463	2	2750.2784	2750.2784	M	R	2	30
PSM	ADDLDFETGDAGASATFPMQCSALR	96	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=24125	91.819	3	2703.1429	2703.1429	M	K	2	27
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGT	97	sp|O95197-6|RTN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,33-UNIMOD:4	ms_run[2]:scan=19218	74.006	3	3483.5485	3483.5485	M	K	2	40
PSM	AEQEPTAEQLAQIAAENEEDEHSVNY	98	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=25404	97.043	2	2956.2846	2956.2846	M	K	2	28
PSM	AGGPPKALPSTGPHSL	99	sp|Q5VWJ9|SNX30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=12228	49.417	2	1527.8045	1527.8045	M	R	2	18
PSM	APPAPGPASGGSGEVDELFDV	100	sp|O14579-3|COPE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=24746	94.368	2	1967.9113	1967.9113	M	K	2	23
PSM	ATPYVTDETGGKYIASTQ	101	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=16770	65.85	2	1942.916	1942.9160	M	R	2	20
PSM	KEMFPYEASTPTGISASC	102	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	18-UNIMOD:4	ms_run[2]:scan=16841	66.107	2	1974.8703	1974.8703	L	R	237	255
PSM	KEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGL	103	sp|Q13501-2|SQSTM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	15-UNIMOD:35	ms_run[2]:scan=21287	81.084	3	3541.6254	3541.6254	S	K	260	294
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	104	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	24-UNIMOD:35	ms_run[2]:scan=21042	80.2	3	3534.5203	3534.5203	I	R	693	727
PSM	KTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA	105	sp|Q15714-2|T22D1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=21199	80.761	4	4599.2841	4599.2841	L	-	99	145
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGGR	106	sp|Q16644|MAPK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17615	68.658	3	2868.3348	2868.3348	-	R	1	32
PSM	MEPTAPSLTEEDLTEVK	107	sp|O95999|BCL10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19831	75.936	2	1946.9031	1946.9031	-	K	1	18
PSM	MEPTAPSLTEEDLTEVK	108	sp|O95999|BCL10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19969	76.41	2	1946.9031	1946.9031	-	K	1	18
PSM	METDAPQPGLASPDSPHDPC	109	sp|O43347|MSI1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=12925	52.008	2	2178.8834	2178.8834	-	K	1	21
PSM	MMHPVASSNPAFCGPGKPSCLNEDAM	110	sp|Q7Z6I8-2|CE024_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=13178	52.966	3	2894.1802	2894.1802	-	R	1	27
PSM	PTGDFDSKPSWADQVEEEGEDD	111	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=17723	68.989	2	2451.9826	2451.9826	M	K	2	24
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	112	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=15688	62.023	3	2633.3085	2633.3085	M	R	2	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	113	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=16080	63.418	3	2633.3085	2633.3085	M	R	2	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	114	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:1	ms_run[2]:scan=15951	62.943	2	2633.3085	2633.3085	M	R	2	27
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	115	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1	ms_run[1]:scan=18278	70.81756094826666	4	5340.4582	5340.4222	M	R	2	70
PSM	STEAQRVDDSPSTSGGSSDGDQ	116	sp|Q96LR5|UB2E2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:1	ms_run[1]:scan=7201	30.199568828266667	2	2223.9132	2223.8992	M	R	2	24
PSM	AAAAECDVVMAATEPELLDDQEAK	117	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=26591	101.96	3	2604.1571	2604.1571	M	R	2	26
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	118	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=21109	80.433	3	3231.2948	3231.2948	M	K	2	32
PSM	AAALGASGGAGAGDDDFDQFDKPGAE	119	sp|Q96EV2-2|RBM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=22213	84.503	3	2451.0462	2451.0462	M	R	2	28
PSM	AATGANAEKAESHNDCPV	120	sp|Q16831|UPP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=7606	31.815	2	1882.8116	1882.8116	M	R	2	20
PSM	AAVGAGGSTAAPGPGAVSAGALEPGTASAAH	121	sp|P78381-3|S35A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=17485	68.253	3	2572.2518	2572.2518	M	R	2	33
PSM	ADEDGEGIHPSAPH	122	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=7965	33.214	2	1472.6168	1472.6168	M	R	2	16
PSM	ADLSLADALTEPSPDIEGEIK	123	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=29312	112.54	2	2225.0951	2225.0951	M	R	2	23
PSM	AEASAAGADSGAAVAAH	124	sp|Q9Y4L5|RN115_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=8774	36.501	2	1467.659	1467.6590	M	R	2	19
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	125	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=22590	85.897	4	3477.5808	3477.5808	M	K	2	33
PSM	ALDGPEQMELEEGKAGSGL	126	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=22720	86.34	2	1971.9095	1971.9095	M	R	2	21
PSM	ARYEEVSVSGFEEFH	127	sp|Q9BRA2|TXD17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=21185	80.704	2	1826.8111	1826.8111	M	R	2	17
PSM	KEMFPYEASTPTGISASC	128	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=14968	59.416	2	1990.8652	1990.8652	L	R	237	255
PSM	KGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEA	129	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=12717	51.231	3	3176.4382	3176.4382	P	K	43	77
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	130	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16818	66.023	3	2523.1547	2523.1547	-	K	1	25
PSM	MDRPAAAAAAGCEGGGGPNPGPAGG	131	sp|Q13613-2|MTMR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=12255	49.519	3	2206.9484	2206.9484	-	R	1	26
PSM	MEDLDQSPLVSSSDSPPRPQPAF	132	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22561	85.781	3	2557.1642	2557.1642	-	K	1	24
PSM	MNVDHEVNLLVEEIH	133	sp|Q9P1F3|ABRAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25827	98.772	2	1847.8724	1847.8724	-	R	1	16
PSM	PGLVDSNPAPPESQEK	134	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8426	35.112	2	1663.8053	1663.8053	M	K	2	18
PSM	PSETPQAEVGPTGCPH	135	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	14-UNIMOD:4	ms_run[2]:scan=7281	30.514	2	1662.7308	1662.7308	M	R	2	18
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	136	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=14381	57.341	3	2664.1861	2664.1861	M	R	2	29
PSM	SGESGQPEAGPSHAGLDWPNPERN	137	sp|Q6NSI4-2|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=15664	61.932	2	2530.1109	2530.1109	M	R	2	26
PSM	SKQQPTQFINPETPGYVGFANLPNQVH	138	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=23880	90.787	3	3052.5043	3052.5043	M	R	2	29
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	139	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=16221	63.91	3	2633.3085	2633.3085	M	R	2	27
PSM	SVAGGEIRGDTGGEDTAAPG	140	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:1	ms_run[2]:scan=11387	46.389	2	1857.8341	1857.8341	M	R	2	22
PSM	MEEEGGSSGGAAGTSADGGDGGEQLLTVKHEL	141	sp|O75582|KS6A5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17657	68.79239018533333	3	3105.379527	3103.352397	-	R	1	33
PSM	MDRPAAAAAAGCEGGGGPNPGPAGG	142	sp|Q13613|MTMR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	40	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=9554	39.56785145893333	2	2223.956980	2222.943315	-	R	1	26
PSM	AASAAAASAAAASAASGSPGPGEGSAGGE	143	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=19614	75.215	3	2300.0153	2300.0153	M	K	2	31
PSM	ADHSFSDGVPSDSVEAAKNASNTE	144	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=14487	57.685	3	2476.0626	2476.0626	M	K	2	26
PSM	ADLSLADALTEPSPDIEGEIK	145	sp|P27816-2|MAP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=29195	112.12	2	2225.0951	2225.0951	M	R	2	23
PSM	AELDIGQHCQVEHC	146	sp|Q8TCF1-4|ZFAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,9-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=13019	52.369	2	1736.7247	1736.7247	M	R	2	16
PSM	AEPDYIEDDNPELIRPQ	147	sp|Q9H098|F107B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=21706	82.632	2	2054.9433	2054.9433	M	K	2	19
PSM	AGDSEQTLQNHQQPNGGEPFLIGVSGGTASG	148	sp|Q9BZX2|UCK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=18629	71.984	3	3052.4122	3052.4122	M	K	2	33
PSM	ASACGAPGPGGALGSQAPSWYH	149	sp|O15357|SHIP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=20381	77.836	3	2139.9432	2139.9432	M	R	2	24
PSM	ASASSGPSSSVGFSSFDPAVPSCTLSSASGIK	150	sp|Q99755-2|PI51A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,23-UNIMOD:4	ms_run[2]:scan=25072	95.73	3	3073.4186	3073.4186	M	R	2	34
PSM	KAAEAAPPTQEAQGETEPTEQAPDALEQAADTS	151	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=14405	57.41	3	3351.5226	3351.5226	Q	R	446	479
PSM	KEAPAEGEAAEPGSPTAAEGEAASAASSTSSP	152	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=12410	50.103	3	2914.2952	2914.2952	E	K	105	137
PSM	KGVVPLAGTNGETTTQGLDGLSE	153	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=16813	66.008	2	2243.1281	2243.1281	D	R	111	134
PSM	KTDLNPDNLQGGDDLDPNYVLSS	154	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=20807	79.326	2	2489.1558	2489.1558	H	R	107	130
PSM	MDLAAAAEPGAGSQHLEVRDEVAE	155	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=20491	78.211	3	2507.1598	2507.1598	-	K	1	25
PSM	MEGSEPVAAHQGEEASCSSWGTGSTN	156	sp|A0AVT1-4|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=15563	61.57	2	2707.0762	2707.0762	-	K	1	27
PSM	MENGAVYSPTTEEDPGPARGP	157	sp|Q9NX76|CKLF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13490	54.136	2	2231.9641	2231.9641	-	R	1	22
PSM	MLQQDSNDDTEDVSLFDAEEETTNRP	158	sp|Q96ET8-2|TV23C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23505	89.315	3	3056.2677	3056.2677	-	R	1	27
PSM	PGLVDSNPAPPESQEK	159	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8313	34.662	2	1663.8053	1663.8053	M	K	2	18
PSM	PNIVLFSGSSHQDLSQ	160	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=16665	65.471	2	1727.8479	1727.8479	M	R	2	18
PSM	PNIVLFSGSSHQDLSQ	161	sp|P11908|PRPS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=16796	65.941	2	1727.8479	1727.8479	M	R	2	18
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	162	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1,24-UNIMOD:35	ms_run[2]:scan=11075	45.357	3	2680.181	2680.1810	M	R	2	29
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	163	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=19946	76.332	3	3008.4098	3008.4098	M	K	2	33
PSM	SQGDSNPAAIPHAAEDIQGDD	164	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=15447	61.152	2	2148.9196	2148.9196	M	R	2	23
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	165	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=15560	61.564	3	2633.3085	2633.3085	M	R	2	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	166	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=16086	63.438	2	2633.3085	2633.3085	M	R	2	27
PSM	SVAGGEIRGDTGGEDTAAPG	167	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=11515	46.813	2	1857.8341	1857.8341	M	R	2	22
PSM	VEKEEAGGGISEEEAAQYD	168	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:1	ms_run[2]:scan=14880	59.091	2	2051.8807	2051.8807	M	R	2	21
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	169	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=18015	69.92924467226666	4	5340.4582	5340.4222	M	R	2	70
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	170	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=13880	55.53895270933333	5	6491.7882	6490.7622	M	K	2	71
PSM	METEQPEETFPNTETNGEFGK	171	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	39	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17348	67.80132054293333	2	2473.027952	2472.027481	-	R	1	22
PSM	AAAAAAGAASGLPGPVAQGL	172	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=26221	100.4	2	1661.8737	1661.8737	M	K	2	22
PSM	AAGGSDPRAGDVEEDASQLIFP	173	sp|O15514|RPB4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=27736	106.6	2	2243.0342	2243.0342	M	K	2	24
PSM	ADEDGEGIHPSAPH	174	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=8076	33.678	2	1472.6168	1472.6168	M	R	2	16
PSM	ADEEEDPTFEEENEEIGGGAEGGQGK	175	sp|Q15543|TAF13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=16894	66.269	3	2764.1108	2764.1108	M	R	2	28
PSM	AEPPSPVHCVAAAAPTATVSEKEPFG	176	sp|Q6PCB5|RSBNL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=19005	73.288	3	2661.2745	2661.2745	M	K	2	28
PSM	AGVEEVAASGSHLNGDLDPDD	177	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=21226	80.862	2	2108.9134	2108.9134	M	R	2	23
PSM	AGVEEVAASGSHLNGDLDPDD	178	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=21357	81.344	2	2108.9134	2108.9134	M	R	2	23
PSM	ATDSGDPASTEDSEKPDGISFEN	179	sp|Q9BYP7-3|WNK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=16357	64.387	2	2409.9932	2409.9932	M	R	2	25
PSM	GSRNSSSAGSGSGDPSEGLP	180	sp|Q8TEB1-2|DCA11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=9433	39.084	2	1846.7929	1846.7929	M	R	2	22
PSM	KDPDSNPYSLLDTSEPEPPVDSEPGEPPPASA	181	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=21428	81.59	3	3333.5049	3333.5049	L	R	512	544
PSM	KILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQ	182	sp|Q9HCD5|NCOA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=20404	77.914	4	4193.0261	4193.0261	A	R	434	476
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	183	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=13825	55.349	3	2773.4246	2773.4246	G	K	61	94
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	184	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=25189	96.213	3	3503.6315	3503.6315	I	R	685	719
PSM	MDLQAAGAQAQGAAEPSRGPPLPSA	185	sp|Q9NQ92|COPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17496	68.287	2	2448.1703	2448.1703	-	R	1	26
PSM	MEATTAGVGRLEEEAL	186	sp|Q8WUD4|CCD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21317	81.193	2	1733.8142	1733.8142	-	R	1	17
PSM	MEFAAENEGKSGGGLHSVAEGV	187	sp|Q9NWK9-2|BCD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15485	61.285	2	2232.9957	2232.9957	-	R	1	23
PSM	MEVTGDAGVPESGEIRTL	188	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18969	73.156	2	1917.899	1917.8990	-	K	1	19
PSM	MLQQDSNDDTEDVSLFDAEEETTNRP	189	sp|Q96ET8-2|TV23C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23497	89.286	3	3056.2677	3056.2677	-	R	1	27
PSM	PTGDFDSKPSWADQVEEEGEDD	190	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=17570	68.522	2	2451.9826	2451.9826	M	K	2	24
PSM	SGEDEQQEQTIAEDLVVTKY	191	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=25341	96.804	3	2323.0703	2323.0703	M	K	2	22
PSM	SGLVLGQRDEPAGH	192	sp|Q9NSK0-2|KLC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1	ms_run[2]:scan=12166	49.181	2	1476.7321	1476.7321	M	R	2	16
PSM	SGNGNAAATAEENSPKM	193	sp|P08397-3|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=6879	28.833	2	1705.7213	1705.7213	M	R	2	19
PSM	SKGPAVGIDLGTTYSCVGVFQHG	194	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=23557	89.526	3	2391.1529	2391.1529	M	K	2	25
PSM	AAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHP	195	sp|Q96JN8|NEUL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:1	ms_run[1]:scan=14627	58.18024624346666	3	3455.5182	3455.4952	M	R	2	47
PSM	MKAQGETEESEKLS	196	sp|Q15648|MED1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=5651	23.90897049226667	2	1623.740476	1623.729782	-	K	1	15
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	197	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=20898	79.686	3	3231.2948	3231.2948	M	K	2	32
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	198	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=24950	95.205	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAMDVDTPSGTNSGAGK	199	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7212	30.242	2	1706.7417	1706.7417	M	K	2	20
PSM	AAAMDVDTPSGTNSGAGK	200	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=10795	44.308	2	1690.7468	1690.7468	M	K	2	20
PSM	AAAMDVDTPSGTNSGAGK	201	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=10914	44.756	2	1690.7468	1690.7468	M	K	2	20
PSM	AAGGSDPRAGDVEEDASQLIFP	202	sp|O15514|RPB4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=27646	106.25	2	2243.0342	2243.0342	M	K	2	24
PSM	AATASAGAGGIDGKP	203	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=9142	37.903	2	1284.631	1284.6310	M	R	2	17
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	204	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=12270	49.581	4	3428.6134	3428.6134	M	K	2	36
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	205	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=12302	49.707	3	3428.6134	3428.6134	M	K	2	36
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	206	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=23696	90.068	3	3263.375	3263.3750	M	K	2	33
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	207	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=22461	85.424	4	3477.5808	3477.5808	M	K	2	33
PSM	AFAETYPAASSLPNGDCGRP	208	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=20560	78.455	2	2121.9426	2121.9426	M	R	2	22
PSM	APIKVGDAIPAVEVFEGEPGN	209	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=24363	92.787	2	2108.079	2108.0790	M	K	2	23
PSM	ASAGGEDCESPAPEADRPHQ	210	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=7123	29.888	2	2121.8658	2121.8658	M	R	2	22
PSM	ASQSQGIQQLLQAEK	211	sp|O95670-2|VATG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=21417	81.547	2	1669.8635	1669.8635	M	R	2	17
PSM	ASSVGNVADSTGLAELAH	212	sp|O15294-3|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=22540	85.701	3	1739.8326	1739.8326	M	R	2	20
PSM	KDLYANTVLSGGTTMYPGIAD	213	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:35	ms_run[2]:scan=19299	74.293	2	2202.0514	2202.0515	R	R	291	312
PSM	KDLYANTVLSGGTTMYPGIAD	214	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:35	ms_run[2]:scan=19453	74.721	2	2202.0514	2202.0515	R	R	291	312
PSM	KDLYANTVLSGGTTMYPGIAD	215	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=21625	82.315	2	2186.0565	2186.0565	R	R	291	312
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	216	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=21176	80.668	3	3473.5868	3473.5868	T	-	609	647
PSM	MDEQAGPGVFFSNNHPGAGGA	217	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20242	77.374	3	2116.8909	2116.8909	-	K	1	22
PSM	MEDLDQSPLVSSSDSPPRPQPAF	218	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22542	85.709	3	2557.1642	2557.1642	-	K	1	24
PSM	MEDLDQSPLVSSSDSPPRPQPAF	219	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=26131	100.06	3	2541.1693	2541.1693	-	K	1	24
PSM	MELSDANLQTLTEYLK	220	sp|P55060-2|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30725	117.83	2	1925.9292	1925.9292	-	K	1	17
PSM	MQNDAGEFVDLYVPR	221	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25259	96.486	2	1810.8196	1810.8196	-	K	1	16
PSM	RSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPAT	222	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=14228	56.778	3	4169.8785	4169.8785	Q	K	10	54
PSM	SDAAVDTSSEITTKDL	223	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=17567	68.514	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	224	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=18011	69.921	2	1693.7894	1693.7894	M	K	2	18
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	225	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=19796	75.839	3	3008.4098	3008.4098	M	K	2	33
PSM	SEGNAAGEPSTPGGPRPLLTGA	226	sp|P05423|RPC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=15841	62.559	2	2077.0076	2077.0076	M	R	2	24
PSM	SGEDEQQEQTIAEDLVVTKY	227	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=25465	97.271	3	2323.0703	2323.0703	M	K	2	22
PSM	SSGNAKIGHPAPNF	228	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1	ms_run[2]:scan=9929	40.915	2	1437.7001	1437.7001	M	K	2	16
PSM	SVELEEALPVTTAEGMAK	229	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=22954	87.192	2	1931.9398	1931.9398	M	K	2	20
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	230	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	37	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=16861	66.183015552	3	3505.598311	3505.576600	T	-	609	647
PSM	AAAAVGAGHGAGGPGAASSSGGA	231	sp|Q96K37|S35E1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8647	35.99	3	1749.803	1749.8030	M	R	2	25
PSM	AAAMDVDTPSGTNSGAGK	232	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7107	29.813	2	1706.7417	1706.7417	M	K	2	20
PSM	AALGHLAGEAAAAPGPGTPCAS	233	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,20-UNIMOD:4	ms_run[2]:scan=19913	76.208	3	1987.9422	1987.9422	M	R	2	24
PSM	AATASAGAGGIDGKP	234	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=8892	36.969	2	1284.631	1284.6310	M	R	2	17
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	235	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=12159	49.155	3	3428.6134	3428.6134	M	K	2	36
PSM	ADEGKSYSEHDDE	236	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5299	22.441	2	1522.5696	1522.5696	M	R	2	15
PSM	AESSESFTMASSPAQR	237	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=10823	44.416	2	1742.7417	1742.7417	M	R	2	18
PSM	AFAETYPAASSLPNGDCGRP	238	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=20431	77.993	2	2121.9426	2121.9426	M	R	2	22
PSM	AKAAAIGIDLGTTYSCVGVFQHG	239	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=25974	99.389	3	2377.1736	2377.1736	M	K	2	25
PSM	ALDGPEQMELEEGKAGSGL	240	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=20374	77.821	2	1987.9045	1987.9045	M	R	2	21
PSM	ANDSGGPGGPSPSERD	241	sp|Q9GZT9-3|EGLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=5586	23.637	2	1540.639	1540.6390	M	R	2	18
PSM	ASQSQGIQQLLQAEK	242	sp|O95670-2|VATG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=21543	82.015	2	1669.8635	1669.8635	M	R	2	17
PSM	ASSGGELGSLFDHHVQ	243	sp|Q5RL73|RBM48_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=20359	77.77	2	1681.7696	1681.7696	M	R	2	18
PSM	ASSVGNVADSTEPTK	244	sp|O15294|OGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=9730	40.189	2	1503.7053	1503.7053	M	R	2	17
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	245	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=19208	73.975	3	3820.7439	3820.7439	M	K	2	36
PSM	DDDIAALVVDNGSGMC	246	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28855	110.88	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	247	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=30902	118.46	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	248	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31127	119.32	2	1692.6971	1692.6971	M	K	2	18
PSM	KAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMT	249	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:35,18-UNIMOD:35,37-UNIMOD:35	ms_run[2]:scan=24798	94.574	4	3807.9461	3807.9461	Y	R	108	146
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	250	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	24-UNIMOD:35	ms_run[2]:scan=21173	80.661	3	3534.5203	3534.5203	I	R	693	727
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	251	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=20785	79.255	3	3473.5868	3473.5868	T	-	609	647
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	252	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=20914	79.74	3	3473.5868	3473.5868	T	-	609	647
PSM	KPVPAAPVPSPVAPAPVPS	253	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13451	53.991	2	1777.0138	1777.0138	E	R	122	141
PSM	MDLQAAGAQAQGAAEPSRGPPLPSA	254	sp|Q9NQ92|COPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=21067	80.279	3	2432.1754	2432.1754	-	R	1	26
PSM	MDNSGKEAEAMALLAEAE	255	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=22104	84.07	2	1952.8343	1952.8343	-	R	1	19
PSM	MDNYADLSDTELTTLLR	256	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29293	112.46	2	2027.9358	2027.9358	-	R	1	18
PSM	MEDLDQSPLVSSSDSPPRPQPAF	257	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22823	86.717	2	2557.1642	2557.1642	-	K	1	24
PSM	MEDSEALGFEHMGLDP	258	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=23567	89.559	2	1834.739	1834.7390	-	R	1	17
PSM	MELSDANLQTLTEYLK	259	sp|P55060-2|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=32337	123.91	2	1909.9343	1909.9343	-	K	1	17
PSM	MEPTAPSLTEEDLTEVK	260	sp|O95999|BCL10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=22282	84.759	2	1930.9081	1930.9081	-	K	1	18
PSM	METDAPQPGLASPDSPHDPC	261	sp|O43347|MSI1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,20-UNIMOD:4	ms_run[2]:scan=15816	62.473	2	2162.8885	2162.8885	-	K	1	21
PSM	METEQPEETFPNTETNGEFGK	262	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16860	66.181	3	2472.0275	2472.0275	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	263	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17134	67.087	3	2472.0275	2472.0275	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	264	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17233	67.431	3	2472.0275	2472.0275	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	265	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=19655	75.357	3	2456.0326	2456.0326	-	R	1	22
PSM	MHSLATAAPVPTTLAQVDRE	266	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=20727	79.037	3	2149.0838	2149.0838	-	K	1	21
PSM	MNGTANPLLDREEHCL	267	sp|Q96JC9|EAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=16620	65.299	2	1926.8564	1926.8564	-	R	1	17
PSM	MQNDAGEFVDLYVPR	268	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25373	96.922	2	1810.8196	1810.8196	-	K	1	16
PSM	MTEADVNPKAYPLADAHLT	269	sp|P55769|NH2L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17918	69.628	2	2113.999	2113.9990	-	K	1	20
PSM	PGPTQTLSPNGENNNDIIQDNNGTIIPF	270	sp|Q15555-2|MARE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=26388	101.1	3	2979.421	2979.4210	M	R	2	30
PSM	PLENLEEEGLPKNPDL	271	sp|Q15008|PSMD6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=18643	72.033	2	1805.9047	1805.9047	M	R	2	18
PSM	RLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATIC	272	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	38-UNIMOD:4	ms_run[2]:scan=19188	73.904	3	3557.6791	3557.6791	P	R	509	547
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	273	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=16816	66.018	3	3089.3751	3089.3751	M	R	2	40
PSM	SETAPAAPAAAPPAEKAPV	274	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=12216	49.367	2	1786.9101	1786.9101	M	K	2	21
PSM	SGGGVIRGPAGNNDC	275	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=8493	35.39	2	1471.6474	1471.6474	M	R	2	17
PSM	SGGGVIRGPAGNNDC	276	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=8605	35.835	2	1471.6474	1471.6474	M	R	2	17
PSM	SGGGVIRGPAGNNDC	277	sp|Q07955-3|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=8724	36.301	2	1471.6474	1471.6474	M	R	2	17
PSM	SNGYEDHMAEDCRGDIG	278	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8530	35.549	2	1982.7371	1982.7371	M	R	2	19
PSM	SQKQEEENPAEETGEE	279	sp|O43768-8|ENSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=6952	29.159	2	1874.7654	1874.7654	M	K	2	18
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	280	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=12678	51.098	3	2984.3999	2984.3999	M	K	2	34
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	281	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=15416	61.047	3	2633.3085	2633.3085	M	R	2	27
PSM	TTNAGPLHPYWPQHL	282	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:1	ms_run[2]:scan=21346	81.303	2	1772.8635	1772.8635	M	R	2	17
PSM	VAPVLETSHVFCCPN	283	sp|Q6IA86-4|ELP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=16171	63.735	2	1728.7964	1728.7964	M	R	2	17
PSM	VGVKPVGSDPDFQPELSGAGS	284	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=15494	61.32	2	2041.9956	2041.9956	M	R	2	23
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	285	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	36	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=16603	65.25136632746667	3	3505.598311	3505.576600	T	-	609	647
PSM	AAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGA	286	sp|Q9NR33|DPOE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=15497	61.332	3	3173.4861	3173.4861	M	R	2	37
PSM	AAAAAATAAAAASIRE	287	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=22514	85.611	2	1427.7369	1427.7369	M	R	2	18
PSM	AAGGSDPRAGDVEEDASQLIFP	288	sp|O15514|RPB4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=27673	106.35	3	2243.0342	2243.0342	M	K	2	24
PSM	AAVAVAVREDSGSGM	289	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35	ms_run[2]:scan=16117	63.548	2	1476.6879	1476.6879	M	K	2	17
PSM	ADDLDFETGDAGASATFPMQCSALR	290	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=24243	92.315	2	2703.1429	2703.1429	M	K	2	27
PSM	ADFDTYDDRAYSSFGGG	291	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=21812	83.026	2	1884.7439	1884.7439	M	R	2	19
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	292	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=21828	83.085	3	3105.3912	3105.3912	M	R	2	37
PSM	AEASSANLGSGCEEK	293	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=7683	32.125	2	1550.6519	1550.6519	M	R	2	17
PSM	AFAETYPAASSLPNGDCGRP	294	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=20705	78.958	2	2121.9426	2121.9426	M	R	2	22
PSM	AFVATQGATVVDQTTLMK	295	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=22253	84.655	2	1937.9768	1937.9768	M	K	2	20
PSM	ASGVAVSDGVIKVFNDM	296	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=23882	90.794	2	1765.8557	1765.8557	M	K	2	19
PSM	ATTGTPTADRGDAAATDDPAA	297	sp|Q86TI2-4|DPP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9150	37.931	2	1986.8767	1986.8767	M	R	2	23
PSM	DDDIAALVVDNGSGMC	298	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28274	108.66	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	299	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30779	118.03	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	300	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31018	118.9	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	301	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31245	119.74	2	1692.6971	1692.6971	M	K	2	18
PSM	EEEIAALVIDNGSGMC	302	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32203	123.43	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	303	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32324	123.87	2	1764.7546	1764.7546	M	K	2	18
PSM	GSRNSSSAGSGSGDPSEGLP	304	sp|Q8TEB1-2|DCA11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9553	39.562	2	1846.7929	1846.7929	M	R	2	22
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	305	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	24-UNIMOD:35	ms_run[2]:scan=21306	81.151	3	3534.5203	3534.5203	I	R	693	727
PSM	KPLPPAPAPDEYLVSPITGE	306	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=20612	78.629	2	2090.0936	2090.0936	S	K	334	354
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	307	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=20452	78.079	3	2750.4201	2750.4201	N	R	143	170
PSM	KTITLEVEPSDTIENV	308	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=17917	69.624	2	1786.92	1786.9200	G	K	11	27
PSM	MAPAEILNGKEISAQI	309	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23442	89.08	2	1741.892	1741.8920	-	R	1	17
PSM	MDEPSPLAQPLELNQHS	310	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=23627	89.806	2	1946.9044	1946.9044	-	R	1	18
PSM	MDGEEKTYGGCEGPDAMYV	311	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=14522	57.802	2	2181.8177	2181.8177	-	K	1	20
PSM	MDLFGDLPEPERSP	312	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24869	94.881	2	1659.745	1659.7450	-	R	1	15
PSM	MEDSEALGFEHMGLDP	313	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=20488	78.197	2	1850.7339	1850.7339	-	R	1	17
PSM	METEQPEETFPNTETNGEFGK	314	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=19503	74.873	3	2456.0326	2456.0326	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	315	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=19794	75.835	3	2456.0326	2456.0326	-	R	1	22
PSM	PENVAPRSGATAGAAGG	316	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=4792	20.336	2	1481.7223	1481.7223	M	R	2	19
PSM	RLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATIC	317	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	38-UNIMOD:4	ms_run[2]:scan=19170	73.855	3	3557.6791	3557.6791	P	R	509	547
PSM	SASAPAAEGEGTPTQPASE	318	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=9713	40.126	2	1798.7857	1798.7857	M	K	2	21
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSNR	319	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=15654	61.897	3	2679.3253	2679.3253	M	R	2	31
PSM	SDAAVDTSSEITTKDL	320	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=17426	68.054	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	321	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=17718	68.98	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	322	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=17869	69.446	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	323	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=18157	70.406	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	324	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=18464	71.435	2	1693.7894	1693.7894	M	K	2	18
PSM	SESGHSQPGLYGIER	325	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=11260	45.982	2	1657.7696	1657.7696	M	R	2	17
PSM	SFDPNLLHNNGHNGYPNGTSAAL	326	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=20514	78.292	2	2451.1203	2451.1203	M	R	2	25
PSM	SGEENPASKPTPVQDVQGDG	327	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=10477	43.077	2	2052.9236	2052.9236	M	R	2	22
PSM	SKQQPTQFINPETPGYVGFANLPNQVH	328	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=23843	90.646	3	3052.5043	3052.5043	M	R	2	29
PSM	SLICSISNEVPEHPCVSPVSNHVYE	329	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1,4-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24547	93.531	3	2894.3215	2894.3215	M	R	2	27
PSM	SLYDDLGVETSDSKTEGWS	330	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=25193	96.228	2	2129.9277	2129.9277	M	K	2	21
PSM	SNPFAHLAEPLDPVQPGK	331	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:1	ms_run[2]:scan=23638	89.843	3	1957.9898	1957.9898	M	K	2	20
PSM	DDDIAALVVDNGSGMC	332	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=28971	111.3052286608	2	1708.6996	1708.6915	M	K	2	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	333	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=17100	66.96328468213333	3	3089.3952	3089.3742	M	R	2	40
PSM	PALQDLSQPEGLK	334	sp|Q99707|METH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35		ms_run[1]:scan=13429	53.912535314399996	2	1394.7492	1394.7400	S	K	3	16
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	335	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=18561	71.7540729072	4	4385.0792	4385.0522	M	K	2	52
PSM	MDNYADLSDTELTTLLR	336	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=29253	112.32199219493333	2	2028.953234	2027.935753	-	R	1	18
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	337	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=13584	54.495376998666664	5	6490.8022	6490.7622	M	K	2	71
PSM	AAAAAAAAEQQSSNGPVK	338	sp|Q16585|SGCB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=14033	56.02528465386667	2	1683.8372	1682.8222	M	K	2	20
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	339	sp|Q7Z7E8|UB2Q1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:1,40-UNIMOD:4	ms_run[1]:scan=21572	82.12102318853334	3	3799.778827	3799.754339	-	R	1	42
PSM	KLAADEDDDDDDEEDDDEDDDDDDFDDEEAEE	340	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=13808	55.2877129272	3	3723.218815	3722.195067	V	K	157	189
PSM	KEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGL	341	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=23454	89.13072057626667	3	3526.650290	3525.630469	S	K	344	378
PSM	AEPPSPVHCVAAAAPTATVSEKEPFG	342	sp|Q6PCB5|RSBNL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,9-UNIMOD:4	ms_run[1]:scan=18981	73.2076312672	3	2661.2912	2661.2742	M	K	2	28
PSM	AAAAVQGGRSGGSGGCSGAGGASNCGTGSG	343	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,16-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=7237	30.342	3	2524.0415	2524.0415	M	R	2	32
PSM	AADISESSGADCKGDP	344	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9511	39.4	2	1620.6573	1620.6573	M	R	2	18
PSM	AAPEEHDSPTEASQPIVEEEETKTF	345	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=17893	69.528	3	2812.2563	2812.2563	M	K	2	27
PSM	AATEDERLAGSGEGE	346	sp|P53609-2|PGTB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=9774	40.355	2	1532.6591	1532.6591	M	R	2	17
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEP	347	sp|Q9P2K5-4|MYEF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=14395	57.383	3	2750.2784	2750.2784	M	R	2	30
PSM	ADDLDFETGDAGASATFPMQCSALR	348	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=24094	91.689	3	2703.1429	2703.1429	M	K	2	27
PSM	AESSESFTMASSPAQR	349	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=13773	55.161	2	1726.7468	1726.7468	M	R	2	18
PSM	AETLPGSGDSGPGTASLGPGVAETGTR	350	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=18071	70.123	3	2483.1776	2483.1776	M	R	2	29
PSM	AGGGAGDPGLGAAAAPAPET	351	sp|Q13637|RAB32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=15050	59.713	2	1648.7693	1648.7693	M	R	2	22
PSM	AGPESDAQYQFTGIK	352	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13589	54.515	2	1610.7577	1610.7577	M	K	2	17
PSM	AKSGGCGAGAGVGGGNGALTWVNNAA	353	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=19389	74.578	3	2315.0713	2315.0713	M	K	2	28
PSM	ALDGPEQMELEEGKAGSGL	354	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=22577	85.846	2	1971.9095	1971.9095	M	R	2	21
PSM	APAEILNGKEISAQI	355	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17104	66.977	2	1552.8461	1552.8461	M	R	2	17
PSM	ASSGGELGSLFDHHVQ	356	sp|Q5RL73|RBM48_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=20350	77.74	2	1681.7696	1681.7696	M	R	2	18
PSM	DDDIAALVVDNGSGMC	357	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=27927	107.36	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	358	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28166	108.23	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	359	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=29517	113.33	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	360	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32447	124.29	2	1764.7546	1764.7546	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	361	sp|Q9BTY7|HGH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=16115	63.541	2	1910.8494	1910.8494	M	K	2	24
PSM	KGVVPLAGTDGETTTQGLDGLSE	362	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=18634	72.001	2	2244.1121	2244.1121	D	R	111	134
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	363	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	24-UNIMOD:35	ms_run[2]:scan=20798	79.296	3	3534.5203	3534.5203	I	R	693	727
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	364	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	24-UNIMOD:35	ms_run[2]:scan=21545	82.019	3	3534.5203	3534.5203	I	R	693	727
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	365	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=21043	80.201	3	3473.5868	3473.5868	T	-	609	647
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAENV	366	sp|Q12906-4|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=22214	84.505	3	2891.4917	2891.4917	A	K	489	519
PSM	KSYELPDGQVITIGNE	367	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=23215	88.196	2	1761.8785	1761.8785	E	R	938	954
PSM	KSYELPDGQVITIGNE	368	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=23457	89.142	2	1761.8785	1761.8785	E	R	938	954
PSM	MDEQAGPGVFFSNNHPGAGGA	369	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20105	76.895	2	2116.8909	2116.8909	-	K	1	22
PSM	MDEQAGPGVFFSNNHPGAGGA	370	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=23115	87.822	2	2100.896	2100.8960	-	K	1	22
PSM	MDLFGDLPEPERSP	371	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24981	95.338	2	1659.745	1659.7450	-	R	1	15
PSM	MEATLEQHLEDTM	372	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=23323	88.621	2	1604.6698	1604.6698	-	K	1	14
PSM	MEATTAGVGRLEEEAL	373	sp|Q8WUD4|CCD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=25190	96.216	2	1717.8193	1717.8193	-	R	1	17
PSM	MEDSEALGFEHMGLDP	374	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=20618	78.644	2	1850.7339	1850.7339	-	R	1	17
PSM	MEGLDDGPDFLSEEDRGL	375	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25565	97.673	2	2051.863	2051.8630	M	K	2	20
PSM	MELEDGVVYQEEPGGSGAVMSE	376	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=21426	81.581	2	2385.9828	2385.9828	-	R	1	23
PSM	MELLGEYVGQEGKPQ	377	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22358	85.043	2	1734.8135	1734.8135	-	K	1	16
PSM	MELLGEYVGQEGKPQ	378	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22494	85.537	2	1734.8135	1734.8135	-	K	1	16
PSM	MELSDANLQTLTEYLK	379	sp|P55060-2|XPO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30607	117.41	2	1925.9292	1925.9292	-	K	1	17
PSM	MQNDAGEFVDLYVPR	380	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=27840	107.01	2	1794.8247	1794.8247	-	K	1	16
PSM	PCSEETPAISPSK	381	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=6121	25.731	2	1401.6446	1401.6446	M	R	2	15
PSM	PCSEETPAISPSK	382	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4	ms_run[2]:scan=6237	26.196	2	1401.6446	1401.6446	M	R	2	15
PSM	PGPTQTLSPNGENNNDIIQDNNGTIIPFR	383	sp|Q15555-2|MARE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=22061	83.899	3	3135.5221	3135.5221	M	K	2	31
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	384	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,24-UNIMOD:35	ms_run[2]:scan=10948	44.888	3	2680.181	2680.1810	M	R	2	29
PSM	SDAAVDTSSEITTKDL	385	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=18324	70.975	2	1693.7894	1693.7894	M	K	2	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	386	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=16544	65.034	3	3089.3751	3089.3751	M	R	2	40
PSM	SETAPAAPAAAPPAEKAPV	387	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=12333	49.822	2	1786.9101	1786.9101	M	K	2	21
PSM	SGDGATEQAAEYVPEKV	388	sp|Q12996-3|CSTF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=16680	65.519	2	1791.8163	1791.8163	M	K	2	19
PSM	SNGYEDHMAEDCRGDIG	389	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=11494	46.752	2	1966.7422	1966.7422	M	R	2	19
PSM	SSSGLNSEKVAALIQ	390	sp|Q13867|BLMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:1	ms_run[2]:scan=20407	77.923	2	1544.8046	1544.8046	M	K	2	17
PSM	AADISESSGADCKGD	391	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=8121	33.87335694346667	2	1523.6142	1523.6042	M	P	2	17
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	392	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=16337	64.315397764	3	3505.598311	3505.576600	T	-	609	647
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	393	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	13-UNIMOD:35	ms_run[1]:scan=18518	71.61536373679999	3	3489.601718	3489.581685	T	-	609	647
PSM	PALQDLSQPEGLK	394	sp|Q99707|METH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34		ms_run[1]:scan=13423	53.893391759733326	2	1394.7492	1394.7400	S	K	3	16
PSM	ATVVVEATEPEPSGSIANPAASTSPSLSH	395	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=22284	84.76917702266665	3	2849.3992	2847.3772	M	R	2	31
PSM	MDLFGDLPEPERSP	396	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25090	95.81241800933334	2	1659.754497	1659.745039	-	R	1	15
PSM	ADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQ	397	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=21775	82.88963225786667	4	4972.3942	4972.3632	M	R	2	58
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	398	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=15165	60.1356070256	5	6475.7962	6474.7682	M	K	2	71
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	399	sp|Q7Z7E8|UB2Q1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:1,40-UNIMOD:4	ms_run[1]:scan=21550	82.03763632533334	4	3799.779401	3799.754339	-	R	1	42
PSM	AAAAECDVVMAATEPELLDDQEAK	400	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,6-UNIMOD:4,10-UNIMOD:35	ms_run[1]:scan=26456	101.38746089333334	2	2605.1762	2604.1562	M	R	2	26
PSM	MMHPVASSNPAFCGPGKPSCLNEDAM	401	sp|Q7Z6I8|CE024_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4,20-UNIMOD:4,26-UNIMOD:35	ms_run[1]:scan=15004	59.549177921066665	3	2879.206679	2878.185278	-	R	1	27
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	402	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1,31-UNIMOD:35	ms_run[1]:scan=16291	64.16016334133333	2	2681.1892	2680.1662	M	K	2	33
PSM	KSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQPPQQPNVSSA	403	sp|O75157|T22D2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=17304	67.6580588688	4	4907.463132	4907.428561	L	-	734	781
PSM	AAAAAATAAAAASIRE	404	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=22644	86.086	2	1427.7369	1427.7369	M	R	2	18
PSM	AAAAECDVVMAATEPELLDDQEAK	405	sp|Q99615|DNJC7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=28685	110.25	3	2588.1622	2588.1622	M	R	2	26
PSM	AAAVAAAGAGEPQSPDELLPKGDAE	406	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=22194	84.429	3	2376.1445	2376.1445	M	K	2	27
PSM	AAGAGTAGPASGPGVVRDPAASQP	407	sp|Q15554-4|TERF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9559	39.589	2	2061.0239	2061.0239	M	R	2	26
PSM	AAPAQQTTQPGGGK	408	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=4714	20.009	2	1352.6684	1352.6684	M	R	2	16
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGK	409	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,36-UNIMOD:35	ms_run[2]:scan=9515	39.414	3	3300.5065	3300.5065	M	R	2	41
PSM	ADDLDFETGDAGASATFPMQCSALR	410	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,21-UNIMOD:4	ms_run[2]:scan=26666	102.28	3	2687.1479	2687.1479	M	K	2	27
PSM	ADLDSPPKLSGVQQPSEGVGGG	411	sp|Q9H9E3-2|COG4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=17769	69.13	2	2136.0335	2136.0335	M	R	2	24
PSM	ADLEEQLSDEEKV	412	sp|P47755-2|CAZA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=21499	81.859	2	1545.7046	1545.7046	M	R	2	15
PSM	AELGLNEHHQNEVINYM	413	sp|Q9NQ48|LZTL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=16452	64.733	3	2067.932	2067.9320	M	R	2	19
PSM	AFAETYPAASSLPNGDCGRP	414	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=20426	77.981	3	2121.9426	2121.9426	M	R	2	22
PSM	AGPESDAQYQFTGIK	415	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13730	55.008	2	1610.7577	1610.7577	M	K	2	17
PSM	AHAGGGSGGSGAGGPAG	416	sp|O75182-2|SIN3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=4122	17.477	2	1265.5385	1265.5385	M	R	2	19
PSM	AKVEQVLSLEPQHEL	417	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=21647	82.394	2	1760.9309	1760.9309	M	K	2	17
PSM	ALFPAFAGLSEAPDGGSSR	418	sp|Q9H7Z3|NRDE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=31268	119.84	2	1890.9112	1890.9112	M	K	2	21
PSM	ANDSGGPGGPSPSE	419	sp|Q9GZT9-3|EGLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=6553	27.516	2	1269.5109	1269.5109	M	R	2	16
PSM	ASASSGPSSSVGFSSFDPAVPSCTLSSAASGIK	420	sp|Q99755-4|PI51A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,23-UNIMOD:4	ms_run[2]:scan=25707	98.276	3	3144.4557	3144.4557	M	R	2	35
PSM	ATAVETEACQPTDASWESGGGGDDEM	421	sp|Q9UK61-3|TASOR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,9-UNIMOD:4,26-UNIMOD:35	ms_run[2]:scan=19972	76.42	2	2728.0388	2728.0389	M	K	2	28
PSM	ATGANATPLDFPSK	422	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16408	64.579	2	1430.7042	1430.7042	M	K	2	16
PSM	ATGANATPLDFPSK	423	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16541	65.028	2	1430.7042	1430.7042	M	K	2	16
PSM	ATGANATPLDFPSK	424	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16668	65.481	2	1430.7042	1430.7042	M	K	2	16
PSM	ATQADLMELDMAMEPDR	425	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=21242	80.917	2	2009.838	2009.8380	M	K	2	19
PSM	DDDIAALVVDNGSGMC	426	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=26681	102.34	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	427	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28049	107.8	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	428	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28386	109.1	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	429	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28503	109.58	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	430	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28735	110.43	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	431	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30087	115.47	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	432	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30659	117.6	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	433	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=29975	115.05	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	434	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=29000	111.41	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	435	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31360	120.18	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	436	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31474	120.62	2	1692.6971	1692.6971	M	K	2	18
PSM	EEEIAALVIDNGSGMC	437	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31229	119.69	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	438	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32437	124.26	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	439	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32574	124.71	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	440	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=33223	126.82	2	1748.7597	1748.7597	M	K	2	18
PSM	GDMANNSVAYSGVKNSL	441	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=14763	58.684	2	1783.8047	1783.8047	M	K	2	19
PSM	GDMANNSVAYSGVKNSL	442	sp|P20020-5|AT2B1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=17546	68.455	2	1767.8098	1767.8098	M	K	2	19
PSM	GTAAAAAAAAAAAAAGEGA	443	sp|Q7RTP0|NIPA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=26532	101.71	2	1455.6954	1455.6954	M	R	2	21
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	444	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=14200	56.659	3	2730.3833	2730.3833	K	R	123	152
PSM	KEAPAEGEAAEPGSPTAAEGEAASAASSTSSP	445	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12282	49.63	3	2914.2952	2914.2952	E	K	105	137
PSM	KIGNPVPYNEGLGQPQVAPPAPAASPAASS	446	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16182	63.776	3	2884.4719	2884.4719	V	R	111	141
PSM	KPAEAPTAPSPAQTLENSEPAPVSQLQS	447	sp|Q9UHD8-3|SEPT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17302	67.65	3	2844.4141	2844.4141	P	R	30	58
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAENV	448	sp|Q12906-4|ILF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22094	84.032	3	2891.4917	2891.4917	A	K	489	519
PSM	KPVPAAPVPSPVAPAPVPS	449	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13572	54.444	2	1777.0138	1777.0138	E	R	122	141
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	450	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:35	ms_run[2]:scan=18038	70.011	3	2766.415	2766.4150	N	R	143	170
PSM	MDDDIAALVVDNGSGMC	451	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35,16-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=27263	104.7	2	1855.7274	1855.7274	-	K	1	18
PSM	MDEPSPLAQPLELNQHS	452	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20719	79.007	2	1962.8993	1962.8993	-	R	1	18
PSM	MDEPSPLAQPLELNQHS	453	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20848	79.492	2	1962.8993	1962.8993	-	R	1	18
PSM	MDLAAAAEPGAGSQHLEV	454	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19165	73.842	2	1823.836	1823.8360	-	R	1	19
PSM	MDLAAAAEPGAGSQHLEV	455	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19308	74.319	2	1823.836	1823.8360	-	R	1	19
PSM	MDLAAAAEPGAGSQHLEV	456	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=23593	89.669	2	1807.8411	1807.8411	-	R	1	19
PSM	MDLFGDLPEPERSP	457	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=29350	112.69	2	1643.7501	1643.7501	-	R	1	15
PSM	MDTESTYSGYSYYSSHS	458	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15547	61.515	2	2021.7473	2021.7473	-	K	1	18
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	459	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16812	66.003	2	2498.0966	2498.0966	-	R	1	28
PSM	MEDSQDLNEQSVK	460	sp|O95677-3|EYA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8088	33.727	2	1579.6672	1579.6672	-	K	1	14
PSM	MEEVPHDCPGADSAQAG	461	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=12951	52.1	2	1811.7091	1811.7091	-	R	1	18
PSM	MEGPLSVFGDRSTGETI	462	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26012	99.552	2	1852.8513	1852.8513	-	R	1	18
PSM	MEGSEPVAAHQGEEASCSSWGTGSTN	463	sp|A0AVT1-4|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=12874	51.799	3	2723.0712	2723.0712	-	K	1	27
PSM	MEGSGEQPGPQPQHPGDH	464	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=7598	31.782	2	1925.7962	1925.7962	-	R	1	19
PSM	METEQPEETFPNTETNGEFGK	465	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17280	67.578	3	2472.0275	2472.0275	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	466	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=19955	76.362	2	2456.0326	2456.0326	-	R	1	22
PSM	MFQAAGAAQATPSHDA	467	sp|Q9BT23|LIMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10928	44.804	2	1630.7046	1630.7046	-	K	1	17
PSM	MFQAAGAAQATPSHDA	468	sp|Q9BT23|LIMD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11048	45.25	2	1630.7046	1630.7046	-	K	1	17
PSM	MHGGGPPSGDSACPL	469	sp|P24928-2|RPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=9681	40.04	2	1496.6024	1496.6024	-	R	1	16
PSM	MNYMPGTASLIEDIDK	470	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=23453	89.125	2	1870.8329	1870.8329	-	K	1	17
PSM	MRNSEEQPSGGTTVLQ	471	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9124	37.829	2	1790.8105	1790.8105	-	R	1	17
PSM	MVEKEEAGGGISEEEAAQYD	472	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14473	57.634	2	2198.9161	2198.9161	-	R	1	21
PSM	PEMPEDMEQEEVNIPNR	473	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=10571	43.416	2	2087.8776	2087.8776	M	R	2	19
PSM	PGFTCCVPGCYNNSH	474	sp|Q96EK4|THA11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=12348	49.874	2	1768.6756	1768.6756	M	R	2	17
PSM	PTGDFDSKPSWADQVEEEGEDD	475	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17950	69.721	2	2451.9826	2451.9826	M	K	2	24
PSM	RAAAPGTLEPDAAAATPAAPSPASLPLAPGCAL	476	sp|Q8N5W9|RFLB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	31-UNIMOD:4	ms_run[2]:scan=22799	86.625	3	3052.5652	3052.5652	E	R	51	84
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	477	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=20996	80.034	3	3845.8847	3845.8847	E	R	354	390
PSM	RSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPAT	478	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=14143	56.447	3	4169.8785	4169.8785	Q	K	10	54
PSM	SDAAVDTSSEITTKDL	479	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16723	65.686	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	480	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16994	66.606	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	481	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=18607	71.905	2	1693.7894	1693.7894	M	K	2	18
PSM	SDEFSLADALPEHSPA	482	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=24742	94.352	2	1726.7686	1726.7686	M	K	2	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	483	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=16679	65.516	3	3089.3751	3089.3751	M	R	2	40
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	484	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=19892	76.124	4	3008.4098	3008.4098	M	K	2	33
PSM	SETAPAAPAAPAPAE	485	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8329	34.727	2	1349.6463	1349.6463	M	K	2	17
PSM	SETAPAAPAAPAPAE	486	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8447	35.198	2	1349.6463	1349.6463	M	K	2	17
PSM	SETAPAAPAAPAPAEKTPV	487	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=12135	49.062	2	1816.9207	1816.9207	M	K	2	21
PSM	SFGSEHYLCSSSSYR	488	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=14491	57.699	2	1807.7472	1807.7472	M	K	2	17
PSM	SGGGPSGGGPGGSGRA	489	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=4309	18.339	2	1255.5541	1255.5541	M	R	2	18
PSM	SNNGLDIQDKPPAPPM	490	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=14713	58.519	2	1750.8196	1750.8196	M	R	2	18
PSM	SQGDSNPAAIPHAAEDIQGDD	491	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12524	50.496	2	2106.909	2106.9090	M	R	2	23
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	492	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=12812	51.572	3	2984.3999	2984.3999	M	K	2	34
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGD	493	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=18696	72.218	3	4385.0531	4385.0531	M	K	2	52
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	494	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=15239	60.419	3	2633.3085	2633.3085	M	R	2	27
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	495	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=15264	60.513	3	2633.3085	2633.3085	M	R	2	27
PSM	STATTVAPAGIPATPGPVNPPPPEVSNPSKPG	496	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=18860	72.79	3	3046.5611	3046.5611	M	R	2	34
PSM	SVELEEALPVTTAEGMAK	497	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=22822	86.712	2	1931.9398	1931.9398	M	K	2	20
PSM	SVELEEALPVTTAEGMAK	498	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=25492	97.377	2	1915.9449	1915.9449	M	K	2	20
PSM	SYGRPPPDVEGMTSL	499	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=20582	78.536	2	1646.761	1646.7610	M	K	2	17
PSM	TTNAGPLHPYWPQHL	500	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:1	ms_run[2]:scan=21216	80.822	2	1772.8635	1772.8635	M	R	2	17
PSM	DDDIAALVVDNGSGMC	501	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29636	113.76577339653333	2	1709.6972	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	502	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=28987	111.3601617576	2	1709.6892	1708.6912	M	K	2	18
PSM	EEEIAALVIDNGSGMC	503	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32698	125.1364225208	2	1764.7617	1764.7541	M	K	2	18
PSM	EEEIAALVIDNGSGMC	504	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32606	124.8227144088	2	1764.7617	1764.7541	M	K	2	18
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	505	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=26701	102.42929493706667	3	3264.3812	3263.3742	M	K	2	33
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGGR	506	sp|Q16644|MAPK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17834	69.32875086	3	2869.341576	2868.334837	-	R	1	32
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQDPAP	507	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=20071	76.77911385093333	3	3008.4272	3008.4092	M	K	2	33
PSM	ADDLDFETGDAGASATFPMQCSALR	508	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=24250	92.34335978293333	3	2703.1592	2703.1422	M	K	2	27
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	509	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=15311	60.68336350293334	5	6475.7962	6474.7682	M	K	2	71
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	510	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=15187	60.230535549866666	5	6475.7962	6474.7682	M	K	2	71
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	511	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14048	56.0850884416	5	6491.7882	6490.7622	M	K	2	71
PSM	AAAAAAAGDSDSWDADAFSVEDPVR	512	sp|O75822|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=25916	99.1556810672	3	2506.1042	2506.0882	M	K	2	27
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	513	sp|Q7Z7E8|UB2Q1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:1,1-UNIMOD:35,40-UNIMOD:4	ms_run[1]:scan=19633	75.28314752213333	4	3815.769510	3815.749254	-	R	1	42
PSM	AEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEE	514	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,17-UNIMOD:4	ms_run[1]:scan=23989	91.2360759736	4	4122.8792	4122.8492	M	R	2	39
PSM	AEAMDLGKDPNGPTHSSTLFV	515	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=21814	83.03587910666667	2	2229.0562	2228.0412	M	R	2	23
PSM	SLFGTTSGFGTSGTSMFGSATTDNHNPM	516	sp|P78406|RAE1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,16-UNIMOD:35,28-UNIMOD:35	ms_run[1]:scan=25117	95.92575442373332	3	2884.2152	2883.1962	M	K	2	30
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	517	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	33	13-UNIMOD:35	ms_run[1]:scan=18229	70.67534739253333	3	3489.601718	3489.581685	T	-	609	647
PSM	AAAAGGGGPGTAVGATGSGIAAAAAGLAVYR	518	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=27165	104.3	3	2555.3092	2555.3092	M	R	2	33
PSM	AAAYLDPNLNHTPNSST	519	sp|Q05397-7|FAK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=19015	73.324	2	1826.8435	1826.8435	M	K	2	19
PSM	AADISESSGADCKGDP	520	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9389	38.921	2	1620.6573	1620.6573	M	R	2	18
PSM	AAGPISERNQDATVYVGGLDE	521	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=20266	77.455	3	2203.0393	2203.0393	M	K	2	23
PSM	AATASAGAGGIDGKP	522	sp|Q02978-2|M2OM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=9017	37.433	2	1284.631	1284.6310	M	R	2	17
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	523	sp|P49354-2|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=12146	49.103	4	3428.6134	3428.6134	M	K	2	36
PSM	ADDAGAAGGPGGPGGPGMGN	524	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=8648	35.995	2	1639.6533	1639.6533	M	R	2	22
PSM	ADTQYILPNDIGVSSLDC	525	sp|Q9NY33-2|DPP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,18-UNIMOD:4	ms_run[2]:scan=30121	115.6	2	2021.9252	2021.9252	M	R	2	20
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	526	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=24824	94.695	3	3263.375	3263.3750	M	K	2	33
PSM	AESSESFTMASSPAQR	527	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=10709	43.956	2	1742.7417	1742.7417	M	R	2	18
PSM	AGSGAGVRCSLL	528	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=14888	59.126	2	1188.5921	1188.5921	M	R	2	14
PSM	AGSYPEGAPAILADK	529	sp|Q6P1Q9|MET2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=18613	71.936	2	1500.746	1500.7460	M	R	2	17
PSM	AGSYPEGAPAILADK	530	sp|Q6P1Q9|MET2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=18748	72.403	2	1500.746	1500.7460	M	R	2	17
PSM	AGSYPEGAPAVLADK	531	sp|Q96IZ6|MET2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=16410	64.584	2	1486.7304	1486.7304	M	R	2	17
PSM	AGYEYVSPEQLAGFDKY	532	sp|Q9C0D9|EPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=27248	104.63	2	1977.8996	1977.8996	M	K	2	19
PSM	AKSGGCGAGAGVGGGNGALTWVNNAA	533	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=19354	74.471	3	2315.0713	2315.0713	M	K	2	28
PSM	ALDGPEQMELEEGKAGSGL	534	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=20232	77.341	2	1987.9045	1987.9045	M	R	2	21
PSM	ALDGPEQMELEEGKAGSGL	535	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=22582	85.864	2	1971.9095	1971.9095	M	R	2	21
PSM	ANSANTNTVPKLY	536	sp|P52655|TF2AA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=15153	60.101	2	1433.7151	1433.7151	M	R	2	15
PSM	ANSANTNTVPKLY	537	sp|P52655|TF2AA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=15280	60.572	2	1433.7151	1433.7151	M	R	2	15
PSM	ANSTAVVKIPGTPGAGG	538	sp|Q16514-2|TAF12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=16524	64.968	2	1537.81	1537.8100	M	R	2	19
PSM	ASGGSGGVSVPALWSEVN	539	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=29255	112.33	2	1714.8162	1714.8162	M	R	2	20
PSM	ASGVAVSDGVIKVFNDM	540	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=24837	94.756	2	1765.8557	1765.8557	M	K	2	19
PSM	ASSLNEDPEGSRITYV	541	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=18261	70.771	2	1778.8323	1778.8323	M	K	2	18
PSM	ATKCGNCGPGYSTPLEAM	542	sp|Q13228-3|SBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,4-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:35	ms_run[2]:scan=12756	51.371	2	1970.8172	1970.8172	M	K	2	20
PSM	ATQADLMELDMAMEPDR	543	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,7-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=24986	95.355	2	2009.838	2009.8380	M	K	2	19
PSM	ATQADLMELDMAMEPDR	544	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=26557	101.83	2	1993.8431	1993.8431	M	K	2	19
PSM	ATTATMATSGSAR	545	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=7323	30.69	2	1266.5874	1266.5874	M	K	2	15
PSM	DDDIAALVVDNGSGMC	546	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=26579	101.92	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	547	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=27068	103.94	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	548	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=27818	106.92	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	549	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=28619	110	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	550	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30430	116.76	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	551	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30545	117.18	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	552	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30897	118.45	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	553	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31108	119.25	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	554	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=33099	126.41	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	555	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=33231	126.84	2	1764.7546	1764.7546	M	K	2	18
PSM	EEEIAALVIDNGSGMC	556	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=33347	127.24	2	1748.7597	1748.7597	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	557	sp|Q9BTY7|HGH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11863	48.063	2	1868.8388	1868.8388	M	K	2	24
PSM	KAFLADPSAFVAAAPVAAATTAAPAAAAAPA	558	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=25222	96.348	3	2751.4596	2751.4596	V	K	204	235
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	559	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=24415	92.991	3	3518.5254	3518.5254	I	R	693	727
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	560	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=24538	93.497	3	3518.5254	3518.5254	I	R	693	727
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	561	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=20775	79.206	3	3473.5868	3473.5868	T	-	609	647
PSM	KSYELPDGQVITIGNE	562	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=23339	88.693	2	1761.8785	1761.8785	E	R	938	954
PSM	MEATLEQHLEDTM	563	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17176	67.23	2	1620.6647	1620.6647	-	K	1	14
PSM	MEATLEQHLEDTM	564	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=23448	89.107	2	1604.6698	1604.6698	-	K	1	14
PSM	MEEEQDLPEQPVK	565	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11876	48.117	2	1628.724	1628.7240	-	K	1	14
PSM	MNNHVSSKPSTM	566	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=3912	16.507	2	1405.5966	1405.5966	-	K	1	13
PSM	MNPIVVVHGGGAGPISKD	567	sp|Q7L266|ASGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14169	56.546	2	1804.9142	1804.9142	-	R	1	19
PSM	MRNSEEQPSGGTTVLQ	568	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=11810	47.838	2	1774.8156	1774.8156	-	R	1	17
PSM	MSPALQDLSQPEGLK	569	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18744	72.387	2	1670.8185	1670.8185	-	K	1	16
PSM	PEFLEDPSVLTKD	570	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=18620	71.953	2	1488.7348	1488.7348	M	K	2	15
PSM	PGIDKLPIEETLEDSPQT	571	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=21000	80.046	2	1980.9892	1980.9892	M	R	2	20
PSM	PGIDKLPIEETLEDSPQT	572	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=21130	80.507	2	1980.9892	1980.9892	M	R	2	20
PSM	PGPATDAGKIPFCDA	573	sp|Q86SK9-2|SCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:4	ms_run[2]:scan=14061	56.133	2	1515.7028	1515.7028	M	K	2	17
PSM	RAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQ	574	sp|Q7Z7K6-3|CENPV_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=25536	97.554	4	4345.1754	4345.1754	P	R	69	112
PSM	RIPSAVGYQPTLATDMGTMQE	575	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	16-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=14026	55.995	3	2297.0668	2297.0668	G	R	324	345
PSM	RTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAEN	576	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=22790	86.588	4	3928.8967	3928.8967	G	K	365	404
PSM	SAIQNLHSFDPFADAS	577	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=28646	110.1	2	1760.8006	1760.8006	M	K	2	18
PSM	SAPSATPIFAPGENCSPAWGAAPAAYDAADTHL	578	sp|Q14353|GAMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,15-UNIMOD:4	ms_run[2]:scan=27948	107.43	3	3325.4986	3325.4986	M	R	2	35
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	579	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=14256	56.885	3	2664.1861	2664.1861	M	R	2	29
PSM	SCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAEN	580	sp|Q12962|TAF10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=20157	77.074	3	3587.6322	3587.6322	M	K	2	42
PSM	SETAPAAPAAPAPAE	581	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=8463	35.262	2	1391.6569	1391.6569	M	K	2	17
PSM	SGLVLGQRDEPAGH	582	sp|Q9NSK0-2|KLC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=12293	49.673	2	1476.7321	1476.7321	M	R	2	16
PSM	SLQVLNDKNVSNE	583	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=15982	63.069	2	1500.742	1500.7420	M	K	2	15
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	584	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=12558	50.62	3	2984.3999	2984.3999	M	K	2	34
PSM	SSAAEPPPPPPPESAPSKPAASIASGGSNSSN	585	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=12687	51.129	2	2984.3999	2984.3999	M	K	2	34
PSM	SSSAGSGHQPSQS	586	sp|Q13542|4EBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=3777	15.861	2	1257.5222	1257.5222	M	R	2	15
PSM	TEWETAAPAVAETPDIKLFG	587	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:1	ms_run[2]:scan=30368	116.53	2	2187.0736	2187.0736	M	K	2	22
PSM	VGVKPVGSDPDFQPELSGAGS	588	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15623	61.795	2	2041.9956	2041.9956	M	R	2	23
PSM	DDDIAALVVDNGSGMC	589	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29292	112.46271449946667	2	1709.6892	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	590	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27393	105.215137572	2	1708.7003	1708.6915	M	K	2	18
PSM	DDDIAALVVDNGSGMC	591	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29870	114.62580458693333	2	1709.6972	1708.6912	M	K	2	18
PSM	EEEIAALVIDNGSGMC	592	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32818	125.52579270666666	2	1765.7532	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	593	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32809	125.4928763512	2	1765.7532	1764.7542	M	K	2	18
PSM	AEQEPTAEQLAQIAAENEEDEHSVNY	594	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=25281	96.57790182773333	3	2956.3022	2956.2842	M	K	2	28
PSM	PTGDFDSKPSWADQVEEEGEDD	595	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32		ms_run[1]:scan=17977	69.81849109093334	2	2453.0002	2451.9822	M	K	2	24
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	596	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=18497	71.5441706048	4	5340.4582	5340.4222	M	R	2	70
PSM	APAQQTTQPGGGK	597	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	32		ms_run[1]:scan=4740	20.123368129066666	2	1239.6291	1239.6202	A	R	3	16
PSM	MKETIMNQEKLA	598	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7886	32.874612022933334	2	1508.730979	1508.721467	-	K	1	13
PSM	AAAAAATAAAAASIRE	599	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=22486	85.509	2	1427.7369	1427.7369	M	R	2	18
PSM	AAAVAAAGAGEPQSPDELLPKGDAE	600	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=22315	84.89	3	2376.1445	2376.1445	M	K	2	27
PSM	AALGHLAGEAAAAPGPGTPCAS	601	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,20-UNIMOD:4	ms_run[2]:scan=19764	75.725	3	1987.9422	1987.9422	M	R	2	24
PSM	AAQIPIVATTSTPGIVRNS	602	sp|Q6PI98|IN80C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=22064	83.912	2	1937.0582	1937.0582	M	K	2	21
PSM	AAVPELLQQQEEDRS	603	sp|Q9Y5X3-2|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=21922	83.386	2	1753.8483	1753.8483	M	K	2	17
PSM	AEPDYIEDDNPELIRPQ	604	sp|Q9H098|F107B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=21582	82.158	2	2054.9433	2054.9433	M	K	2	19
PSM	AEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEE	605	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=23967	91.145	4	4122.8501	4122.8501	M	R	2	39
PSM	AEQSDEAVKYYTLEEIQ	606	sp|P00167-2|CYB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=23368	88.813	3	2056.9477	2056.9477	M	K	2	19
PSM	AESSESFTMASSPAQ	607	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=13253	53.26	2	1586.6406	1586.6406	M	R	2	17
PSM	AESSESFTMASSPAQ	608	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=17034	66.744	2	1570.6457	1570.6457	M	R	2	17
PSM	AGAGPAPGLPGAGGPVVPGPGAGIPGKSGEE	609	sp|Q9BTD8-4|RBM42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=20869	79.574	3	2619.3293	2619.3293	M	R	2	33
PSM	AGQDPALSTSHPFYDVA	610	sp|P85298-2|RHG08_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=21610	82.26	2	1816.8268	1816.8268	M	R	2	19
PSM	AKVEQVLSLEPQHEL	611	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=21764	82.854	2	1760.9309	1760.9309	M	K	2	17
PSM	ALDGPEQMELEEGKAGSGL	612	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=20094	76.859	2	1987.9045	1987.9045	M	R	2	21
PSM	ALTSFLPAPTQLSQDQLEAEEKA	613	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=30042	115.3	3	2528.2646	2528.2646	M	R	2	25
PSM	ANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGATKPAVSG	614	sp|Q5VTL8-2|PR38B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,28-UNIMOD:4	ms_run[2]:scan=11719	47.498	4	3870.8052	3870.8052	M	K	2	42
PSM	ASASSGPSSSVGFSSFDPAVPSCTLSSAASGIK	615	sp|Q99755-4|PI51A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,23-UNIMOD:4	ms_run[2]:scan=25713	98.3	3	3144.4557	3144.4557	M	R	2	35
PSM	ATEGMILTNHDHQI	616	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=13481	54.108	2	1636.7515	1636.7515	M	R	2	16
PSM	ATEGMILTNHDHQI	617	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=13604	54.572	2	1636.7515	1636.7515	M	R	2	16
PSM	EEEIAALVIDNGSGMC	618	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31098	119.21	2	1764.7546	1764.7546	M	K	2	18
PSM	GTTAPGPIHLLELCDQ	619	sp|Q9NQS7-2|INCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=26299	100.71	2	1762.856	1762.8560	M	K	2	18
PSM	KDGAVNGPSVVGDQTPIEPQTSIE	620	sp|P49321-4|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15444	61.141	3	2437.1973	2437.1973	P	R	312	336
PSM	KELASQPDVDGFLVGGASL	621	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=23157	87.971	2	1901.9735	1901.9735	C	K	256	275
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	622	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14102	56.285	3	2773.4246	2773.4246	G	K	61	94
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	623	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	24-UNIMOD:35	ms_run[2]:scan=20905	79.709	3	3534.5203	3534.5203	I	R	693	727
PSM	KTVTNAVVTVPAYFNDSQ	624	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17870	69.448	2	1952.9844	1952.9844	G	R	137	155
PSM	MAPSVPAAEPEYPKGI	625	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18027	69.965	2	1713.8284	1713.8284	-	R	1	17
PSM	MDEQALLGLNPNADSDF	626	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29635	113.76	2	1906.8255	1906.8255	-	R	1	18
PSM	MDSGGGSLGLHTPDS	627	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13099	52.675	2	1487.6198	1487.6198	-	R	1	16
PSM	MDVGELLSYQPNRGT	628	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22842	86.787	2	1736.8039	1736.8040	-	K	1	16
PSM	MEATLEQHLEDTM	629	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17049	66.783	2	1620.6647	1620.6647	-	K	1	14
PSM	MEATLEQHLEDTM	630	sp|O43504|LTOR5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22753	86.454	2	1604.6698	1604.6698	-	K	1	14
PSM	MEDSEALGFEHMGLDP	631	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=23559	89.534	2	1834.739	1834.7390	-	R	1	17
PSM	MEDSQDLNEQSVK	632	sp|O95677-3|EYA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8099	33.776	2	1579.6672	1579.6672	-	K	1	14
PSM	MEGHDPKEPEQL	633	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=10642	43.705	2	1450.6398	1450.6398	-	R	1	13
PSM	MEGLDDGPDFLSEEDRGL	634	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=28827	110.78	2	2035.8681	2035.8681	M	K	2	20
PSM	MELLGEYVGQEGKPQ	635	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=28742	110.45	2	1718.8185	1718.8185	-	K	1	16
PSM	METEQPEETFPNTETNGEFGK	636	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17002	66.631	3	2472.0275	2472.0275	-	R	1	22
PSM	METGTAPLVAPPR	637	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12907	51.93	2	1396.7021	1396.7021	-	R	1	14
PSM	MHTGGETSACKPSSV	638	sp|Q13627-4|DYR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=5063	21.43	2	1605.6763	1605.6763	-	R	1	16
PSM	MLGTEGGEGFVVKV	639	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22274	84.733	2	1479.7279	1479.7279	M	R	2	16
PSM	MNGTLDHPDQPDLDAI	640	sp|Q92879-2|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19400	74.601	2	1808.7887	1808.7887	-	K	1	17
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	641	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=17101	66.966	3	2838.196	2838.1960	-	K	1	25
PSM	MRNSEEQPSGGTTVLQ	642	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8993	37.356	2	1790.8105	1790.8105	-	R	1	17
PSM	MRNSEEQPSGGTTVLQ	643	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=11689	47.398	2	1774.8156	1774.8156	-	R	1	17
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	644	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14755	58.658	3	2832.4182	2832.4182	M	K	2	30
PSM	PAIMTMLADHAA	645	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=8999	37.372	2	1272.5842	1272.5842	M	R	2	14
PSM	PENVAPRSGATAGAAGG	646	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4807	20.397	2	1481.7223	1481.7223	M	R	2	19
PSM	PGGLLLGDVAPNFEANTTVG	647	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=26590	101.96	2	1940.9844	1940.9844	M	R	2	22
PSM	PYQYPALTPEQK	648	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11512	46.806	2	1433.7191	1433.7191	M	K	2	14
PSM	RLDVTLGPVPEIGGSEAPAPQN	649	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=20563	78.464	3	2216.1437	2216.1437	E	K	69	91
PSM	SAEVETSEGVDESEK	650	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=9151	37.935	2	1636.6952	1636.6952	M	K	2	17
PSM	SAEVETSEGVDESEK	651	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=9262	38.387	2	1636.6952	1636.6952	M	K	2	17
PSM	SDAAVDTSSEITTKDL	652	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=13399	53.799	2	1693.7894	1693.7894	M	K	2	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	653	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=16959	66.483	3	3089.3751	3089.3751	M	R	2	40
PSM	SEGNAAGEPSTPGGPRPLLTGA	654	sp|P05423|RPC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=15711	62.085	3	2077.0076	2077.0076	M	R	2	24
PSM	SESGHSQPGLYGIER	655	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=11402	46.435	2	1657.7696	1657.7696	M	R	2	17
PSM	SETAPAAPAAAPPAE	656	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8109	33.82	2	1349.6463	1349.6463	M	K	2	17
PSM	SETAPAAPAAPAPAEKTPV	657	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=12258	49.53	2	1816.9207	1816.9207	M	K	2	21
PSM	SFDPNLLHNNGHNGYPNGTSAAL	658	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=20655	78.785	2	2451.1203	2451.1203	M	R	2	25
PSM	SGELPPNINIKEP	659	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=19623	75.249	2	1448.7511	1448.7511	M	R	2	15
PSM	SGNGNAAATAEENSPKM	660	sp|P08397-3|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=6758	28.362	2	1705.7213	1705.7213	M	R	2	19
PSM	SGQSLTDRITAAQHSVTGSAVS	661	sp|Q13492-3|PICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=19905	76.175	3	2214.0877	2214.0877	M	K	2	24
PSM	SNGYEDHMAEDC	662	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9292	38.503	2	1468.4871	1468.4871	M	R	2	14
PSM	SNGYEDHMAEDCRGDIG	663	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8420	35.085	2	1982.7371	1982.7371	M	R	2	19
PSM	SNNGLDIQDKPPAPPM	664	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=14591	58.055	2	1750.8196	1750.8196	M	R	2	18
PSM	SQKQEEENPAEETGEE	665	sp|O43768-8|ENSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=6843	28.691	2	1874.7654	1874.7654	M	K	2	18
PSM	SSEMLPAFIETSNVDK	666	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=22273	84.727	2	1824.8451	1824.8451	M	K	2	18
PSM	STATTVAPAGIPATPGPVNPPPPEVSNPSKPG	667	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:1	ms_run[2]:scan=19001	73.276	3	3046.5611	3046.5611	M	R	2	34
PSM	VAPVLETSHVFCCPN	668	sp|Q6IA86-4|ELP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=16162	63.702	2	1728.7964	1728.7964	M	R	2	17
PSM	DDDIAALVVDNGSGMC	669	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=30931	118.5696616112	2	1709.7292	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	670	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29759	114.19902860373332	2	1709.6972	1708.6912	M	K	2	18
PSM	DDIAALVVDNGSGMC	671	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,14-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=28479	109.47207542746668	2	1593.6743	1593.6645	D	K	3	18
PSM	EEEIAALVIDNGSGMC	672	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32958	125.9838374592	2	1765.7642	1764.7542	M	K	2	18
PSM	EEIAALVIDNGSGMC	673	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,14-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=32675	125.05406533653333	2	1635.7212	1635.7112	E	K	3	18
PSM	SETAPAAPAAPAPAE	674	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=8964	37.24689507786666	2	1391.6658	1391.6564	M	K	2	17
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	675	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=16461	64.76118606266667	3	3505.598311	3505.576600	T	-	609	647
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	676	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=18784	72.5174049088	4	5340.4582	5340.4222	M	R	2	70
PSM	SGESGQPEAGPSHAGLDWPNPERN	677	sp|Q6NSI4|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=15571	61.59972773413333	3	2530.1272	2530.1102	M	R	2	26
PSM	MEDLDQSPLVSSSDSPPRPQPAF	678	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:1	ms_run[1]:scan=26090	99.8833820632	2	2543.181492	2541.169334	-	K	1	24
PSM	ATQADLMELDMAMEPDR	679	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,7-UNIMOD:35	ms_run[1]:scan=26042	99.67382729173333	2	1994.8572	1993.8422	M	K	2	19
PSM	ATQADLMELDMAMEPDR	680	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,7-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=25087	95.80063248186666	2	2010.8392	2009.8372	M	K	2	19
PSM	MEDVNSNVNADQEVR	681	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9555	39.57320554426666	2	1777.772679	1776.758457	-	K	1	16
PSM	KNVMSAFGLTDDQVSGPPSAPAED	682	sp|Q92734|TFG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:35	ms_run[1]:scan=16365	64.4170073624	3	2449.134174	2448.111485	N	R	179	203
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	683	sp|Q7Z7E8|UB2Q1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:1,1-UNIMOD:35,40-UNIMOD:4	ms_run[1]:scan=19745	75.6514219528	3	3815.771287	3815.749254	-	R	1	42
PSM	MEEEGLECPNSSSEK	684	sp|Q7L7V1|DHX32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[1]:scan=8710	36.244962894400004	2	1783.706103	1782.692411	-	R	1	16
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	685	sp|Q05519|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=22767	86.50626018666667	4	4195.9482	4195.9192	M	R	2	50
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	686	sp|Q05519|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,48-UNIMOD:35	ms_run[1]:scan=21017	80.1135398256	4	4211.9412	4211.9142	M	R	2	50
PSM	ALCNGDSKLENAGGDL	687	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=16819	66.02489151706666	2	1675.7662	1674.7512	M	K	2	18
PSM	AAAAAAGAASGLPGPVAQGL	688	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=26107	99.956	2	1661.8737	1661.8737	M	K	2	22
PSM	AAAAASHLNLDAL	689	sp|Q13049|TRI32_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=23586	89.641	2	1278.6568	1278.6568	M	R	2	15
PSM	AAEAGVVGAGASPDGDW	690	sp|Q16576-2|RBBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=23128	87.865	2	1570.69	1570.6900	M	R	2	19
PSM	AANSSGQGFQNKN	691	sp|Q9NRY2-2|SOSSC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5281	22.364	2	1363.6117	1363.6117	M	R	2	15
PSM	AAPAGGGGSAVSVLAPNG	692	sp|Q9BZE9|ASPC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=18523	71.628	2	1493.7474	1493.7474	M	R	2	20
PSM	AAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGK	693	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=11237	45.906	3	3284.5116	3284.5116	M	R	2	41
PSM	AASAAAAELQASGGP	694	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=21980	83.587	2	1312.6259	1312.6259	M	R	2	17
PSM	AASCVLLHTGQ	695	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=15696	62.047	2	1197.5812	1197.5812	M	K	2	13
PSM	AATDLERFSNAEPEP	696	sp|Q92599-2|SEPT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=20588	78.56	2	1687.7689	1687.7689	M	R	2	17
PSM	AAVQAAEVKVDGSEP	697	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=15994	63.119	2	1511.7468	1511.7468	M	K	2	17
PSM	ADLAECNIKVMC	698	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,6-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=19902	76.164	2	1464.6411	1464.6411	M	R	2	14
PSM	ADLANEEKPAIAPPVFVFQ	699	sp|Q9H6Z4-3|RANB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=29418	112.94	3	2097.0783	2097.0783	M	K	2	21
PSM	ADMQNLVERLE	700	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=19285	74.246	2	1374.6449	1374.6449	M	R	2	13
PSM	ADMQNLVERLE	701	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=26857	103.05	2	1358.65	1358.6500	M	R	2	13
PSM	ADSRDPASDQMQHW	702	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=12943	52.072	2	1684.69	1684.6900	M	K	2	16
PSM	AEGGGPEPGEQER	703	sp|Q14CS0|UBX2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5679	24.033	2	1353.5797	1353.5797	M	R	2	15
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	704	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=22428	85.304	3	3477.5808	3477.5808	M	K	2	33
PSM	AGAGPAPGLPGAGGPVVPGPGAGIPGKSGEE	705	sp|Q9BTD8-4|RBM42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=20998	80.04	3	2619.3293	2619.3293	M	R	2	33
PSM	AGAGSAAVSGAGTPVAGPTG	706	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=13647	54.727	2	1596.7744	1596.7744	M	R	2	22
PSM	AGGEAGVTLGQPHLS	707	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=15680	61.988	2	1434.7103	1434.7103	M	R	2	17
PSM	AGGEAGVTLGQPHLS	708	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=15808	62.454	2	1434.7103	1434.7103	M	R	2	17
PSM	ANSTAVVKIPGTPGAGG	709	sp|Q16514-2|TAF12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=16389	64.505	2	1537.81	1537.8100	M	R	2	19
PSM	AQGSHQIDFQVLHDL	710	sp|Q9NYJ8-2|TAB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=23855	90.695	2	1748.8482	1748.8482	M	R	2	17
PSM	ASCASIDIEDATQHL	711	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=24480	93.259	2	1671.741	1671.7410	M	R	2	17
PSM	ASCASIDIEDATQHL	712	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=24595	93.723	2	1671.741	1671.7410	M	R	2	17
PSM	ASGAGGVGGGGGGKI	713	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=7806	32.546	2	1142.568	1142.5680	M	R	2	17
PSM	ASTITGSQDCIVNH	714	sp|Q16600|ZN239_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=13574	54.453	2	1543.6937	1543.6937	M	R	2	16
PSM	ASYFDEHDCEPSDPEQET	715	sp|Q9P0P0|RN181_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=17346	67.796	2	2196.8066	2196.8066	M	R	2	20
PSM	ASYFDEHDCEPSDPEQET	716	sp|Q9P0P0|RN181_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=17491	68.27	2	2196.8066	2196.8066	M	R	2	20
PSM	ATPYVTDETGGKYIASTQ	717	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=16760	65.815	2	1942.916	1942.9160	M	R	2	20
PSM	ATQADLMELDMAMEPDR	718	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=26036	99.649	2	1993.8431	1993.8431	M	K	2	19
PSM	ATTATMATSGSAR	719	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=5263	22.288	2	1282.5823	1282.5823	M	K	2	15
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	720	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=19159	73.829	3	3820.7439	3820.7439	M	K	2	36
PSM	DDDIAALVVDNGSGMC	721	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=27289	104.81	2	1708.692	1708.6920	M	K	2	18
PSM	GDPERPEAAGLDQDE	722	sp|Q7LG56-5|RIR2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=10941	44.863	2	1639.6962	1639.6962	M	R	2	17
PSM	GLLSQGSPLSWEETK	723	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=19684	75.45	2	1630.8203	1630.8203	M	R	2	17
PSM	KEEEGLANGSAAEPAMPNTYGVEPLPQEVL	724	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:35	ms_run[2]:scan=21525	81.945	3	3155.4969	3155.4969	N	K	691	721
PSM	KLVQDVANNTNEEAGDGTTTATVLA	725	sp|P10809-2|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14201	56.661	3	2531.2351	2531.2351	A	R	96	121
PSM	MDEQAGPGVFFSNNHPGAGGA	726	sp|O43815-2|STRN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=23241	88.302	2	2100.896	2100.8960	-	K	1	22
PSM	MDGEEKTYGGCEGPDAMYV	727	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,11-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=17324	67.726	2	2165.8228	2165.8228	-	K	1	20
PSM	MDGIVPDIAVGTK	728	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19666	75.391	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	729	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19806	75.868	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	730	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20079	76.813	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	731	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=24643	93.934	2	1356.6959	1356.6959	-	R	1	14
PSM	MDQCVTVERELE	732	sp|Q9H871-2|RMD5A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=19323	74.368	2	1549.6752	1549.6752	-	K	1	13
PSM	MDSGGGSLGLHTPDS	733	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12973	52.18	2	1487.6198	1487.6198	-	R	1	16
PSM	MDSTLTASEIRQ	734	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11795	47.784	2	1408.6504	1408.6504	-	R	1	13
PSM	MDSTLTASEIRQ	735	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=16095	63.469	2	1392.6555	1392.6555	-	R	1	13
PSM	MEEEGLECPNSSSEK	736	sp|Q7L7V1-2|DHX32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8677	36.111	2	1782.6924	1782.6924	-	R	1	16
PSM	MEFPDLGAHCSEPSCQ	737	sp|Q8WV99-2|ZFN2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22295	84.809	2	1905.7332	1905.7332	-	R	1	17
PSM	MEGPLSVFGDRSTGETI	738	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25907	99.119	2	1852.8513	1852.8513	-	R	1	18
PSM	MESGPRAELGAGAPPAVVA	739	sp|Q3KQU3-2|MA7D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16198	63.83	2	1836.904	1836.9040	-	R	1	20
PSM	METGTAPLVAPPR	740	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12778	51.445	2	1396.7021	1396.7021	-	R	1	14
PSM	MMLSTEGREGFVV	741	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=18599	71.878	2	1528.6902	1528.6902	-	K	1	14
PSM	MNSVGEACTDMK	742	sp|O43715|TRIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=5529	23.389	2	1415.5367	1415.5367	-	R	1	13
PSM	MNSVGEACTDMK	743	sp|O43715|TRIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=8904	37.018	2	1399.5418	1399.5418	-	R	1	13
PSM	PAIMTMLADHAA	744	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35	ms_run[2]:scan=13071	52.563	2	1256.5893	1256.5893	M	R	2	14
PSM	PAIMTMLADHAA	745	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35	ms_run[2]:scan=13440	53.952	2	1256.5893	1256.5893	M	R	2	14
PSM	PALPLDQLQITH	746	sp|Q9H1I8-3|ASCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=19624	75.251	2	1344.7402	1344.7402	M	K	2	14
PSM	PEIVDTCSLASPASVC	747	sp|P09960-2|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=17687	68.887	2	1704.7699	1704.7699	M	R	2	18
PSM	PEMPEDMEQEEVNIPNR	748	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=10435	42.92	2	2087.8776	2087.8776	M	R	2	19
PSM	PYQYPALTPEQK	749	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11644	47.251	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	750	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11769	47.687	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	751	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12015	48.632	2	1433.7191	1433.7191	M	K	2	14
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	752	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,22-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=18292	70.86	3	3498.6833	3498.6833	N	R	309	345
PSM	SDAAVDTSSEITTKDL	753	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=17152	67.152	2	1693.7894	1693.7894	M	K	2	18
PSM	SDQQLDCALDLMR	754	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=20188	77.187	2	1621.7076	1621.7076	M	R	2	15
PSM	SDQQLDCALDLMR	755	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=26320	100.8	2	1605.7127	1605.7127	M	R	2	15
PSM	SELKDCPLQFHDF	756	sp|O75528-2|TADA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=21449	81.659	2	1676.7505	1676.7505	M	K	2	15
PSM	SETAPAAPAAAPPAE	757	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=8694	36.183	2	1391.6569	1391.6569	M	K	2	17
PSM	SGALDVLQMKEEDVL	758	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=26244	100.49	2	1703.8288	1703.8288	M	K	2	17
PSM	SGEENPASKPTPVQDVQGDG	759	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=10362	42.625	2	2052.9236	2052.9236	M	R	2	22
PSM	SGELPPNINIKEP	760	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=18901	72.935	2	1448.7511	1448.7511	M	R	2	15
PSM	SGMGENTSDPSRAET	761	sp|Q15596|NCOA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=4830	20.497	2	1595.6369	1595.6369	M	R	2	17
PSM	SHQTGIQASEDVKEIFA	762	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=19454	74.725	2	1900.9167	1900.9167	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	763	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=11608	47.121	2	1966.7422	1966.7422	M	R	2	19
PSM	SNNGLDIQDKPPAPPM	764	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=17803	69.234	2	1734.8247	1734.8247	M	R	2	18
PSM	SNPFAHLAEPLDPVQPGK	765	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=23521	89.377	3	1957.9898	1957.9898	M	K	2	20
PSM	SRSNVQPTAAPGQ	766	sp|Q96GD4-4|AURKB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=5831	24.629	2	1353.6637	1353.6637	M	K	2	15
PSM	SYGRPPPDVEGMTSL	767	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15821	62.489	2	1662.7559	1662.7559	M	K	2	17
PSM	SYTLDSLGNPSAYR	768	sp|P07197|NFM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=21555	82.055	2	1584.742	1584.7420	M	R	2	16
PSM	TSEVIEDEKQFYS	769	sp|Q9BV86-2|NTM1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1	ms_run[2]:scan=20456	78.091	2	1615.7253	1615.7253	M	K	2	15
PSM	VAPVLETSHVFCCPN	770	sp|Q6IA86-4|ELP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:1,12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=24960	95.246	2	1770.8069	1770.8069	M	R	2	17
PSM	DDDIAALVVDNGSGMC	771	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29220	112.20535988906666	2	1709.6892	1708.6912	M	K	2	18
PSM	KFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	772	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:35	ms_run[1]:scan=23468	89.17799924373334	3	3093.556016	3093.532868	T	-	804	836
PSM	PSVPAAEPEYPKGI	773	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=13231	53.1726677416	2	1453.7532	1453.7448	A	R	3	17
PSM	SETAPAAPAAPAPAE	774	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=11605	47.115800988000004	2	1391.6638	1391.6564	M	K	2	17
PSM	ASGVAVSDGVIKVFNDM	775	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=25588	97.77534759626666	2	1766.8672	1765.8552	M	K	2	19
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	776	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=17244	67.4703810912	3	3089.3952	3089.3742	M	R	2	40
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	777	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=23538	89.44670775866666	3	3264.3912	3263.3742	M	K	2	33
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPAK	778	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=26569	101.8741531112	3	3265.3952	3263.3742	M	K	2	33
PSM	SGGGPSGGGPGGSGRA	779	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=4286	18.231931654133334	2	1255.5621	1255.5536	M	R	2	18
PSM	METEQPEETFPNTETNGEFGK	780	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18997	73.2660349736	2	2474.031276	2472.027481	-	R	1	22
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	781	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14101	56.28052658826667	5	6491.7882	6490.7622	M	K	2	71
PSM	AAGSGGSGGSGGGPGPGPGGGGGPSGSGSGPGSNGGLGSGGELHP	782	sp|Q96JN8|NEUL4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30		ms_run[1]:scan=11864	48.068852404000005	3	3415.5212	3413.4852	M	R	2	47
PSM	GEAAVAAGPCPLREDSFT	783	sp|Q9Y664|KPTN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,10-UNIMOD:4	ms_run[1]:scan=19918	76.2195720744	2	1888.8752	1888.8622	M	R	3	21
PSM	ATQADLMELDMAMEPDR	784	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,11-UNIMOD:35	ms_run[1]:scan=26687	102.37132870746667	2	1993.8522	1993.8422	M	K	2	19
PSM	PEMPEDMEQEEVNIPNR	785	sp|Q9NZL9-2|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	3-UNIMOD:35	ms_run[1]:scan=13415	53.86442522586666	2	2071.8972	2071.8822	M	R	2	19
PSM	ANSTAVVKIPGTPGAGG	786	sp|Q16514-2|TAF12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=16358	64.39267635173333	2	1537.8192	1537.8092	M	R	2	19
PSM	SGNGNAAATAEENSPKM	787	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=7492	31.363997966133336	2	1707.7172	1705.7212	M	R	2	19
PSM	SGNGNAAATAEENSPKM	788	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=7549	31.59238175466667	2	1706.7172	1705.7212	M	R	2	19
PSM	SGNGNAAATAEENSPKM	789	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=8473	35.30716119386667	2	1706.7152	1705.7212	M	R	2	19
PSM	MDHYDSQQTNDYMQPEEDWD	790	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20136	77.00644136586668	3	2604.950656	2603.932928	-	R	1	21
PSM	MEEELQHSHCVNCVS	791	sp|Q8TB52|FBX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=13354	53.6382875696	2	1900.767185	1899.754968	-	R	1	16
PSM	ADEEEEVKPILQ	792	sp|Q8N0Z6|TTC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=16418	64.60599786	2	1440.7070	1440.6979	M	K	3	15
PSM	AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPG	793	sp|Q9H7Z6|KAT8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=22086	84.00269500693334	3	3217.4942	3217.4752	M	R	2	40
PSM	MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEK	794	sp|P15927|RFA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:1	ms_run[1]:scan=26233	100.44705739946667	3	3734.607626	3731.574685	-	K	1	38
PSM	AAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGA	795	sp|Q9NR33|DPOE4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=15625	61.798	3	3173.4861	3173.4861	M	R	2	37
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	796	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,31-UNIMOD:35	ms_run[2]:scan=16264	64.063	3	2680.1671	2680.1671	M	K	2	33
PSM	AAAMVPGRSESWE	797	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=13793	55.231	2	1447.6402	1447.6402	M	R	2	15
PSM	AAATGAVAASAASGQAEG	798	sp|Q9NWH9|SLTM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=13897	55.599	2	1501.7009	1501.7009	M	K	2	20
PSM	AAEAADLGLGAAVPVELR	799	sp|Q9Y5Q8-2|TF3C5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=27598	106.07	2	1763.9418	1763.9418	M	R	2	20
PSM	AAQIPIVATTSTPGIVRNS	800	sp|Q6PI98|IN80C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=22191	84.415	2	1937.0582	1937.0582	M	K	2	21
PSM	AASAAAAELQASGGP	801	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=22101	84.06	2	1312.6259	1312.6259	M	R	2	17
PSM	AASTDMAGLEESFR	802	sp|Q9BW30|TPPP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=22939	87.14	2	1525.6719	1525.6719	M	K	2	16
PSM	ADDLDFETGDAGASATFPMQCSALR	803	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,21-UNIMOD:4	ms_run[2]:scan=26778	102.73	3	2687.1479	2687.1479	M	K	2	27
PSM	ADEAALALQPGGSPSAAGAD	804	sp|Q96EB6-2|SIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21330	81.246	2	1809.8381	1809.8381	M	R	2	22
PSM	ADEAALALQPGGSPSAAGAD	805	sp|Q96EB6-2|SIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21341	81.285	2	1809.8381	1809.8381	M	R	2	22
PSM	ADMQNLVERLE	806	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=19438	74.689	2	1374.6449	1374.6449	M	R	2	13
PSM	ADMQNLVERLE	807	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=26967	103.52	2	1358.65	1358.6500	M	R	2	13
PSM	ADPDVLTEVPAALK	808	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=24873	94.893	2	1479.7821	1479.7821	M	R	2	16
PSM	AEASSANLGSGCEE	809	sp|Q6P1K2-3|PMF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=10504	43.177	2	1422.5569	1422.5569	M	K	2	16
PSM	AELVQGQSAPVGM	810	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=17005	66.638	2	1343.6391	1343.6391	M	K	2	15
PSM	AELVQGQSAPVGM	811	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=17144	67.118	2	1343.6391	1343.6391	M	K	2	15
PSM	AENGESSGPPRPS	812	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5776	24.435	2	1325.5848	1325.5848	M	R	2	15
PSM	AENSESLGTVPEHE	813	sp|Q8TAG9|EXOC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=11680	47.363	2	1539.6689	1539.6689	M	R	2	16
PSM	AESDWDTVTVLR	814	sp|O60869-2|EDF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=23068	87.631	2	1432.6834	1432.6834	M	K	2	14
PSM	AKSGGCGAGAGVGGGNGALTWVNNAA	815	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=19344	74.441	3	2315.0713	2315.0713	M	K	2	28
PSM	AMNYNAKDEVDGGPPCAPGGTA	816	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,2-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=12683	51.109	2	2248.9365	2248.9365	M	K	2	24
PSM	APSVPAAEPEYPKGI	817	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13781	55.194	2	1524.7824	1524.7824	M	R	2	17
PSM	ASACGAPGPGGALGSQAPSWYH	818	sp|O15357|SHIP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=20412	77.933	2	2139.9432	2139.9432	M	R	2	24
PSM	ASEELQKDLEEV	819	sp|Q9HB71-2|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=24379	92.852	2	1430.6777	1430.6777	M	K	2	14
PSM	ASGADSKGDDLSTAIL	820	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=18993	73.25	2	1561.7471	1561.7471	M	K	2	18
PSM	ASGADSKGDDLSTAIL	821	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=19129	73.722	2	1561.7471	1561.7471	M	K	2	18
PSM	ASSAQSGGSSGGPAVPTVQ	822	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=12864	51.76	2	1685.7857	1685.7857	M	R	2	21
PSM	AVAVGRPSNEEL	823	sp|Q9NVA2|SEP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=13759	55.111	2	1282.6517	1282.6517	M	R	2	14
PSM	DDDIAALVVDNGSGMC	824	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=22815	86.691	2	1666.6815	1666.6815	M	K	2	18
PSM	DDDIAALVVDNGSGMC	825	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30203	115.91	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	826	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=29405	112.89	2	1708.692	1708.6920	M	K	2	18
PSM	KAAYPDLENPPLLVTPSQQA	827	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=20283	77.515	2	2151.1212	2151.1212	I	K	89	109
PSM	KALSQTVPSSGTNGVSLPADCTGAVPAASPDTAAW	828	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	21-UNIMOD:4	ms_run[2]:scan=20349	77.735	3	3383.6303	3383.6303	P	R	115	150
PSM	KEEEGLANGSAAEPAMPNTYGVEPLPQEVL	829	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:35	ms_run[2]:scan=21503	81.872	3	3155.4969	3155.4969	N	K	691	721
PSM	KEVIPVNVPEAQEEM	830	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:35	ms_run[2]:scan=13663	54.784	2	1726.8448	1726.8448	K	K	513	528
PSM	KIGNPVPYNEGLGQPQVAPPAPAASPAASS	831	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16224	63.919	4	2884.4719	2884.4719	V	R	111	141
PSM	KILATPPQEDAPSVDIANI	832	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=19904	76.173	2	1991.0575	1991.0575	K	R	283	302
PSM	KPAEAPTAPSPAQTLENSEPAPVSQLQS	833	sp|Q9UHD8-3|SEPT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17294	67.627	3	2844.4141	2844.4141	P	R	30	58
PSM	KPGMVVTFAPVNVTTEV	834	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35	ms_run[2]:scan=18871	72.828	2	1803.9441	1803.9441	L	K	273	290
PSM	KPGMVVTFAPVNVTTEV	835	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=21463	81.718	2	1787.9492	1787.9492	L	K	273	290
PSM	KPYFLTDGTGTVTPANASGINDGAAAVVLM	836	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	30-UNIMOD:35	ms_run[2]:scan=23545	89.475	3	2966.4695	2966.4695	L	K	235	265
PSM	KSLGPAAPIIDSPYGDPIDPEDAPESIT	837	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=23816	90.537	3	2864.3968	2864.3967	L	R	102	130
PSM	KSYELPDGQVITIGNE	838	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=23585	89.638	2	1761.8785	1761.8785	E	R	938	954
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	839	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	22-UNIMOD:35	ms_run[2]:scan=17902	69.568	3	2766.415	2766.4150	N	R	143	170
PSM	KVLAGETLSVNDPPDVLD	840	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18461	71.423	2	1880.9731	1880.9731	E	R	182	200
PSM	KVTIAQGGVLPNIQAVLLP	841	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=26958	103.48	2	1930.1615	1930.1615	G	K	100	119
PSM	KVTIAQGGVLPNIQAVLLP	842	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=27063	103.92	3	1930.1615	1930.1615	G	K	100	119
PSM	MDFEDDYTHSAC	843	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15074	59.801	2	1547.5181	1547.5181	-	R	1	13
PSM	MDFEDDYTHSAC	844	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=20025	76.597	2	1531.5232	1531.5232	-	R	1	13
PSM	MDFEDDYTHSAC	845	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=20156	77.072	2	1531.5232	1531.5232	-	R	1	13
PSM	MDGEEKTYGGCEGPDAMYV	846	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=20531	78.347	2	2149.8279	2149.8279	-	K	1	20
PSM	MDLFGDLPEPERSP	847	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=29467	113.13	2	1643.7501	1643.7501	-	R	1	15
PSM	MEDLVQDGVASPATPGTG	848	sp|Q8IWJ2-3|GCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18515	71.605	2	1801.804	1801.8040	-	K	1	19
PSM	MEDSEALGFEHMGLDP	849	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24930	95.12	2	1834.739	1834.7390	-	R	1	17
PSM	MEDSQDLNEQSVK	850	sp|O95677-3|EYA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=11496	46.758	2	1563.6723	1563.6723	-	K	1	14
PSM	MEEVPHDCPGADSAQAG	851	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=9283	38.47	2	1827.704	1827.7040	-	R	1	18
PSM	MEGGLADGEPDRTSLLGDS	852	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18501	71.56	2	1976.8633	1976.8633	-	K	1	20
PSM	MEGPLSVFGDRSTGETI	853	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25891	99.05	2	1852.8513	1852.8513	-	R	1	18
PSM	MELEDGVVYQEEPGGSGAVMSE	854	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=21558	82.065	2	2385.9828	2385.9828	-	R	1	23
PSM	MELLGEYVGQEGKPQ	855	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=28627	110.03	2	1718.8185	1718.8185	-	K	1	16
PSM	MENQVLTPHVYWAQ	856	sp|Q9P035-2|HACD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22588	85.891	2	1772.8192	1772.8192	-	R	1	15
PSM	METGTAPLVAPPR	857	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=16785	65.905	2	1380.7071	1380.7071	-	R	1	14
PSM	MFSAGAESLLHQA	858	sp|O43299-2|AP5Z1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22551	85.741	2	1418.65	1418.6500	-	R	1	14
PSM	MLGTEGGEGFVVKV	859	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22280	84.752	2	1479.7279	1479.7279	M	R	2	16
PSM	MMCGAPSATQPATAETQHIADQV	860	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=21104	80.417	2	2456.077	2456.0770	-	R	1	24
PSM	MNGTLDHPDQPDLDAI	861	sp|Q92879-2|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19563	75.052	2	1808.7887	1808.7887	-	K	1	17
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	862	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=17248	67.48	3	2838.196	2838.1960	-	K	1	25
PSM	MNSNVENLPPHII	863	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19527	74.937	2	1534.745	1534.7450	-	R	1	14
PSM	MNSSTPSTGVYANGNDSK	864	sp|O95758-6|PTBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7440	31.157	2	1886.7952	1886.7952	-	K	1	19
PSM	MNSVGEACTDMK	865	sp|O43715|TRIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=12569	50.666	2	1383.5469	1383.5469	-	R	1	13
PSM	PAVSLPPKENALF	866	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17297	67.637	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	867	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17435	68.087	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	868	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17729	69.008	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	869	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17880	69.48	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	870	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18169	70.448	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	871	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=19886	76.106	2	1381.7606	1381.7606	M	K	2	15
PSM	PEMPEDMEQEEVNIPNR	872	sp|Q9NZL9-4|MAT2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=12670	51.064	3	2071.8827	2071.8827	M	R	2	19
PSM	PGLVDSNPAPPESQE	873	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10783	44.262	2	1535.7104	1535.7104	M	K	2	17
PSM	PYLGSEDVVKEL	874	sp|Q9Y6B7-2|AP4B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18012	69.922	2	1347.6922	1347.6922	M	K	2	14
PSM	PYQYPALTPEQK	875	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11385	46.381	2	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	876	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11885	48.154	2	1433.7191	1433.7191	M	K	2	14
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	877	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=21380	81.423	4	3845.8847	3845.8847	E	R	354	390
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	878	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=21675	82.51	4	3845.8847	3845.8847	E	R	354	390
PSM	REPILSSEPSPAVTPVTPTTLIAP	879	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=22216	84.512	3	2472.3476	2472.3476	E	R	88	112
PSM	SDAAVDTSSEITTKDL	880	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=18968	73.152	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	881	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=19629	75.267	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	882	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13361	53.662	2	1651.7788	1651.7788	M	K	2	18
PSM	SDEFSLADALPEHSPA	883	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=24863	94.864	2	1726.7686	1726.7686	M	K	2	18
PSM	SESSSKSSQPLAS	884	sp|P17096-2|HMGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=5204	22.045	2	1335.6154	1335.6154	M	K	2	15
PSM	SETAPLAPTIPAPAE	885	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21686	82.556	2	1505.7613	1505.7613	M	K	2	17
PSM	SETAPLAPTIPAPAE	886	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21816	83.042	2	1505.7613	1505.7613	M	K	2	17
PSM	SETAPLAPTIPAPAE	887	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21949	83.477	2	1505.7613	1505.7613	M	K	2	17
PSM	SETAPLAPTIPAPAE	888	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=22068	83.929	2	1505.7613	1505.7613	M	K	2	17
PSM	SGDGATEQAAEYVPE	889	sp|Q12996-3|CSTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=17078	66.888	2	1564.6529	1564.6529	M	K	2	17
PSM	SGESGQPEAGPSHAGLDWPNPERN	890	sp|Q6NSI4-2|RADX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=15638	61.841	3	2530.1109	2530.1109	M	R	2	26
PSM	SNGYEDHMAEDC	891	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6041	25.394	2	1484.482	1484.4820	M	R	2	14
PSM	SNGYEDHMAEDC	892	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6159	25.873	2	1484.482	1484.4820	M	R	2	14
PSM	SQAEFEKAAEEV	893	sp|P07108|ACBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=20236	77.352	2	1378.6252	1378.6252	M	R	2	14
PSM	SSSGLNSEKVAALIQ	894	sp|Q13867|BLMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=20267	77.459	2	1544.8046	1544.8046	M	K	2	17
PSM	SSVAVLTQESFAEH	895	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=22363	85.06	2	1545.7311	1545.7311	M	R	2	16
PSM	STGPTAATGSNR	896	sp|Q15836|VAMP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=4411	18.753	2	1160.5422	1160.5422	M	R	2	14
PSM	SVNYAAGLSPYADKG	897	sp|Q8N6T7-2|SIR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=18401	71.23	2	1553.7362	1553.7362	M	K	2	17
PSM	SYGRPPPDVEGMTSL	898	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21064	80.271	2	1646.761	1646.7610	M	K	2	17
PSM	TTNAGPLHPYWPQHL	899	sp|Q15125|EBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:1	ms_run[2]:scan=21480	81.784	2	1772.8635	1772.8635	M	R	2	17
PSM	VGGGGVGGGLLENANPLIYQ	900	sp|Q9Y3D0|CIA2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=24974	95.312	2	1883.9741	1883.9741	M	R	2	22
PSM	VGQLSEGAIAAIMQ	901	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:35	ms_run[2]:scan=17355	67.823	2	1402.7126	1402.7126	M	K	2	16
PSM	DDDIAALVVDNGSGMC	902	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31535	120.87386610186667	2	1710.6902	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	903	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27716	106.52165922773334	2	1709.6842	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	904	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31407	120.36174036266667	2	1709.6902	1708.6912	M	K	2	18
PSM	EEEIAALVIDNGSGMC	905	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=33251	126.90691823280001	2	1764.7642	1764.7542	M	K	2	18
PSM	SETAPAAPAAPAPAE	906	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=11730	47.54130843493333	2	1391.6638	1391.6564	M	K	2	17
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	907	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17006	66.64014752533333	3	3505.598311	3505.576600	T	-	609	647
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	908	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	9-UNIMOD:35	ms_run[1]:scan=18792	72.55506315279999	3	3489.602969	3489.581685	T	-	609	647
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	909	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=17531	68.40795751173333	3	3091.4052	3089.3742	M	R	2	40
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	910	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=17438	68.09483063946666	3	3089.3952	3089.3742	M	R	2	40
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGG	911	sp|Q16644|MAPK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21047	80.20934740933333	3	2712.251739	2712.233726	-	R	1	31
PSM	ANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGAT	912	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,28-UNIMOD:4	ms_run[1]:scan=11906	48.23160750613333	3	3331.5212	3331.4982	M	K	2	36
PSM	MEADLSGFNIDAPRWDQ	913	sp|Q96NB2|SFXN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26231	100.4373218176	2	2021.898655	2021.878906	-	R	1	18
PSM	MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCL	914	sp|Q7Z7E8|UB2Q1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35,40-UNIMOD:4	ms_run[1]:scan=19605	75.17960454933333	4	3815.769510	3815.749254	-	R	1	42
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	915	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19025	73.36119055946666	3	3231.425693	3230.402859	Q	R	630	663
PSM	GLLSQGSPLSWEETK	916	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29		ms_run[1]:scan=19762	75.72004257893333	2	1630.8295	1630.8197	M	R	2	17
PSM	ADEEEEVKPILQ	917	sp|Q8N0Z6|TTC5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=16551	65.05587990400001	2	1440.7070	1440.6979	M	K	3	15
PSM	MDGEEQQPPHEANVEPVVPSEASEPVP	918	sp|Q9H4I3|TRABD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18161	70.41678893386667	3	2955.323296	2955.308013	-	R	1	28
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	919	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=23893	90.8327789128	3	3364.3232	3362.2662	M	K	2	31
PSM	AAAAAAAGDSDSWDADAFSVEDPVR	920	sp|O75822-2|EIF3J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=26016	99.566	3	2506.0884	2506.0884	M	K	2	27
PSM	AAAAAAGAGPEMV	921	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=13326	53.538	2	1143.523	1143.5230	M	R	2	15
PSM	AAAAAGAGSGPWAAQE	922	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=18216	70.642	2	1426.6477	1426.6477	M	K	2	18
PSM	AAAAAGLGGGGAGPGPEAGDFLA	923	sp|P23610|HAP40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=27315	104.92	2	1895.9014	1895.9014	M	R	2	25
PSM	AAAAGDGGGEGGAGLGSAAGLGPGPGL	924	sp|Q9HCJ3-2|RAVR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=24271	92.432	3	2105.9978	2105.9978	M	R	2	29
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	925	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=22220	84.532	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAMVPGRSESWE	926	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=13924	55.68	2	1447.6402	1447.6402	M	R	2	15
PSM	AAAMVPGRSESWE	927	sp|O43598-2|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=17621	68.675	2	1431.6453	1431.6453	M	R	2	15
PSM	AAAVAAAGAGEPQSPDELLP	928	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=27355	105.06	3	1875.9214	1875.9214	M	K	2	22
PSM	AADTQVSETLK	929	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=10557	43.361	2	1203.5983	1203.5983	M	R	2	13
PSM	AAGTSSYWEDLR	930	sp|O95249|GOSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=20770	79.19	2	1396.6259	1396.6259	M	K	2	14
PSM	AAPAGGGGSAVSVLAPNGR	931	sp|Q9BZE9|ASPC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15012	59.578	2	1649.8485	1649.8485	M	R	2	21
PSM	AAQVAPAAASSLGNPPPPPPSEL	932	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=23648	89.882	3	2180.1113	2180.1113	M	K	2	25
PSM	AASCVLLHTGQ	933	sp|P14550|AK1A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=15830	62.521	2	1197.5812	1197.5812	M	K	2	13
PSM	AASQAVEEMRS	934	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12567	50.66	2	1219.5503	1219.5503	M	R	2	13
PSM	AATFFGEVVKAPC	935	sp|O95456-2|PSMG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=27494	105.63	2	1437.6962	1437.6962	M	R	2	15
PSM	AATNLENQLHSAQ	936	sp|Q53HC0-2|CCD92_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15574	61.612	2	1437.6848	1437.6848	M	K	2	15
PSM	AAVKEPLEFHA	937	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15306	60.664	2	1252.6452	1252.6452	M	K	2	13
PSM	ADDLDFETGDAGASATFPMQCSALR	938	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,21-UNIMOD:4	ms_run[2]:scan=26791	102.78	3	2687.1479	2687.1479	M	K	2	27
PSM	ADFDDRVSDEE	939	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=13232	53.174	2	1338.5212	1338.5212	M	K	2	13
PSM	ADGQVAELLLR	940	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=25809	98.705	2	1225.6667	1225.6667	M	R	2	13
PSM	ADHSFSDGVPSDSVEAA	941	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15361	60.853	2	1731.7224	1731.7224	M	K	2	19
PSM	ADHVQSLAQLENLC	942	sp|Q9UIA9|XPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=23317	88.6	2	1638.7672	1638.7672	M	K	2	16
PSM	ADLAECNIKVMC	943	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,6-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=16253	64.031	2	1480.636	1480.6360	M	R	2	14
PSM	ADLDKLNIDSIIQ	944	sp|P36873|PP1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=28512	109.6	2	1498.7879	1498.7879	M	R	2	15
PSM	ADSRDPASDQMQHW	945	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=9447	39.145	2	1700.6849	1700.6849	M	K	2	16
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	946	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=21695	82.59	3	3105.3912	3105.3912	M	R	2	37
PSM	AEAEEDCHSDTV	947	sp|Q9UK97-2|FBX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=7611	31.838	2	1403.5147	1403.5147	M	R	2	14
PSM	AELVQGQSAPVGM	948	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=22410	85.23	2	1327.6442	1327.6442	M	K	2	15
PSM	AENGESSGPPRPS	949	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=5660	23.95	2	1325.5848	1325.5848	M	R	2	15
PSM	AENSESLGTVPEHE	950	sp|Q8TAG9|EXOC6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=11805	47.818	2	1539.6689	1539.6689	M	R	2	16
PSM	AESDWDTVTVLR	951	sp|O60869-2|EDF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=22946	87.164	2	1432.6834	1432.6834	M	K	2	14
PSM	AFAETYPAASSLPNGDCG	952	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=23732	90.227	2	1868.7887	1868.7887	M	R	2	20
PSM	AFLASGPYLTHQQ	953	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=24004	91.297	2	1473.7252	1473.7252	M	K	2	15
PSM	AGLTVRDPAVD	954	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=14271	56.945	2	1154.5932	1154.5932	M	R	2	13
PSM	AGPESDAQYQFTGIK	955	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13911	55.647	2	1610.7577	1610.7577	M	K	2	17
PSM	AKPAATAAAASEELSQVPDEELL	956	sp|A6NKD9|CC85C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=26149	100.14	3	2352.1697	2352.1697	M	R	2	25
PSM	ALFPAFAGLSEAPDGGSSR	957	sp|Q9H7Z3|NRDE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=31272	119.85	2	1890.9112	1890.9112	M	K	2	21
PSM	APAEILNGKEISAQI	958	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17242	67.467	2	1552.8461	1552.8461	M	R	2	17
PSM	AQDQGEKENPM	959	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=6754	28.343	2	1287.5401	1287.5401	M	R	2	13
PSM	ASASYHISNLLEKMTSSD	960	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=18722	72.313	3	2010.9204	2010.9204	M	K	2	20
PSM	ASGEHSPGSGAA	961	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=4285	18.229	2	1068.4472	1068.4472	M	R	2	14
PSM	ASGSGTKNLDF	962	sp|Q96NC0|ZMAT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12726	51.264	2	1137.5302	1137.5302	M	R	2	13
PSM	ASGSGTKNLDF	963	sp|Q96NC0|ZMAT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12862	51.757	2	1137.5302	1137.5302	M	R	2	13
PSM	ASPDDPLRADHMV	964	sp|Q8WWZ3-2|EDAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15396	60.962	2	1464.6667	1464.6667	M	K	2	15
PSM	ASSGAGDPLDSK	965	sp|Q9Y2R0|COA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8162	34.054	2	1145.52	1145.5200	M	R	2	14
PSM	ATEGMILTNHDHQI	966	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15855	62.605	2	1620.7566	1620.7566	M	R	2	16
PSM	DDDIAALVVDNGSGMC	967	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=30319	116.34	2	1708.692	1708.6920	M	K	2	18
PSM	GEKSENCGVPEDLLNGL	968	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25293	96.619	2	1871.8571	1871.8571	M	K	2	19
PSM	GPPGPALPATMNNSSSET	969	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13168	52.929	2	1726.7832	1726.7832	M	R	2	20
PSM	KAAYPDLENPPLLVTPSQQA	970	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=20436	78.015	2	2151.1212	2151.1212	I	K	89	109
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	971	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=14074	56.181	3	2730.3833	2730.3833	K	R	123	152
PSM	KEPVEAAPAAEPVPAST	972	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8554	35.633	2	1662.8465	1662.8465	Q	-	261	278
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	973	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=18207	70.615	4	3230.4029	3230.4029	Q	R	630	663
PSM	KILATPPQEDAPSVDIANI	974	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=20036	76.641	2	1991.0575	1991.0575	K	R	283	302
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	975	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=25053	95.647	3	3503.6315	3503.6315	I	R	685	719
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	976	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=25311	96.688	3	3503.6315	3503.6315	I	R	685	719
PSM	KLGLPPLTPEQQEALQ	977	sp|Q9UHX1-6|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17910	69.602	2	1760.9672	1760.9672	A	K	24	40
PSM	KPGMVVTFAPVNVTTEV	978	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=19010	73.308	2	1803.9441	1803.9441	L	K	273	290
PSM	KSYELPDGQVITIGNE	979	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=23090	87.721	2	1761.8785	1761.8785	E	R	938	954
PSM	KTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQA	980	sp|Q9HCD5|NCOA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16017	63.195	4	3485.7638	3485.7638	L	K	400	434
PSM	KTVTNAVVTVPAYFNDSQ	981	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17726	68.999	2	1952.9844	1952.9844	G	R	137	155
PSM	MDGEEKTYGGCEGPDAMYV	982	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=17473	68.205	2	2165.8228	2165.8228	-	K	1	20
PSM	MDLQAAGAQAQGAAEPSRGPPLPSA	983	sp|Q9NQ92|COPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17458	68.162	3	2448.1703	2448.1703	-	R	1	26
PSM	MDPSGVKVLETAEDIQE	984	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=26102	99.933	2	1901.8928	1901.8928	-	R	1	18
PSM	MDVGELLSYQPNRGT	985	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=27460	105.5	2	1720.809	1720.8090	-	K	1	16
PSM	MEDLDQSPLVSSSDSPPRPQPAF	986	sp|Q9NQC3-2|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=26022	99.594	3	2541.1693	2541.1693	-	K	1	24
PSM	MEEEQDLPEQPVK	987	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11757	47.641	2	1628.724	1628.7240	-	K	1	14
PSM	MELEDGVVYQEEPGGSGAVMSE	988	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=21419	81.556	2	2385.9828	2385.9828	-	R	1	23
PSM	MENEPDHENVEQSLCA	989	sp|Q8N3P4-2|VPS8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=13237	53.194	2	1958.7622	1958.7622	-	K	1	17
PSM	MEPAVGGPGPLIVNN	990	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21010	80.083	2	1521.7497	1521.7497	-	K	1	16
PSM	METMASPGKDNY	991	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6819	28.6	2	1416.5537	1416.5537	-	R	1	13
PSM	METMASPGKDNY	992	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=9944	40.975	2	1400.5588	1400.5588	-	R	1	13
PSM	MLGPEGGEGFVVKL	993	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25368	96.907	2	1489.7487	1489.7487	M	R	2	16
PSM	MLLFCPGCGNGLIVEEGQ	994	sp|Q9Y2Y1|RPC10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=25103	95.867	2	2008.9057	2008.9057	-	R	1	19
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	995	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,24-UNIMOD:35	ms_run[2]:scan=19054	73.467	3	2822.2011	2822.2011	-	K	1	25
PSM	MNSNVENLPPHII	996	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=22649	86.1	2	1518.7501	1518.7501	-	R	1	14
PSM	MQHVSSSQSSQ	997	sp|Q6ZTU2-4|E400N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3872	16.316	2	1262.5197	1262.5197	-	R	1	12
PSM	MRDADADAGGGADGGDG	998	sp|Q14657|LAGE3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4529	19.264	2	1564.5696	1564.5696	-	R	1	18
PSM	PAGPVQAVPPPPPVPTEP	999	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17514	68.354	2	1745.9352	1745.9352	M	K	2	20
PSM	PALPLDQLQITH	1000	sp|Q9H1I8-3|ASCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=19466	74.767	2	1344.7402	1344.7402	M	K	2	14
PSM	PAVSLPPKENALF	1001	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17156	67.167	2	1381.7606	1381.7606	M	K	2	15
PSM	PEIVDTCSLASPASVC	1002	sp|P09960-2|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=17838	69.345	2	1704.7699	1704.7699	M	R	2	18
PSM	PGLVDSNPAPPESQE	1003	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10907	44.731	2	1535.7104	1535.7104	M	K	2	17
PSM	PGPTPSGTNVGSSG	1004	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5518	23.35	2	1213.5575	1213.5575	M	R	2	16
PSM	PGVTVKDVNQQEFV	1005	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13804	55.271	2	1558.7991	1558.7991	M	R	2	16
PSM	PPYTVVYFPVRG	1006	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=19167	73.846	2	1393.7394	1393.7394	M	R	2	14
PSM	PTNFTVVPVEAHADGGGDETAE	1007	sp|Q9Y666-2|S12A7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15101	59.896	2	2211.992	2211.9920	M	R	2	24
PSM	PYQYPALTPEQK	1008	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12748	51.339	2	1433.7191	1433.7191	M	K	2	14
PSM	RAAAPGTLEPDAAAATPAAPSPASLPLAPGCAL	1009	sp|Q8N5W9|RFLB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	31-UNIMOD:4	ms_run[2]:scan=22778	86.543	3	3052.5652	3052.5652	E	R	51	84
PSM	RAIVDALPPPCESACTVPTDVD	1010	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=17462	68.172	2	2382.1195	2382.1195	A	K	260	282
PSM	RAVTTVTQSTPVPGPSVPPPEELQVSPGP	1011	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18274	70.807	3	2923.5291	2923.5291	T	R	1413	1442
PSM	REVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALP	1012	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=22942	87.153	3	3713.9476	3713.9476	S	R	340	376
PSM	REVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALP	1013	sp|P30260|CDC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=23015	87.422	3	3713.9476	3713.9476	S	R	340	376
PSM	RLLEGDGGPNTGGMGAYCPAPQVSNDLLL	1014	sp|P22102-2|PUR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=22876	86.918	3	2987.4117	2987.4117	K	K	220	249
PSM	SDAAVDTSSEITTKDL	1015	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=13270	53.322	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	1016	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=14014	55.956	2	1693.7894	1693.7894	M	K	2	18
PSM	SDQEAKPSTEDLGD	1017	sp|P63165|SUMO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8408	35.035	2	1532.6478	1532.6478	M	K	2	16
PSM	SENLDKSNVNEAG	1018	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7561	31.641	2	1417.6321	1417.6321	M	K	2	15
PSM	SETPAQCSIKQE	1019	sp|P41212|ETV6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=7347	30.787	2	1418.6348	1418.6348	M	R	2	14
PSM	SGELPPNINIKEP	1020	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=18771	72.471	2	1448.7511	1448.7511	M	R	2	15
PSM	SGWADERGGEGDG	1021	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=9586	39.693	2	1333.5171	1333.5171	M	R	2	15
PSM	SGWADERGGEGDG	1022	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=9727	40.185	2	1333.5171	1333.5171	M	R	2	15
PSM	SHQTGIQASEDV	1023	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=8912	37.052	2	1312.5895	1312.5895	M	K	2	14
PSM	SHTILLVQPTK	1024	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12841	51.678	2	1277.7343	1277.7343	M	R	2	13
PSM	SHTILLVQPTK	1025	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12960	52.131	2	1277.7343	1277.7343	M	R	2	13
PSM	SLQVLNDKNVSNE	1026	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=15973	63.03	2	1500.742	1500.7420	M	K	2	15
PSM	SRSYNDELQFLE	1027	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=23105	87.785	2	1541.6998	1541.6998	M	K	2	14
PSM	SRSYNDELQFLE	1028	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=23235	88.279	2	1541.6998	1541.6998	M	K	2	14
PSM	SSEAETQQPPAAPPAAPALSAADT	1029	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=18095	70.195	3	2319.0866	2319.0866	M	K	2	26
PSM	SSEMLPAFIETSNVDK	1030	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=22585	85.879	2	1824.8451	1824.8451	M	K	2	18
PSM	SSVAVLTQESFAEH	1031	sp|Q00341|VIGLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=22236	84.59	2	1545.7311	1545.7311	M	R	2	16
PSM	SVATGSSETAGGASGGGA	1032	sp|Q8TAE6|PP14C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=7370	30.894	2	1464.6328	1464.6328	M	R	2	20
PSM	SVELEEALPVTTAEGMA	1033	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=27217	104.51	2	1803.8448	1803.8448	M	K	2	19
PSM	SYGRPPPDVEGMTSL	1034	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15950	62.94	2	1662.7559	1662.7559	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1035	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=20714	78.995	2	1646.761	1646.7610	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1036	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=20902	79.703	2	1646.761	1646.7610	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1037	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=21197	80.752	2	1646.761	1646.7610	M	K	2	17
PSM	TSMASLFSFTSPAVK	1038	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=24616	93.814	2	1630.7913	1630.7913	M	R	2	17
PSM	TTTTTFKGVDPNS	1039	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:1	ms_run[2]:scan=12290	49.666	2	1409.6674	1409.6674	M	R	2	15
PSM	VEKEEAGGGISEEEAAQYD	1040	sp|Q9UBE0-2|SAE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10349	42.577	2	2009.8702	2009.8702	M	R	2	21
PSM	DDDIAALVVDNGSGMC	1041	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31656	121.349031104	2	1692.6974	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1042	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=26933	103.367173544	2	1708.6982	1708.6915	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1043	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32197	123.40829964346668	2	1708.6901	1708.6915	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1044	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31840	122.07537389946667	2	1710.7082	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1045	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31418	120.40297762773334	2	1709.6902	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1046	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=29107	111.7869647928	2	1709.6892	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1047	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30347	116.45254163813334	2	1693.6912	1692.6962	M	K	2	18
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	1048	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=18326	70.98003707893334	5	5340.4572	5340.4222	M	R	2	70
PSM	SASAPAAEGEGTPTQPASEKEPEMPGP	1049	sp|P35659|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=14520	57.79834275146666	3	2664.2022	2664.1852	M	R	2	29
PSM	ASGQGPGPPRQECGEPALPSASEEQVAQDTEEVF	1050	sp|Q16611|BAK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=24823	94.68996753706666	3	3595.6212	3595.6002	M	R	2	36
PSM	ADLAECNIKVMC	1051	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,6-UNIMOD:4,11-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=16374	64.44714261066666	2	1480.6453	1480.6355	M	R	2	14
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	1052	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14235	56.79893771866667	5	6492.7742	6490.7622	M	K	2	71
PSM	ATQADLMELDMAMEPDR	1053	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,11-UNIMOD:35	ms_run[1]:scan=26667	102.28634184853333	2	1994.8582	1993.8422	M	K	2	19
PSM	ADSGTAGGAALAAPAPGPGSGGPGP	1054	sp|Q96C90|PP14B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=17053	66.79757338186667	2	2002.9532	2001.9382	M	R	2	27
PSM	ARPDDEEGAAVAPGHPLA	1055	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=11179	45.7118778776	2	1814.8702	1813.8592	M	K	2	20
PSM	MNTEAEQQLLHHA	1056	sp|Q9BXW6|OSBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=13424	53.89562496773333	2	1578.720148	1578.709656	-	R	1	14
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1057	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18924	73.00928716453333	3	3231.425693	3230.402859	Q	R	630	663
PSM	KPLESPGGTMAPQQPEGAKPQAQAALAAP	1058	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:35	ms_run[1]:scan=13735	55.0191565608	3	2857.410015	2856.443993	M	K	355	384
PSM	RVVVPATEEEAEVDEFPTDGEMSAQEED	1059	sp|O00541|PESC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	22-UNIMOD:35	ms_run[1]:scan=17638	68.73487189386667	3	3124.366842	3123.335015	A	R	285	313
PSM	SGNGNAAATAEENSPKM	1060	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=7699	32.18738795146667	2	1706.7152	1705.7212	M	R	2	19
PSM	SGNGNAAATAEENSPKM	1061	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=8382	34.9334202824	2	1706.7152	1705.7212	M	R	2	19
PSM	MEEELQHSHCVNCVS	1062	sp|Q8TB52|FBX30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=9120	37.81264314853333	2	1916.778163	1915.749883	-	R	1	16
PSM	KTVEPPISQVGNVDTASELE	1063	sp|O95104|SCAF4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=16163	63.707706184	2	2113.072849	2112.058644	N	K	1091	1111
PSM	SSGNAKIGHPAPNF	1064	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=9897	40.79858628986666	2	1437.7064	1437.6996	M	K	2	16
PSM	MDFEDDYTHSAC	1065	sp|Q5BKZ1|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=20016	76.57247378453333	2	1531.531654	1531.523160	-	R	1	13
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	1066	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=22248	84.63109883973334	3	3105.4092	3105.3902	M	R	2	37
PSM	AAAAAGAGSGPWAAQE	1067	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=18072	70.125	2	1426.6477	1426.6477	M	K	2	18
PSM	AAAAMAAAAGGGAGAA	1068	sp|Q9NX46|ADPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=12515	50.465	2	1216.5506	1216.5506	M	R	2	18
PSM	AAADGGGPGGASVGTEEDGGGVGH	1069	sp|A6NHR9-2|SMHD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=10294	42.342	3	2022.8515	2022.8515	M	R	2	26
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	1070	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=22416	85.252	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAEEEDGGPEGPNRE	1071	sp|Q99942|RNF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7759	32.392	2	1668.6863	1668.6863	M	R	2	18
PSM	AAAVAVAAASR	1072	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14587	58.04	2	998.55089	998.5509	M	R	2	13
PSM	AAAVAVAAASR	1073	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14712	58.517	2	998.55089	998.5509	M	R	2	13
PSM	AADISESSGADC	1074	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=10270	42.254	2	1223.4612	1223.4612	M	K	2	14
PSM	AALAPLPPLPAQF	1075	sp|Q9NP79|VTA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=32969	126.02	2	1346.7598	1346.7598	M	K	2	15
PSM	AAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPG	1076	sp|Q9H7Z6|KAT8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=22107	84.084	3	3217.476	3217.4760	M	R	2	40
PSM	AAQIPESDQIKQF	1077	sp|Q9Y5J7|TIM9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19174	73.868	2	1515.7569	1515.7569	M	K	2	15
PSM	AAQIPESDQIKQF	1078	sp|Q9Y5J7|TIM9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19102	73.617	3	1515.7569	1515.7569	M	K	2	15
PSM	AAQVAPAAASSLGNPPPPPPSEL	1079	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=23602	89.71	2	2180.1113	2180.1113	M	K	2	25
PSM	AASAPPPPDKLEGGGGPAPPPAPPSTG	1080	sp|Q9BRQ0|PYGO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14634	58.201	3	2431.202	2431.2020	M	R	2	29
PSM	AASEVAGVVANAPSPPESSSLCAS	1081	sp|Q8ND24-2|RN214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,22-UNIMOD:4	ms_run[2]:scan=24613	93.8	3	2299.0638	2299.0638	M	K	2	26
PSM	AATTGSGVKVP	1082	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=10469	43.058	2	1028.5502	1028.5502	M	R	2	13
PSM	AATTGSGVKVP	1083	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=10590	43.498	2	1028.5502	1028.5502	M	R	2	13
PSM	AAVKEPLEFHA	1084	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=15436	61.116	2	1252.6452	1252.6452	M	K	2	13
PSM	AAVQAAEVKVDGSEP	1085	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=16124	63.57	2	1511.7468	1511.7468	M	K	2	17
PSM	ADGQVAELLLR	1086	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=25917	99.158	2	1225.6667	1225.6667	M	R	2	13
PSM	ADGSLTGGGLEAAAMAPE	1087	sp|Q8NEM2|SHCBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,15-UNIMOD:35	ms_run[2]:scan=21074	80.306	2	1674.7407	1674.7407	M	R	2	20
PSM	ADSRDPASDQMQHW	1088	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=9566	39.616	2	1700.6849	1700.6849	M	K	2	16
PSM	AEGTAEAPLENGGGGDSGAGALE	1089	sp|Q96G46-3|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=17887	69.506	2	2070.8978	2070.8978	M	R	2	25
PSM	AELVQGQSAPVGM	1090	sp|Q96I24|FUBP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=22288	84.786	2	1327.6442	1327.6442	M	K	2	15
PSM	AELVQGQSAPVGMKAEGFVDALH	1091	sp|Q96I24|FUBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=23518	89.363	3	2411.1791	2411.1791	M	R	2	25
PSM	AEPDPSHPLETQAG	1092	sp|Q8IXJ6-4|SIR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=11614	47.139	2	1489.6685	1489.6685	M	K	2	16
PSM	AGENFATPFHGHVG	1093	sp|Q9Y5N5-2|N6MT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=15329	60.739	2	1481.6688	1481.6688	M	R	2	16
PSM	AGLTVRDPAVD	1094	sp|P33240-2|CSTF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14403	57.407	2	1154.5932	1154.5932	M	R	2	13
PSM	AHSPVQSGLPGMQNL	1095	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15277	60.561	2	1592.7617	1592.7617	M	K	2	17
PSM	AISSSSCELPLVAVCQVTSTPDKQQNF	1096	sp|Q86X76-2|NIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28298	108.75	3	3007.4267	3007.4267	M	K	2	29
PSM	ALDGPEQMELEEGKAGSGL	1097	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=20097	76.872	3	1987.9045	1987.9045	M	R	2	21
PSM	ANEAYPCPCDIGH	1098	sp|Q96DG6|CMBL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=14607	58.11	2	1544.6024	1544.6024	M	R	2	15
PSM	ANEAYPCPCDIGH	1099	sp|Q96DG6|CMBL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=14729	58.575	2	1544.6024	1544.6024	M	R	2	15
PSM	APIKVGDAIPAVEVFEGEPGN	1100	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=24249	92.341	3	2108.079	2108.0790	M	K	2	23
PSM	AQPGTLNLNNEVVKM	1101	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,15-UNIMOD:35	ms_run[2]:scan=16583	65.175	2	1684.8454	1684.8454	M	R	2	17
PSM	ASEELACKLE	1102	sp|Q9BUP0|EFHD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=15438	61.121	2	1190.5489	1190.5489	M	R	2	12
PSM	ASSGAGDPLDSK	1103	sp|Q9Y2R0|COA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=8275	34.517	2	1145.52	1145.5200	M	R	2	14
PSM	ATETVELHKL	1104	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=12735	51.298	2	1181.6292	1181.6292	M	K	2	12
PSM	ATVTATTKVPEI	1105	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=17135	67.088	2	1271.6973	1271.6973	M	R	2	14
PSM	DDDIAALVVDNGSGMC	1106	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31581	121.05	2	1692.6971	1692.6971	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	1107	sp|Q9BTY7|HGH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=16076	63.401	2	1910.8494	1910.8494	M	K	2	24
PSM	GEKSENCGVPEDLLNGL	1108	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25412	97.068	2	1871.8571	1871.8571	M	K	2	19
PSM	KALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEE	1109	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4	ms_run[2]:scan=23764	90.332	4	3807.9214	3807.9214	A	K	49	92
PSM	KDPDSNPYSLLDTSEPEPPVDSEPGEPPPASA	1110	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=21559	82.07	3	3333.5049	3333.5049	L	R	512	544
PSM	KEAAPDAGAEPITADSDPAYSS	1111	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10949	44.893	2	2161.9651	2161.9651	E	K	287	309
PSM	KFIPLSEPAPVPPIPNEQQLA	1112	sp|Q99627-2|CSN8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=22249	84.636	3	2284.2467	2284.2467	N	R	129	150
PSM	KFSAPVVPSSFNFGGPAPGMN	1113	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	20-UNIMOD:35	ms_run[2]:scan=21546	82.024	3	2123.0146	2123.0146	Y	-	1018	1039
PSM	KGIPLATGDTSPEPELLPGAPLPPP	1114	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=23266	88.394	3	2463.3261	2463.3261	L	K	32	57
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	1115	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13967	55.813	3	2773.4246	2773.4246	G	K	61	94
PSM	KLYTLVTYVPVTTF	1116	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=24934	95.141	2	1643.9174	1643.9174	N	K	101	115
PSM	KNPESTVPIAPELPPSTSTEQPVTPEPTS	1117	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17102	66.969	3	3029.5081	3029.5081	V	R	1097	1126
PSM	KTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQA	1118	sp|Q9HCD5|NCOA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16027	63.228	4	3485.7638	3485.7638	L	K	400	434
PSM	MDFEDDYTHSAC	1119	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=14937	59.306	2	1547.5181	1547.5181	-	R	1	13
PSM	MDGGDDGNLIIK	1120	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=17798	69.218	2	1288.5969	1288.5969	-	K	1	13
PSM	MDGIVPDIAVGTK	1121	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19518	74.919	2	1372.6908	1372.6908	-	R	1	14
PSM	MDSAGQDINLNSPN	1122	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13958	55.791	2	1532.6413	1532.6413	-	K	1	15
PSM	MDSVEKGAATSVSNP	1123	sp|Q8NFW8-2|NEUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9871	40.694	2	1549.693	1549.6930	-	R	1	16
PSM	MDSVEKGAATSVSNP	1124	sp|Q8NFW8-2|NEUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14577	57.999	2	1533.6981	1533.6981	-	R	1	16
PSM	MEANGLGPQGFPEL	1125	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=31381	120.26	2	1500.6919	1500.6919	-	K	1	15
PSM	MEDSEALGFEHMGLDP	1126	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=27502	105.66	2	1818.7441	1818.7441	-	R	1	17
PSM	MEENDPKPGEAAAAVEGQ	1127	sp|P19622|HME2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11355	46.284	2	1899.8156	1899.8156	-	R	1	19
PSM	MEMTEMTGVSLK	1128	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=9256	38.36	2	1445.6088	1445.6088	-	R	1	13
PSM	MEPAVSEPMRDQVA	1129	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=10049	41.382	2	1632.7124	1632.7124	-	R	1	15
PSM	MEPAVSEPMRDQVA	1130	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=10169	41.857	2	1632.7124	1632.7124	-	R	1	15
PSM	MESYHKPDQQ	1131	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4527	19.259	2	1319.5452	1319.5452	-	K	1	11
PSM	METMASPGKDNY	1132	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=6777	28.437	2	1416.5537	1416.5537	-	R	1	13
PSM	MEVDAPGVDGRDGL	1133	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15492	61.314	2	1487.6562	1487.6562	-	R	1	15
PSM	MEVTGDAGVPESGEI	1134	sp|O00273-2|DFFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=23252	88.344	2	1531.6712	1531.6712	-	R	1	16
PSM	MHGGGPPSGDSACPL	1135	sp|P24928-2|RPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=9953	41.007	2	1496.6024	1496.6024	-	R	1	16
PSM	MLAAGVGGQGE	1136	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12323	49.798	2	1046.4703	1046.4703	-	R	1	12
PSM	MMLSTEGREGFVV	1137	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=18730	72.335	2	1528.6902	1528.6902	-	K	1	14
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	1138	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=16960	66.486	3	2838.196	2838.1960	-	K	1	25
PSM	MNSNVENLPPHII	1139	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19229	74.039	2	1534.745	1534.7450	-	R	1	14
PSM	MNSSTPSTANGNDSK	1140	sp|O95758-1|PTBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3942	16.645	2	1567.642	1567.6420	-	K	1	16
PSM	MNTEAEQQLLHHA	1141	sp|Q9BXW6|OSBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13549	54.371	2	1578.7097	1578.7097	-	R	1	14
PSM	MNVGTAHSEVNPNT	1142	sp|Q8N138-4|ORML3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7152	30.005	2	1527.6624	1527.6624	-	R	1	15
PSM	MNVGVAHSEVNPNT	1143	sp|Q9P0S3|ORML1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8848	36.802	2	1525.6831	1525.6831	-	R	1	15
PSM	MNVGVAHSEVNPNT	1144	sp|Q9P0S3|ORML1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=13027	52.401	2	1509.6882	1509.6882	-	R	1	15
PSM	MQDAENVAVPEAAEE	1145	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15491	61.312	2	1659.6934	1659.6934	-	R	1	16
PSM	MQDAENVAVPEAAEE	1146	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=20352	77.744	2	1643.6985	1643.6985	-	R	1	16
PSM	MQNDAGEFVDLYVPR	1147	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25318	96.712	3	1810.8196	1810.8196	-	K	1	16
PSM	MVFFTCNACGESVK	1148	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=12694	51.15	2	1664.6997	1664.6997	-	K	1	15
PSM	PAIMTMLADHAA	1149	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=13556	54.395	2	1256.5893	1256.5893	M	R	2	14
PSM	PAVSLPPKENALF	1150	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17577	68.549	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	1151	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18022	69.951	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	1152	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18312	70.933	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	1153	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18621	71.956	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	1154	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18763	72.45	2	1381.7606	1381.7606	M	K	2	15
PSM	PEFLEDPSVLTKD	1155	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18760	72.445	2	1488.7348	1488.7348	M	K	2	15
PSM	PEPTKSAPAP	1156	sp|P58876|H2B1D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4428	18.834	2	993.51311	993.5131	M	K	2	12
PSM	PGVTVKDVNQQEFV	1157	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13945	55.757	2	1558.7991	1558.7991	M	R	2	16
PSM	PPYTVVYFPVRG	1158	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=19305	74.315	2	1393.7394	1393.7394	M	R	2	14
PSM	RAIVDALPPPCESACTVPTDVD	1159	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=17254	67.504	3	2382.1195	2382.1195	A	K	260	282
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1160	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=21526	81.949	4	3845.8847	3845.8847	E	R	354	390
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1161	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=21310	81.166	3	3845.8847	3845.8847	E	R	354	390
PSM	SDAAVDTSSEITTKDL	1162	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19180	73.88	2	1693.7894	1693.7894	M	K	2	18
PSM	SDAAVDTSSEITTKDL	1163	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19335	74.41	2	1693.7894	1693.7894	M	K	2	18
PSM	SDNGELEDKPPAPPV	1164	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=14415	57.438	2	1605.7522	1605.7522	M	R	2	17
PSM	SEDSSALPWSIN	1165	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=26892	103.2	2	1346.599	1346.5990	M	R	2	14
PSM	SETAPAAPAAAPPAE	1166	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=11335	46.228	2	1391.6569	1391.6569	M	K	2	17
PSM	SETAPAAPAAAPPAE	1167	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=11468	46.657	2	1391.6569	1391.6569	M	K	2	17
PSM	SGELPPNINIKEP	1168	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=18638	72.017	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	1169	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19033	73.391	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	1170	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=19915	76.212	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	1171	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=20189	77.189	2	1448.7511	1448.7511	M	R	2	15
PSM	SGMGENTSDPSRAET	1172	sp|Q15596|NCOA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=7034	29.509	2	1579.642	1579.6420	M	R	2	17
PSM	SGSSSVAAMK	1173	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6191	26.01	1	965.4488	965.4488	M	K	2	12
PSM	SNNGLDIQDKPPAPPM	1174	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=14671	58.349	3	1750.8196	1750.8196	M	R	2	18
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	1175	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,48-UNIMOD:35	ms_run[2]:scan=21025	80.143	4	4211.9149	4211.9149	M	R	2	50
PSM	SRTLASAVPLSSPDYYE	1176	sp|Q2M2Z5-3|KIZ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=22139	84.204	2	1896.9105	1896.9105	M	R	2	19
PSM	SSDASQGVITTPPPPSMPH	1177	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=13021	52.378	2	1962.8993	1962.8993	M	K	2	21
PSM	SSDASQGVITTPPPPSMPH	1178	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=13161	52.909	2	1962.8993	1962.8993	M	K	2	21
PSM	STLYVSPHPDAFPSL	1179	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=25808	98.7	2	1671.8144	1671.8144	M	R	2	17
PSM	STLYVSPHPDAFPSL	1180	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=25916	99.156	2	1671.8144	1671.8144	M	R	2	17
PSM	TGAEIEPSAQAKPE	1181	sp|Q96D09|GASP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6139	25.792	2	1426.694	1426.6940	M	K	2	16
PSM	TTPNKTPPGADP	1182	sp|Q9UM13|APC10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:1	ms_run[2]:scan=6223	26.14	2	1236.5986	1236.5986	M	K	2	14
PSM	VNPGSSSQPPPVTAGSLSWK	1183	sp|P61968|LMO4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14818	58.887	2	1995.0062	1995.0062	M	R	2	22
PSM	VPPVQVSPLIKLG	1184	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=20083	76.822	2	1345.8333	1345.8333	M	R	2	15
PSM	DDDIAALVVDNGSGMC	1185	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27185	104.38113725706667	2	1708.7003	1708.6915	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1186	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31764	121.7838987928	2	1692.6995	1692.6966	M	K	2	18
PSM	DDIAALVVDNGSGMC	1187	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	14-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=20797	79.293081096	2	1551.6637	1551.6540	D	K	3	18
PSM	EEEIAALVIDNGSGMC	1188	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32828	125.5575528792	2	1764.7481	1764.7541	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1189	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31740	121.67959972106668	2	1765.7482	1764.7542	M	K	2	18
PSM	AGVEEVAASGSHLNGDLDPDDREEGAASTAEEAA	1190	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=20601	78.60097361439999	3	3382.4952	3381.4712	M	K	2	36
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	1191	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=18641	72.02530459173333	4	5340.4582	5340.4222	M	R	2	70
PSM	AAALGASGGAGAGDDDFDQFDKPGAE	1192	sp|Q96EV2|RBM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=22189	84.40663172133333	3	2451.0592	2451.0462	M	R	2	28
PSM	ADDLDFETGDAGASATFPMQCSAL	1193	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=28748	110.47518053653333	3	2547.0562	2547.0412	M	R	2	26
PSM	ASGQGPGPPRQECGEPALPSASEEQVAQDTEEVF	1194	sp|Q16611|BAK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=24831	94.7271465616	3	3595.6212	3595.6002	M	R	2	36
PSM	MNYNAKDEVDGGPPCAPGGTA	1195	sp|Q9NV96|CC50A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,1-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=12307	49.7329488336	2	2177.9132	2177.8992	A	K	3	24
PSM	METEQPEETFPNTETNGEFGK	1196	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18307	70.91610197680001	2	2473.030550	2472.027481	-	R	1	22
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	1197	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14324	57.13879339786667	5	6492.7742	6490.7622	M	K	2	71
PSM	MEPRPTAPSSGAPGLAGVGETPSAAALAAA	1198	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1	ms_run[1]:scan=23158	87.97467688773332	3	2746.376884	2746.359595	-	R	1	31
PSM	MEADLSGFNIDAPRWDQ	1199	sp|Q96NB2|SFXN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26240	100.47389451333333	2	2022.896051	2021.878906	-	R	1	18
PSM	ATQADLMELDMAMEPDR	1200	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=28007	107.6530364144	2	1978.8492	1977.8472	M	K	2	19
PSM	SDAAVDTSSEITTKDL	1201	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=19942	76.31481511653332	2	1694.8102	1693.7892	M	K	2	18
PSM	MYQVKPYHGGGAPL	1202	sp|Q13155|AIMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12819	51.599218623733336	2	1574.7652	1574.7542	P	R	3	17
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	1203	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=25074	95.73968915626666	3	3505.662547	3503.631515	I	R	685	719
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	1204	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	25-UNIMOD:35	ms_run[1]:scan=16518	64.95213896213333	3	2715.409773	2714.388392	K	R	123	152
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	1205	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	4-UNIMOD:35,22-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=18443	71.36778205653333	3	3498.708546	3498.683314	N	R	398	434
PSM	SGGGVIRGPAGNNDC	1206	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=9274	38.4319390416	2	1472.6402	1471.6472	M	R	2	17
PSM	SGGGVIRGPAGNNDC	1207	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=9391	38.92631260453334	2	1472.6402	1471.6472	M	R	2	17
PSM	MDHYDSQQTNDYMQPEEDWD	1208	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,13-UNIMOD:35	ms_run[1]:scan=19529	74.94496457173334	2	2604.952260	2603.932928	-	R	1	21
PSM	RLILPVGPAGGNQMLEQYD	1209	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:35	ms_run[1]:scan=19779	75.78447314613332	2	2086.073826	2086.051725	G	K	178	197
PSM	MMCGAPSATQPATAETQHIADQV	1210	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=18450	71.3880235048	3	2472.087576	2472.071946	-	R	1	24
PSM	CDIEEATNQLLDVNLHENQ	1211	sp|Q9BV44|THUM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,1-UNIMOD:4	ms_run[1]:scan=29824	114.44612295893333	2	2297.0432	2296.0272	M	K	2	21
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	1212	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,7-UNIMOD:35,20-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=25312	96.69027389226667	3	2945.3162	2945.2992	M	R	2	33
PSM	MKETIMNQEKLA	1213	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10554	43.3523761576	2	1492.736680	1492.726552	-	K	1	13
PSM	METEQPEETFPNTETNGEFGK	1214	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18195	70.55302148106666	2	2473.028226	2472.027481	-	R	1	22
PSM	AAAAAAAAAAGAAGG	1215	sp|Q86U42-2|PABP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20593	78.581	2	1083.5309	1083.5309	M	R	2	17
PSM	AAAADSFSGGPAGV	1216	sp|Q96E14|RMI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=19733	75.618	2	1218.5517	1218.5517	M	R	2	16
PSM	AAAEAANCIMEVSCGQAESSE	1217	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=23617	89.766	3	2241.8824	2241.8824	M	K	2	23
PSM	AAAEAANCIMEVSCGQAESSE	1218	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=23743	90.26	3	2241.8824	2241.8824	M	K	2	23
PSM	AAAEAANCIMEVSCGQAESSE	1219	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=28047	107.79	3	2225.8875	2225.8875	M	K	2	23
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	1220	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=24919	95.072	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAEEEDGGPEGPNRE	1221	sp|Q99942|RNF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7667	32.056	2	1668.6863	1668.6863	M	R	2	18
PSM	AAAEEGCSVGAEAD	1222	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=10184	41.908	2	1377.5354	1377.5354	M	R	2	16
PSM	AAAVAAAGAGEPQSPDELLP	1223	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=27468	105.53	3	1875.9214	1875.9214	M	K	2	22
PSM	AADISESSGADC	1224	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=10377	42.68	2	1223.4612	1223.4612	M	K	2	14
PSM	AADISESSGADCKGDP	1225	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=9269	38.41	2	1620.6573	1620.6573	M	R	2	18
PSM	AADKPADQGAE	1226	sp|Q9H9A5-4|CNO10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=4321	18.381	2	1113.4938	1113.4938	M	K	2	13
PSM	AADTQVSETLK	1227	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=10674	43.824	2	1203.5983	1203.5983	M	R	2	13
PSM	AAGGDHGSPDSY	1228	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6625	27.808	2	1174.4527	1174.4527	M	R	2	14
PSM	AAGGDHGSPDSY	1229	sp|P30566-2|PUR8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=6743	28.301	2	1174.4527	1174.4527	M	R	2	14
PSM	AAQIPESDQIKQF	1230	sp|Q9Y5J7|TIM9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=19036	73.397	2	1515.7569	1515.7569	M	K	2	15
PSM	AATTGSGVKVP	1231	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=10717	43.994	2	1028.5502	1028.5502	M	R	2	13
PSM	ADQGEKENPM	1232	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=4171	17.709	2	1175.4765	1175.4765	M	R	2	12
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	1233	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=21570	82.11	3	3105.3912	3105.3912	M	R	2	37
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	1234	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=22126	84.158	3	3105.3912	3105.3912	M	R	2	37
PSM	AEGSAVSDPQHAA	1235	sp|Q9H2C0|GAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7170	30.08	2	1280.5633	1280.5633	M	R	2	15
PSM	AELGLNEHHQNEVINYM	1236	sp|Q9NQ48|LZTL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20421	77.959	3	2051.9371	2051.9371	M	R	2	19
PSM	AELGLNEHHQNEVINYM	1237	sp|Q9NQ48|LZTL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20444	78.049	2	2051.9371	2051.9371	M	R	2	19
PSM	AENGDNEKMAALEA	1238	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=8531	35.551	2	1519.6461	1519.6461	M	K	2	16
PSM	AESSESFTMASSPAQ	1239	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=13126	52.773	2	1586.6406	1586.6406	M	R	2	17
PSM	AGCGEIDHSINMLPTN	1240	sp|Q9NTX7-2|RN146_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,3-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=16554	65.064	2	1785.7662	1785.7662	M	R	2	18
PSM	AGDSEQTLQNHQQPNGGEPFLIGVSGGTASG	1241	sp|Q9BZX2|UCK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=22599	85.925	3	3094.4228	3094.4228	M	K	2	33
PSM	AHIPSGGAPAAGAAPMGPQYCVC	1242	sp|Q96FN4|CPNE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,16-UNIMOD:35,21-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=16204	63.853	3	2297.0027	2297.0027	M	K	2	25
PSM	AHSPVQSGLPGMQNL	1243	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20920	79.755	2	1576.7668	1576.7668	M	K	2	17
PSM	AISSSSCELPLVAVCQVTSTPDKQQNF	1244	sp|Q86X76-2|NIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28213	108.42	3	3007.4267	3007.4267	M	K	2	29
PSM	AKNGSEADIDEGLYS	1245	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=14025	55.99	2	1609.7108	1609.7108	M	R	2	17
PSM	ANDSGGPGGPSPSERD	1246	sp|Q9GZT9-3|EGLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5702	24.138	2	1540.639	1540.6390	M	R	2	18
PSM	APAMQPAEIQFAQ	1247	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=13719	54.964	2	1416.6708	1416.6708	M	R	2	15
PSM	APAMQPAEIQFAQ	1248	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17111	67.005	2	1400.6758	1400.6758	M	R	2	15
PSM	APSVPAAEPEYPKGI	1249	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13914	55.655	2	1524.7824	1524.7824	M	R	2	17
PSM	AQDQGEKENPM	1250	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=4175	17.725	2	1303.535	1303.5350	M	R	2	13
PSM	ASEELQKDLEEV	1251	sp|Q9HB71-2|CYBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=17086	66.914	2	1430.6777	1430.6777	M	K	2	14
PSM	ASGGSGGVSVPALWSEVN	1252	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=29368	112.75	2	1714.8162	1714.8162	M	R	2	20
PSM	ASSDIQVKELE	1253	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=14986	59.482	2	1259.6245	1259.6245	M	K	2	13
PSM	ASSHSSSPVPQGSSSDVFF	1254	sp|Q9P1Q0-4|VPS54_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20463	78.116	2	1950.8595	1950.8596	M	K	2	21
PSM	ASTITGSQDCIVNH	1255	sp|Q16600|ZN239_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=13625	54.637	2	1543.6937	1543.6937	M	R	2	16
PSM	ATAATEEPFPFHGLLP	1256	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=31198	119.57	2	1738.8566	1738.8566	M	K	2	18
PSM	ATAATEEPFPFHGLLPK	1257	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=24906	95.025	2	1866.9516	1866.9516	M	K	2	19
PSM	ATGANATPLDFPSK	1258	sp|Q15637-4|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=16800	65.95	2	1430.7042	1430.7042	M	K	2	16
PSM	ATSLHEGPTNQLDLLI	1259	sp|Q15723-4|ELF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=26990	103.62	2	1762.9101	1762.9101	M	R	2	18
PSM	AVAVGRPSNEEL	1260	sp|Q9NVA2|SEP11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=13624	54.633	2	1282.6517	1282.6517	M	R	2	14
PSM	DDDIAALVVDNGSGMC	1261	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=26774	102.71	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1262	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=26962	103.5	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1263	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=22378	85.105	2	1722.7441	1722.7441	M	K	2	18
PSM	GDPERPEAAGLDQDE	1264	sp|Q7LG56-5|RIR2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=11077	45.362	2	1639.6962	1639.6962	M	R	2	17
PSM	KEGVIEPDTDAPQEMGDENAEITEEMMDQAND	1265	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35,26-UNIMOD:35,27-UNIMOD:35	ms_run[2]:scan=13627	54.646	3	3598.4393	3598.4393	D	K	85	117
PSM	KIEEPPIPPLEQPVAPED	1266	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18624	71.969	2	1997.0357	1997.0357	P	K	754	772
PSM	KLLGASELPIVTPAL	1267	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=23566	89.556	2	1520.9178	1520.9178	V	R	300	315
PSM	KNPESTVPIAPELPPSTSTEQPVTPEPTS	1268	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17085	66.909	3	3029.5081	3029.5081	V	R	1097	1126
PSM	KPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILT	1269	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=24115	91.781	3	3287.7289	3287.7289	A	K	489	523
PSM	KPVQTSAVTGQASTGPVTQIIQT	1270	sp|P51610-2|HCFC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14890	59.131	3	2311.2383	2311.2383	T	K	621	644
PSM	KSYELPDGQVITIGNE	1271	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19729	75.61	2	1761.8785	1761.8785	E	R	938	954
PSM	KSYELPDGQVITIGNE	1272	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19717	75.564	2	1761.8785	1761.8785	E	R	938	954
PSM	KVAEAPGVASPTEAAEAPVPATPTGAAAPTGAAESPGTSGSP	1273	sp|Q7L311|ARMX2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15028	59.633	3	3726.8224	3726.8224	T	R	204	246
PSM	MAPSVPAAEPEYPKGI	1274	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=20561	78.457	2	1697.8335	1697.8335	-	R	1	17
PSM	MDHYDSQQTNDYMQPEEDWD	1275	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=19537	74.969	3	2603.9329	2603.9329	-	R	1	21
PSM	MDQCVTVERELE	1276	sp|Q9H871-2|RMD5A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=15853	62.598	2	1565.6702	1565.6702	-	K	1	13
PSM	MDRSGFGEISSPVI	1277	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21946	83.469	2	1551.7239	1551.7239	-	R	1	15
PSM	MDVGELLSYQPNRGT	1278	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22979	87.285	2	1736.8039	1736.8040	-	K	1	16
PSM	MEATTAGVGRLEEEAL	1279	sp|Q8WUD4|CCD12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21451	81.668	2	1733.8142	1733.8142	-	R	1	17
PSM	MECPHLSSSVCIAPDSA	1280	sp|Q9Y6I4-2|UBP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=16480	64.812	2	1917.7907	1917.7907	-	K	1	18
PSM	MEEEQDLPEQPVK	1281	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=14825	58.908	2	1612.7291	1612.7291	-	K	1	14
PSM	MEEISLANLDTN	1282	sp|Q96GX2|A7L3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=29205	112.15	2	1390.6286	1390.6286	-	K	1	13
PSM	MEERGDSEPTPGCSGLGPGGV	1283	sp|Q8WW01-2|SEN15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=13820	55.329	2	2145.8943	2145.8943	-	R	1	22
PSM	MEESVNQMQPLNE	1284	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16513	64.935	2	1605.6651	1605.6651	-	K	1	14
PSM	MEGGLADGEPDRTSLLGDS	1285	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=22153	84.264	2	1960.8684	1960.8684	-	K	1	20
PSM	MEGSGEQPGPQPQHPGDH	1286	sp|Q9UJA5-3|TRM6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5434	22.98	3	1941.7912	1941.7912	-	R	1	19
PSM	MEPAVSEPMRDQVA	1287	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=16344	64.339	2	1600.7225	1600.7225	-	R	1	15
PSM	MERPQPDSMPQDLSEAL	1288	sp|P09601|HMOX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22118	84.13	2	2000.8819	2000.8819	-	K	1	18
PSM	MEVLAAETTSQQE	1289	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16767	65.839	2	1493.6556	1493.6556	-	R	1	14
PSM	MEWGSESAAVR	1290	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=16938	66.419	2	1263.5554	1263.5554	-	R	1	12
PSM	MLGPEGGEGFVV	1291	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26172	100.21	2	1248.5696	1248.5696	M	K	2	14
PSM	MLGPEGGEGFVVKL	1292	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25495	97.389	2	1489.7487	1489.7487	M	R	2	16
PSM	MLGTEGGEGFVVKV	1293	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=25806	98.691	2	1463.733	1463.7330	M	R	2	16
PSM	MMCGAPSATQPATAETQHIADQV	1294	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=16635	65.359	3	2488.0669	2488.0669	-	R	1	24
PSM	MMCGAPSATQPATAETQHIADQV	1295	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=18616	71.946	3	2472.0719	2472.0719	-	R	1	24
PSM	MNGDQNSDVYAQE	1296	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9420	39.038	2	1527.5784	1527.5784	-	K	1	14
PSM	MNSNVENLPPHII	1297	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19365	74.501	2	1534.745	1534.7450	-	R	1	14
PSM	MNSNVENLPPHII	1298	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20510	78.273	2	1534.745	1534.7450	-	R	1	14
PSM	MNSVGEACTDMK	1299	sp|O43715|TRIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8421	35.091	2	1399.5418	1399.5418	-	R	1	13
PSM	MNYMPGTASLIEDIDK	1300	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26948	103.43	2	1854.838	1854.8380	-	K	1	17
PSM	MQNSHSGVNQLGGVFVNG	1301	sp|P26367|PAX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18677	72.151	2	1901.869	1901.8690	-	R	1	19
PSM	MQSDDVIWDTLGN	1302	sp|Q9BXY0|MAK16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28929	111.13	2	1550.6559	1550.6559	-	K	1	14
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	1303	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14770	58.706	3	2832.4182	2832.4182	M	K	2	30
PSM	PAIMTMLADHAA	1304	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18890	72.893	2	1240.5944	1240.5944	M	R	2	14
PSM	PAVSLPPKENALF	1305	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=20031	76.62	2	1381.7606	1381.7606	M	K	2	15
PSM	PEPAKSAPAP	1306	sp|Q16778|H2B2E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4331	18.424	2	963.50255	963.5025	M	K	2	12
PSM	PGETEEPRPPEQQDQEGGEAA	1307	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7077	29.682	3	2249.9673	2249.9673	M	K	2	23
PSM	PGGLLLGDVAPNFEANTTVG	1308	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=26490	101.53	2	1940.9844	1940.9844	M	R	2	22
PSM	PGIVELPTLEEL	1309	sp|P51970|NDUA8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=28843	110.83	2	1308.7177	1308.7177	M	K	2	14
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1310	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=20972	79.948	4	3845.8847	3845.8847	E	R	354	390
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1311	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=21397	81.481	3	3845.8847	3845.8847	E	R	354	390
PSM	RTAPTSTIAPGVVMASSPALPTQPAEEAA	1312	sp|P16220|CREB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35	ms_run[2]:scan=16444	64.701	3	2836.4277	2836.4277	I	R	241	270
PSM	RTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEA	1313	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=26510	101.61	4	4310.9496	4310.9496	E	R	305	347
PSM	RTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEA	1314	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=26519	101.65	4	4310.9496	4310.9496	E	R	305	347
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	1315	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=20021	76.587	3	2849.4244	2849.4244	P	R	634	661
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSN	1316	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=17743	69.052	3	2523.2241	2523.2241	M	R	2	30
PSM	SCGNEFVETLK	1317	sp|Q68CZ6-2|HAUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=17023	66.705	2	1324.5969	1324.5969	M	K	2	13
PSM	SCINLPTVLPGSPSKT	1318	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=22474	85.465	2	1711.8815	1711.8815	M	R	2	18
PSM	SCINLPTVLPGSPSKT	1319	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=22613	85.977	2	1711.8815	1711.8815	M	R	2	18
PSM	SDNGELEDKPPAPPV	1320	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=14552	57.912	2	1605.7522	1605.7522	M	R	2	17
PSM	SDTLTADVIGR	1321	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=17937	69.688	2	1188.5986	1188.5986	M	R	2	13
PSM	SEGDSVGESVHG	1322	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7053	29.586	2	1200.4895	1200.4895	M	K	2	14
PSM	SENLDKSNVNEAG	1323	sp|Q9NUJ3|T11L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=7554	31.612	2	1417.6321	1417.6321	M	K	2	15
PSM	SETAPAAPAAAPPAEKAPV	1324	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=12212	49.352	3	1786.9101	1786.9101	M	K	2	21
PSM	SGALDVLQMKEEDVL	1325	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=26125	100.03	2	1703.8288	1703.8288	M	K	2	17
PSM	SGDGATEQAAEYVPE	1326	sp|Q12996-3|CSTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=16941	66.428	2	1564.6529	1564.6529	M	K	2	17
PSM	SGDHLHNDSQIEADF	1327	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=14561	57.942	2	1725.7231	1725.7231	M	R	2	17
PSM	SGELPPNINIKEP	1328	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=19307	74.318	2	1448.7511	1448.7511	M	R	2	15
PSM	SGSSSVAAMK	1329	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=4106	17.407	2	981.44371	981.4437	M	K	2	12
PSM	SGSSSVAAMK	1330	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=4107	17.412	1	981.44371	981.4437	M	K	2	12
PSM	SLVIPEKFQHIL	1331	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=25679	98.168	2	1464.8341	1464.8341	M	R	2	14
PSM	SNNGLDIQDKPPAPPM	1332	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=17949	69.717	2	1734.8247	1734.8247	M	R	2	18
PSM	SSEAETQQPPAAPPAAPALSAADT	1333	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=18223	70.665	3	2319.0866	2319.0866	M	K	2	26
PSM	SSGIHVALVTGGN	1334	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=16722	65.682	2	1252.6412	1252.6412	M	K	2	15
PSM	STATTVAPAGIPATPGPVNPPPPEVSNPSKPG	1335	sp|Q15059-2|BRD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=19091	73.581	3	3046.5611	3046.5611	M	R	2	34
PSM	SVELEEALPVTTAEGMA	1336	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:35	ms_run[2]:scan=20439	78.026	2	1761.8342	1761.8342	M	K	2	19
PSM	SVELEEALPVTTAEGMA	1337	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=27092	104.03	2	1803.8448	1803.8448	M	K	2	19
PSM	SYGRPPPDVEGMTSL	1338	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15292	60.617	2	1662.7559	1662.7559	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1339	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15425	61.085	2	1662.7559	1662.7559	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1340	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15557	61.558	2	1662.7559	1662.7559	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1341	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15687	62.021	2	1662.7559	1662.7559	M	K	2	17
PSM	TENSTSAPAAKP	1342	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:1	ms_run[2]:scan=5369	22.725	2	1214.5779	1214.5779	M	K	2	14
PSM	VFFTCNACGESVK	1343	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=11948	48.371	2	1517.6643	1517.6643	M	K	2	15
PSM	DDDIAALVVDNGSGMC	1344	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27498	105.64779885306666	2	1709.6842	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1345	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27607	106.1018226288	2	1709.6842	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1346	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30233	116.02607163973333	2	1693.6912	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1347	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31842	122.08079051333334	2	1693.6912	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1348	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31612	121.17862822986667	2	1694.6932	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1349	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31774	121.82852553813333	2	1693.6912	1692.6962	M	K	2	18
PSM	DDIAALVVDNGSGMC	1350	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,14-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=28367	109.02437434613333	2	1593.6743	1593.6645	D	K	3	18
PSM	EEEIAALVIDNGSGMC	1351	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31854	122.12692544773333	2	1765.7482	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1352	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32325	123.86928381679999	2	1749.7752	1748.7592	M	K	2	18
PSM	PSVPAAEPEYPKGI	1353	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26		ms_run[1]:scan=13358	53.6553788856	2	1453.7532	1453.7448	A	R	3	17
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1354	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17147	67.126741988	3	3505.596958	3505.576600	T	-	609	647
PSM	ASQSQGIQQLLQAEK	1355	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=22528	85.6547373976	2	1670.8572	1669.8632	M	R	2	17
PSM	ASQSQGIQQLLQAEK	1356	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=22396	85.16756368986667	2	1670.8602	1669.8632	M	R	2	17
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	1357	sp|Q99873-3|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=25868	98.95060760346668	3	3199.3232	3199.3042	M	K	2	32
PSM	KPYFLTDGTGTVTPANASGINDGAAAVVLM	1358	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	30-UNIMOD:35	ms_run[1]:scan=23560	89.5380632544	3	2966.486193	2966.469539	L	K	235	265
PSM	MELLGEYVGQEGKPQ	1359	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22319	84.9041864008	2	1734.824187	1734.813453	-	K	1	16
PSM	SDAAVDTSSEITTKDL	1360	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=19789	75.8177458224	2	1694.8072	1693.7892	M	K	2	18
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	1361	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=20676	78.84859055733334	4	3482.709848	3482.688399	N	R	398	434
PSM	SFDPNLLHNNGHNGYPNGTSAAL	1362	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=21688	82.562470312	3	2452.1202	2451.1202	M	R	2	25
PSM	SGGGVIRGPAGNNDC	1363	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=9157	37.9617691824	2	1472.6402	1471.6472	M	R	2	17
PSM	SGGGVIRGPAGNNDC	1364	sp|Q07955|SRSF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=9512	39.40376109413333	2	1472.6412	1471.6472	M	R	2	17
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1365	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20085	76.8275426752	3	3214.426802	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1366	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19196	73.93105116133333	3	3231.425693	3230.402859	Q	R	630	663
PSM	SGNGNAAATAEENSPKM	1367	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=7507	31.426405844533335	2	1706.7172	1705.7212	M	R	2	19
PSM	AISSSSCELPLVAVCQVTSTPDKQQNF	1368	sp|Q86X76-2|NIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,7-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=28182	108.28486514426666	3	3007.4442	3007.4262	M	K	2	29
PSM	KMLLDPMGGIVMTNDGNAIL	1369	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35,7-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=20050	76.6935581936	3	2150.051758	2150.042149	M	R	48	68
PSM	MESKEELAANNLNGENAQQENEGGEQAPTQNEEES	1370	sp|Q9NWD9|BEX4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12979	52.206897574133336	3	3875.635588	3875.614772	-	R	1	36
PSM	SNTTVVPSTAGPGPSGGPGGGGGGGGGGGGTEVIQVTNVSPSASSEQM	1371	sp|Q05519|SRS11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=22744	86.4167090576	4	4195.9482	4195.9192	M	R	2	50
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	1372	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=24005	91.298859252	3	3364.3232	3362.2662	M	K	2	31
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	1373	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,7-UNIMOD:35,20-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=25303	96.65755553226667	3	2945.3162	2945.2992	M	R	2	33
PSM	MKAQGETEESEKLS	1374	sp|Q15648|MED1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:1	ms_run[1]:scan=7906	32.968063563466664	2	1607.739666	1607.734867	-	K	1	15
PSM	MVFFTCNACGESVK	1375	sp|Q9NX58|LYAR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:35,6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=12824	51.6149289072	2	1664.710283	1664.699685	-	K	1	15
PSM	AAAAAAAAAAGAAGG	1376	sp|Q86U42-2|PABP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=20461	78.111	2	1083.5309	1083.5309	M	R	2	17
PSM	AAAAPVAADDDER	1377	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7841	32.684	2	1312.5895	1312.5895	M	R	2	15
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	1378	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=22241	84.611	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAGAAATHLEVA	1379	sp|Q96S52|PIGS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8045	33.555	2	1151.5935	1151.5935	M	R	2	15
PSM	AAAGGGGGGAAAAG	1380	sp|Q9UL25|RAB21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=4619	19.636	2	956.43117	956.4312	M	R	2	16
PSM	AAAVAAAGAGEPQSPDELLP	1381	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=27250	104.64	2	1875.9214	1875.9214	M	K	2	22
PSM	AAESGSDFQQR	1382	sp|Q96BP3|PPWD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7451	31.198	2	1236.5371	1236.5371	M	R	2	13
PSM	AAGTAAALAFLSQES	1383	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=32749	125.3	2	1448.7147	1448.7147	M	R	2	17
PSM	AALTRDPQFQ	1384	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=14541	57.876	2	1187.5935	1187.5935	M	K	2	12
PSM	AASEAAVVSSPSL	1385	sp|Q8WWH5|TRUB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=19691	75.472	2	1229.6139	1229.6139	M	K	2	15
PSM	AAVPELLQQQEEDRS	1386	sp|Q9Y5X3-2|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21787	82.926	2	1753.8483	1753.8483	M	K	2	17
PSM	ADAEVIILPK	1387	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=20703	78.951	2	1109.6332	1109.6332	M	K	2	12
PSM	ADDAGAAGGPGGPGGPGMGN	1388	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=8779	36.524	2	1639.6533	1639.6533	M	R	2	22
PSM	ADDIDIEAMLEAPYK	1389	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=24942	95.173	2	1750.7971	1750.7971	M	K	2	17
PSM	ADEAALALQPGGSPSAAGAD	1390	sp|Q96EB6-2|SIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21478	81.774	2	1809.8381	1809.8381	M	R	2	22
PSM	ADEEKLPPGWE	1391	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17319	67.71	2	1311.5983	1311.5983	M	K	2	13
PSM	ADEEKLPPGWE	1392	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17513	68.353	2	1311.5983	1311.5983	M	K	2	13
PSM	ADEEKLPPGWE	1393	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17715	68.969	2	1311.5983	1311.5983	M	K	2	13
PSM	ADEEKLPPGWE	1394	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17829	69.311	2	1311.5983	1311.5983	M	K	2	13
PSM	ADKEAAFDDAVEE	1395	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=14620	58.149	2	1450.61	1450.6100	M	R	2	15
PSM	ADKMDMSLDDII	1396	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=21063	80.269	2	1439.616	1439.6160	M	K	2	14
PSM	ADKMDMSLDDII	1397	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=25290	96.615	2	1423.6211	1423.6211	M	K	2	14
PSM	ADKPDMGEIASFD	1398	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=14898	59.163	2	1452.6079	1452.6079	M	K	2	15
PSM	ADKPDMGEIASFD	1399	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=15030	59.64	2	1452.6079	1452.6079	M	K	2	15
PSM	ADTTPNGPQGAGAVQFMMTN	1400	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,18-UNIMOD:35	ms_run[2]:scan=21352	81.321	2	2064.8881	2064.8881	M	K	2	22
PSM	AEAGPQAPPPPGTPSRHE	1401	sp|Q16254|E2F4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7892	32.907	2	1836.8755	1836.8755	M	K	2	20
PSM	AEAMDLGKDPNGPTHSSTLFV	1402	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=18129	70.309	3	2244.0369	2244.0369	M	R	2	23
PSM	AEGSAVSDPQHAA	1403	sp|Q9H2C0|GAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7056	29.596	2	1280.5633	1280.5633	M	R	2	15
PSM	AEKFDCHYC	1404	sp|Q13642-3|FHL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=9605	39.764	2	1270.4747	1270.4747	M	R	2	11
PSM	AENGDNEKMAALEA	1405	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=8651	36.007	2	1519.6461	1519.6461	M	K	2	16
PSM	AEPASVAAESLAGS	1406	sp|Q9NQT5-2|EXOS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21085	80.347	2	1300.6147	1300.6147	M	R	2	16
PSM	AEPSGAETRPPI	1407	sp|Q9NRR5-2|UBQL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=11859	48.046	2	1265.6252	1265.6252	M	R	2	14
PSM	AERGGDGGESE	1408	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=3922	16.553	2	1104.432	1104.4320	M	R	2	13
PSM	AETAAGVGRF	1409	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=13687	54.85	2	1019.5036	1019.5036	M	K	2	12
PSM	AETEERSLDNFFA	1410	sp|Q9UKY7|CDV3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=25295	96.628	2	1569.6947	1569.6947	M	K	2	15
PSM	AFAETYPAASSLPNGDCG	1411	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,17-UNIMOD:4	ms_run[2]:scan=23609	89.734	2	1868.7887	1868.7887	M	R	2	20
PSM	AFLASGPYLTHQQ	1412	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=23891	90.827	2	1473.7252	1473.7252	M	K	2	15
PSM	AGGEAGVTLGQPHLS	1413	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=15974	63.035	2	1434.7103	1434.7103	M	R	2	17
PSM	AGLELLSDQGY	1414	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=30424	116.74	2	1206.5768	1206.5768	M	R	2	13
PSM	AGLELLSDQGY	1415	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=30540	117.17	2	1206.5768	1206.5768	M	R	2	13
PSM	AGQDPALSTSHPFYDVA	1416	sp|P85298-2|RHG08_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21729	82.727	2	1816.8268	1816.8268	M	R	2	19
PSM	AKQYDSVECPFCDEVS	1417	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=18521	71.622	2	1974.7975	1974.7975	M	K	2	18
PSM	AKYGEHEASPDNGQNEFSDII	1418	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=19228	74.037	3	2362.0349	2362.0349	M	K	2	23
PSM	ALHVPKAPGFAQML	1419	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=19947	76.334	2	1536.8123	1536.8123	M	K	2	16
PSM	ALTSFLPAPTQLSQDQLEAEEKA	1420	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=30074	115.43	3	2528.2646	2528.2646	M	R	2	25
PSM	AMESTATAAVAAELVSADKIEDVPAPSTSAD	1421	sp|P49321-4|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=28852	110.86	3	3075.4442	3075.4442	M	K	2	33
PSM	AMTGSTPCSSMSNHT	1422	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7220	30.274	2	1625.612	1625.6120	M	K	2	17
PSM	APAMQPAEIQFAQ	1423	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=13586	54.502	2	1416.6708	1416.6708	M	R	2	15
PSM	APAMQPAEIQFAQ	1424	sp|Q14684-2|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16972	66.534	2	1400.6758	1400.6758	M	R	2	15
PSM	APSVPAAEPEYPKGI	1425	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13646	54.722	2	1524.7824	1524.7824	M	R	2	17
PSM	AQDQGEKENPM	1426	sp|P62913|RL11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6869	28.79	2	1287.5401	1287.5401	M	R	2	13
PSM	ASAELQGKYQ	1427	sp|Q6ZMI0-4|PPR21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=9981	41.11	2	1135.551	1135.5510	M	K	2	12
PSM	ASPDDPLRADHMV	1428	sp|Q8WWZ3-2|EDAD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=11788	47.761	2	1480.6616	1480.6616	M	K	2	15
PSM	ASPSRQPPPGGSGLLQGS	1429	sp|Q96S90|LYSM1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=12644	50.964	2	1733.8697	1733.8697	M	R	2	20
PSM	ASSDIQVKELE	1430	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=14860	59.021	2	1259.6245	1259.6245	M	K	2	13
PSM	ASVSSATFSGHGA	1431	sp|Q7Z4H3-3|HDDC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=11916	48.269	2	1219.5469	1219.5469	M	R	2	15
PSM	ATAEVLNIGK	1432	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17003	66.633	2	1056.5815	1056.5815	M	K	2	12
PSM	ATAEVLNIGK	1433	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17133	67.085	2	1056.5815	1056.5815	M	K	2	12
PSM	ATDELATKLS	1434	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=14758	58.669	2	1089.5554	1089.5554	M	R	2	12
PSM	ATTGTPTADRGDAAATDDPAA	1435	sp|Q86TI2-4|DPP9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=9265	38.393	2	1986.8767	1986.8767	M	R	2	23
PSM	ATVQQLEGRW	1436	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21576	82.134	2	1228.62	1228.6200	M	R	2	12
PSM	AVEELQSIIK	1437	sp|Q92990-2|GLMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=26377	101.05	2	1170.6496	1170.6496	M	R	2	12
PSM	AYHSFLVEPISCHAWN	1438	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=24031	91.428	2	1971.8938	1971.8938	M	K	2	18
PSM	CNTPTYCDLGKAA	1439	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=13785	55.202	2	1511.6385	1511.6385	M	K	2	15
PSM	CSLGLFPPPPP	1440	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=29065	111.64	2	1222.6056	1222.6056	M	R	2	13
PSM	DDDIAALVVDNGSGMC	1441	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=22949	87.172	2	1666.6815	1666.6815	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1442	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31917	122.36	2	1708.692	1708.6920	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1443	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31323	120.03	2	1764.7546	1764.7546	M	K	2	18
PSM	GDAKEAGAEGPPAGAAA	1444	sp|Q3B7T1-4|EDRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=7151	30.001	2	1480.6794	1480.6794	M	R	2	19
PSM	GTTAPGPIHLLELCDQ	1445	sp|Q9NQS7-2|INCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=26408	101.17	2	1762.856	1762.8560	M	K	2	18
PSM	KATLVESSTSGFTPGGGGSSVSMIAS	1446	sp|P49321-4|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	23-UNIMOD:35	ms_run[2]:scan=15283	60.581	3	2430.1584	2430.1584	L	R	607	633
PSM	KEVYEGEVTELTPCETENPMGGYG	1447	sp|Q9Y265-2|RUVB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=16420	64.614	3	2704.152	2704.1520	T	K	128	152
PSM	KMLLDPMGGIVMTNDGNAIL	1448	sp|P49368|TCPG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=20039	76.654	3	2150.0421	2150.0421	M	R	48	68
PSM	KPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQV	1449	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=23620	89.777	3	3492.7565	3492.7565	L	K	137	173
PSM	KTPSTMENDSSNLDPSQAPSLAQPLVFSNS	1450	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=20859	79.535	3	3177.4772	3177.4772	G	K	283	313
PSM	MDDKGDPSNEEAP	1451	sp|Q9BTC0-2|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5813	24.567	2	1461.5566	1461.5566	-	K	1	14
PSM	MDDKGDPSNEEAP	1452	sp|Q9BTC0-2|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=8657	36.032	2	1445.5617	1445.5617	-	K	1	14
PSM	MDEQALLGLNPNADSDF	1453	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=32400	124.13	2	1890.8306	1890.8306	-	R	1	18
PSM	MDGIVPDIAVGTK	1454	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19949	76.338	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	1455	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20210	77.266	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	1456	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20389	77.864	2	1372.6908	1372.6908	-	R	1	14
PSM	MDNSGKEAEAMALLAEAE	1457	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26180	100.24	2	1936.8394	1936.8394	-	R	1	19
PSM	MDSGGGSLGLHTPDS	1458	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=16693	65.574	2	1471.6249	1471.6249	-	R	1	16
PSM	MDVERLQEAL	1459	sp|Q9NY27-2|PP4R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20652	78.774	2	1260.602	1260.6020	-	K	1	11
PSM	MDYLTTFTEKSG	1460	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22349	85.008	2	1449.6334	1449.6334	-	R	1	13
PSM	MDYLTTFTEKSG	1461	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=27548	105.86	2	1433.6384	1433.6384	-	R	1	13
PSM	MEANGLGPQGFPEL	1462	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27777	106.76	2	1516.6868	1516.6868	-	K	1	15
PSM	MEESVNQMQPLNE	1463	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21401	81.494	2	1589.6702	1589.6702	-	K	1	14
PSM	MEFPDLGAHCSEPSCQ	1464	sp|Q8WV99-2|ZFN2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=17097	66.954	2	1921.7281	1921.7281	-	R	1	17
PSM	MEGGFGSDFGGSGSG	1465	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18322	70.97	2	1405.5092	1405.5092	-	K	1	16
PSM	MEGGPAVCCQDPRAELVE	1466	sp|Q8N5S9|KKCC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=16034	63.256	2	2074.8758	2074.8758	-	R	1	19
PSM	MELIQDTSRPPLEYV	1467	sp|P50225|ST1A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26371	101.02	2	1847.8975	1847.8975	-	K	1	16
PSM	MEMTEMTGVSLK	1468	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=13386	53.753	2	1429.6139	1429.6139	-	R	1	13
PSM	MENGAVYSPTTEEDPGPA	1469	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15052	59.718	2	1921.7888	1921.7888	-	R	1	19
PSM	MENMAEEELLPLE	1470	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=30030	115.25	2	1604.695	1604.6950	-	K	1	14
PSM	MEPAVGGPGPLIVNN	1471	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20882	79.622	2	1521.7497	1521.7497	-	K	1	16
PSM	MEPPGGSLGPGRGT	1472	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=13305	53.443	2	1353.6347	1353.6347	-	R	1	15
PSM	MEQPGAAASGAGGGSEEPGGG	1473	sp|O60879-2|DIAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8231	34.346	2	1830.7326	1830.7326	-	R	1	22
PSM	MESYHKPDQQ	1474	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=6534	27.431	2	1303.5503	1303.5503	-	K	1	11
PSM	METEQPEETFPNTETNGEFGK	1475	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=19469	74.779	3	2456.0326	2456.0326	-	R	1	22
PSM	METPGASASSLLLPAAS	1476	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=28473	109.45	2	1643.8076	1643.8076	-	R	1	18
PSM	MEVDAPGVDGRDGL	1477	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=20113	76.928	2	1471.6613	1471.6613	-	R	1	15
PSM	MEWGSESAAVR	1478	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12360	49.919	2	1279.5503	1279.5503	-	R	1	12
PSM	MFQAAGAAQATPSHDAKGGGSSTVQ	1479	sp|Q9BT23|LIMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=12919	51.976	3	2416.1077	2416.1077	-	R	1	26
PSM	MLAAGVGGQGE	1480	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12453	50.262	2	1046.4703	1046.4703	-	R	1	12
PSM	MLGPEGGEGFVV	1481	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26066	99.778	2	1248.5696	1248.5696	M	K	2	14
PSM	MMCGAPSATQPATAETQHIADQV	1482	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=18474	71.472	3	2472.0719	2472.0719	-	R	1	24
PSM	MMLGTEGGEGFVV	1483	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24452	93.146	2	1399.6	1399.6000	-	K	1	14
PSM	MMLGTEGGEGFVVKV	1484	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=21579	82.145	2	1626.7633	1626.7633	-	R	1	16
PSM	MNAGSDPVVIVSAA	1485	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20616	78.64	2	1387.6653	1387.6653	-	R	1	15
PSM	MNFSGGGRQEAAGS	1486	sp|Q86TN4-3|TRPT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6728	28.241	2	1425.5943	1425.5943	-	R	1	15
PSM	MNGTLDHPDQPDLDAI	1487	sp|Q92879-2|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=22737	86.391	2	1792.7938	1792.7938	-	K	1	17
PSM	MNLLPNIESPVT	1488	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27392	105.21	2	1384.6908	1384.6908	-	R	1	13
PSM	MNSNVENLPPHII	1489	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19089	73.573	2	1534.745	1534.7450	-	R	1	14
PSM	MNSNVENLPPHII	1490	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=22519	85.627	2	1518.7501	1518.7501	-	R	1	14
PSM	MNVGVAHSEVNPNT	1491	sp|Q9P0S3|ORML1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8965	37.249	2	1525.6831	1525.6831	-	R	1	15
PSM	MNVTSLFSFTSPAVK	1492	sp|Q15797|SMAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27772	106.74	2	1685.8335	1685.8335	-	R	1	16
PSM	MPPYTVVYFPVRG	1493	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35	ms_run[2]:scan=19650	75.341	2	1540.7748	1540.7748	-	R	1	14
PSM	MQSPAVLVTSR	1494	sp|Q53T59|H1BP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13051	52.484	2	1245.6387	1245.6387	-	R	1	12
PSM	MTELQSALLLR	1495	sp|P62253|UB2G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24062	91.558	2	1331.7119	1331.7119	-	R	1	12
PSM	PAVSLPPKENALF	1496	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19736	75.624	2	1381.7606	1381.7606	M	K	2	15
PSM	PDPAKSAPAP	1497	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4756	20.181	2	949.4869	949.4869	M	K	2	12
PSM	PDPAKSAPAP	1498	sp|Q93079|H2B1H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4860	20.608	2	949.4869	949.4869	M	K	2	12
PSM	PEPAKSAPAP	1499	sp|Q16778|H2B2E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4439	18.882	2	963.50255	963.5025	M	K	2	12
PSM	PGPTQTLSPNGENNNDIIQDNNGTIIPF	1500	sp|Q15555-2|MARE2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=26364	100.99	3	2979.421	2979.4210	M	R	2	30
PSM	PQLNGGGGDDLGANDELISF	1501	sp|Q9NQB0-14|TF7L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=25070	95.719	2	1987.9123	1987.9123	M	K	2	22
PSM	RAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQ	1502	sp|Q7Z7K6-3|CENPV_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=25635	97.975	4	4345.1754	4345.1754	P	R	69	112
PSM	RPAPVAQPPAAAPPSAVGSSAAAP	1503	sp|Q9Y6H1|CHCH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10975	44.988	3	2137.128	2137.1280	P	R	27	51
PSM	RVLAPASTLQSSYQIPTENSMTA	1504	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	21-UNIMOD:35	ms_run[2]:scan=16309	64.219	3	2480.2217	2480.2217	E	R	1049	1072
PSM	SAEVPEAASAEEQ	1505	sp|P56211|ARP19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=12355	49.903	2	1358.5838	1358.5838	M	K	2	15
PSM	SANEDQEMELEAL	1506	sp|Q6NW29|RWDD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=21634	82.349	2	1535.6297	1535.6297	M	R	2	15
PSM	SAQSVEEDSILIIPTPDEEE	1507	sp|P17028-2|ZNF24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=30867	118.34	2	2242.0376	2242.0376	M	K	2	22
PSM	SDEFSLADALPEHSPA	1508	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=24626	93.859	2	1726.7686	1726.7686	M	K	2	18
PSM	SEETVPEAASPPPPQGQPYFD	1509	sp|P35612-7|ADDB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=22045	83.837	2	2284.0172	2284.0172	M	R	2	23
PSM	SEHVEPAAPGPGPNGGGGGPAPA	1510	sp|Q4ZIN3-2|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=10424	42.865	3	2020.9239	2020.9239	M	R	2	25
PSM	SEREVSTAPAGTDMPAA	1511	sp|O75530-3|EED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=12210	49.341	2	1730.7781	1730.7781	M	K	2	19
PSM	SESGHSQPGLYGIE	1512	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=14859	59.019	2	1501.6685	1501.6685	M	R	2	16
PSM	SGELPPNINIKEP	1513	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=19761	75.718	2	1448.7511	1448.7511	M	R	2	15
PSM	SQGDSNPAAIPHAAEDIQGDD	1514	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=15727	62.147	2	2148.9196	2148.9196	M	R	2	23
PSM	SSDASQGVITTPPPPSMPH	1515	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=17052	66.792	2	1946.9044	1946.9044	M	K	2	21
PSM	SSDASQGVITTPPPPSMPHKE	1516	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=10394	42.738	3	2220.0369	2220.0369	M	R	2	23
PSM	SSEPPPPYPGGPTAPLLEE	1517	sp|Q9H305-3|CDIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=25269	96.528	2	1975.9415	1975.9415	M	K	2	21
PSM	SSFSYEPYYSTSYK	1518	sp|P07196|NFL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=19749	75.67	2	1749.741	1749.7410	M	R	2	16
PSM	SSLAVRDPAMD	1519	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=11420	46.499	2	1218.5551	1218.5551	M	R	2	13
PSM	SYGRPPPDVEGMTSL	1520	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15167	60.144	2	1662.7559	1662.7559	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1521	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=20430	77.991	2	1646.761	1646.7610	M	K	2	17
PSM	SYGRPPPDVEGMTSL	1522	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=21327	81.233	2	1646.761	1646.7610	M	K	2	17
PSM	TEADVNPKAYPLADAHLT	1523	sp|P55769|NH2L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=18389	71.189	2	1966.9636	1966.9636	M	K	2	20
PSM	TSKGPEEEHPSVTLF	1524	sp|Q03154-2|ACY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=16395	64.532	2	1698.8101	1698.8101	M	R	2	17
PSM	TTEVGSVSEVK	1525	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=10096	41.571	2	1176.5874	1176.5874	M	K	2	13
PSM	TTYLEFIQQNEERDGV	1526	sp|Q15436|SC23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=29035	111.53	2	1982.9222	1982.9222	M	R	2	18
PSM	TTYLEFIQQNEERDGV	1527	sp|Q15436|SC23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=29039	111.54	2	1982.9222	1982.9222	M	R	2	18
PSM	TTYLEFIQQNEERDGV	1528	sp|Q15436|SC23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=29044	111.56	2	1982.9222	1982.9222	M	R	2	18
PSM	TTYLEFIQQNEERDGV	1529	sp|Q15436|SC23A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:1	ms_run[2]:scan=29054	111.6	2	1982.9222	1982.9222	M	R	2	18
PSM	DDDIAALVVDNGSGMC	1530	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30505	117.0316143384	2	1693.6912	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1531	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=29551	113.4503569704	2	1692.6942	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1532	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30465	116.87909265066668	2	1693.6912	1692.6962	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1533	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32896	125.773840856	2	1765.7642	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1534	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=28678	110.219659504	2	1765.7342	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1535	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32312	123.83192574133334	2	1749.7752	1748.7592	M	K	2	18
PSM	PYQYPALTPEQK	1536	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=11252	45.954394921600006	2	1433.7270	1433.7186	M	K	2	14
PSM	AGVEEVAASGSHLNGDLDPDD	1537	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=21440	81.63122462453333	2	2108.9252	2108.9132	M	R	2	23
PSM	AGVEEVAASGSHLNGDLD	1538	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=19897	76.14407885493333	2	1781.8156	1781.8063	M	P	2	20
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1539	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17287	67.59966999093334	3	3505.596958	3505.576600	T	-	609	647
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	1540	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=23161	87.9901413056	3	3478.5922	3477.5802	M	K	2	33
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	1541	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=23094	87.74130195893333	3	3478.5922	3477.5802	M	K	2	33
PSM	KGIPLATGDTSPEPELLPGAPLPPP	1542	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=23324	88.62641780586667	2	2464.345780	2463.326092	L	K	32	57
PSM	SNGYEDHMAEDCRGDIG	1543	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=11971	48.46107256453333	2	1967.7362	1966.7412	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	1544	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=9097	37.7164104888	2	1983.7352	1982.7362	M	R	2	19
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPP	1545	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=28839	110.81681958693333	3	3296.4222	3296.4002	M	K	2	31
PSM	AAPEEHDSPTEASQPIVEEEETKTF	1546	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=17678	68.86457929786667	3	2812.2742	2812.2562	M	K	2	27
PSM	ADDLDFETGDAGASATFPMQCSAL	1547	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=28864	110.90860024293333	3	2547.0562	2547.0412	M	R	2	26
PSM	ADPDVLTEVPAAL	1548	sp|P29083|T2EA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=30781	118.03002802853332	2	1351.6955	1351.6866	M	K	2	15
PSM	METPGASASSLLLPAASRPP	1549	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22451	85.38211423813333	3	2010.020977	2010.009192	-	R	1	21
PSM	MEDLDQSPLVSSSDSPPRPQPAF	1550	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1	ms_run[1]:scan=26272	100.60049776160001	3	2541.186452	2541.169334	-	K	1	24
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	1551	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=20701	78.94452943066668	3	3482.709709	3482.688399	N	R	398	434
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1552	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17987	69.84197631866667	3	3230.423081	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1553	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18026	69.96006505226666	3	3230.423081	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1554	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18772	72.47170553626667	3	3231.425693	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1555	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17440	68.102251492	4	3230.422928	3230.402859	Q	R	630	663
PSM	SGNGNAAATAEENSPKM	1556	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=8353	34.822025265866664	2	1706.7152	1705.7212	M	R	2	19
PSM	ADEEKLPPGWE	1557	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=17468	68.19438218826666	2	1311.6057	1311.5978	M	K	2	13
PSM	MQNSHSGVNQLGGVFVNG	1558	sp|P26367|PAX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18579	71.82494752186668	2	1902.872742	1901.869010	-	R	1	19
PSM	MNVTSLFSFTSPAVK	1559	sp|Q15797|SMAD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=27756	106.6767017368	2	1686.845799	1685.833460	-	R	1	16
PSM	MDEAGSSASGGGFRPGVDSLDEPPNS	1560	sp|Q8IUH3|RBM45_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17185	67.25911388426667	2	2594.117771	2593.087455	-	R	1	27
PSM	AANLSRNGPALQEAYV	1561	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=18874	72.83499436293333	2	1715.8622	1714.8632	M	R	2	18
PSM	MEPETALWGPDLQGPEQSPNDAH	1562	sp|Q9UEG4|ZN629_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=24039	91.4622765928	3	2577.135853	2576.112548	-	R	1	24
PSM	PAVSLPPKENALF	1563	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25		ms_run[1]:scan=18845	72.7356054664	2	1381.7685	1381.7600	M	K	2	15
PSM	MDGEEQQPPHEANVEPVVPSEASEPVP	1564	sp|Q9H4I3|TRABD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18248	70.73145357866666	3	2955.323296	2955.308013	-	R	1	28
PSM	ALCNGDSKLENAGGDL	1565	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=18756	72.431987096	2	1675.7472	1674.7512	M	K	2	18
PSM	MKETIMNQEKLA	1566	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7947	33.135639648533335	2	1508.730979	1508.721467	-	K	1	13
PSM	KEGTLTQVPLAPPPPGAPPSPAPA	1567	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=16548	65.04496737413334	3	2290.255865	2289.236883	P	R	1128	1152
PSM	AAAAAAGEAR	1568	sp|P09417-2|DHPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6342	26.637	2	899.44609	899.4461	M	R	2	12
PSM	AAAAAGTATSQ	1569	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6650	27.918	2	960.45124	960.4512	M	R	2	13
PSM	AAAEAANCIMEVSCGQAESSE	1570	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=23869	90.743	3	2241.8824	2241.8824	M	K	2	23
PSM	AAAEAGGDDARCV	1571	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=8294	34.581	2	1303.5463	1303.5463	M	R	2	15
PSM	AAAEEEDGGPEGPN	1572	sp|Q99942|RNF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8735	36.349	2	1383.5426	1383.5426	M	R	2	16
PSM	AAAWGSSLTAATQ	1573	sp|Q86U28-2|ISCA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=23890	90.824	2	1275.6095	1275.6095	M	R	2	15
PSM	AAGTLYTYPENW	1574	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=28462	109.41	2	1426.6405	1426.6405	M	R	2	14
PSM	AALGEPVRLE	1575	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=17839	69.347	2	1095.5924	1095.5924	M	R	2	12
PSM	AALGEPVRLE	1576	sp|Q9NUP9|LIN7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=17979	69.825	2	1095.5924	1095.5924	M	R	2	12
PSM	AAQVAPAAASSLGNPPPPPPSELK	1577	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=18525	71.637	3	2308.2063	2308.2063	M	K	2	26
PSM	AASSLEQKLS	1578	sp|O14733|MP2K7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=14328	57.148	2	1074.5557	1074.5557	M	R	2	12
PSM	ADGGSERADG	1579	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=3869	16.304	2	975.38937	975.3894	M	R	2	12
PSM	ADGSLTGGGLEAAAMAPE	1580	sp|Q8NEM2|SHCBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24329	92.665	2	1658.7458	1658.7458	M	R	2	20
PSM	ADHSFSDGVPSDSVEAA	1581	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=15227	60.375	2	1731.7224	1731.7224	M	K	2	19
PSM	ADKEAAFDDAVEE	1582	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=14739	58.605	2	1450.61	1450.6100	M	R	2	15
PSM	ADKMDMSLDDII	1583	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=20932	79.806	2	1439.616	1439.6160	M	K	2	14
PSM	ADKMDMSLDDII	1584	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=21193	80.741	2	1439.616	1439.6160	M	K	2	14
PSM	ADKMDMSLDDII	1585	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=24970	95.293	2	1423.6211	1423.6211	M	K	2	14
PSM	ADKMDMSLDDII	1586	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=28279	108.67	2	1407.6262	1407.6262	M	K	2	14
PSM	ADKTPGGSQ	1587	sp|O15042-2|SR140_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=3917	16.53	2	901.41412	901.4141	M	K	2	11
PSM	ADLANEEKPAIAPPVFVFQ	1588	sp|Q9H6Z4-3|RANB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=29302	112.5	3	2097.0783	2097.0783	M	K	2	21
PSM	ADLEEQLSDEEKV	1589	sp|P47755-2|CAZA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=21630	82.335	2	1545.7046	1545.7046	M	R	2	15
PSM	ADRGCPLEAAPLPAEV	1590	sp|Q14689-3|DIP2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=21083	80.341	2	1706.8298	1706.8298	M	R	2	18
PSM	ADSELQLVEQ	1591	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=21911	83.353	2	1172.5561	1172.5561	M	R	2	12
PSM	AEAEGVPTTPGPASGSTF	1592	sp|Q86VR2|RETR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=20049	76.69	2	1716.7843	1716.7843	M	R	2	20
PSM	AEAEGVPTTPGPASGSTF	1593	sp|Q86VR2|RETR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=20178	77.156	2	1716.7843	1716.7843	M	R	2	20
PSM	AEAGPQAPPPPGTPSRHE	1594	sp|Q16254|E2F4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7905	32.963	3	1836.8755	1836.8755	M	K	2	20
PSM	AEEQPQVELFVKAGSDGA	1595	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=23418	88.994	3	1915.9163	1915.9163	M	K	2	20
PSM	AEGEDVPPLPTSSGDGWE	1596	sp|Q9NUY8-2|TBC23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=25081	95.77	2	1883.8061	1883.8061	M	K	2	20
PSM	AEGGAADLDTQ	1597	sp|Q9Y4E8-4|UBP15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=10461	43.032	2	1088.4622	1088.4622	M	R	2	13
PSM	AELQEVQITEEKPLLPGQTPEAA	1598	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24615	93.808	3	2532.2959	2532.2959	M	K	2	25
PSM	AENGDNEKMAALEA	1599	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=12851	51.72	2	1503.6511	1503.6511	M	K	2	16
PSM	AENGESSGPPRPS	1600	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5592	23.664	2	1325.5848	1325.5848	M	R	2	15
PSM	AENLLDGPPNPK	1601	sp|Q92793-2|CBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=16385	64.486	2	1305.6565	1305.6565	M	R	2	14
PSM	AESSESFTMASSPAQ	1602	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=17170	67.214	2	1570.6457	1570.6457	M	R	2	17
PSM	AETLEFNDVYQEVKGSMNDG	1603	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=26416	101.21	3	2302.99	2302.9900	M	R	2	22
PSM	AGGGAGDPGLGAAAAPAPET	1604	sp|Q13637|RAB32_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10849	44.507	2	1606.7587	1606.7587	M	R	2	22
PSM	AGITTIEAVK	1605	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=15851	62.593	2	1043.5863	1043.5863	M	R	2	12
PSM	AISSSSCELPLVAVCQVTSTPDKQQNF	1606	sp|Q86X76-2|NIT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28190	108.32	3	3007.4267	3007.4267	M	K	2	29
PSM	AKNGSEADIDEGLYS	1607	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=14146	56.457	2	1609.7108	1609.7108	M	R	2	17
PSM	ALSAETESHIY	1608	sp|O14569|C56D2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=16469	64.781	2	1261.5826	1261.5826	M	R	2	13
PSM	ALSMPLNGLKEED	1609	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=18325	70.977	2	1473.7021	1473.7021	M	K	2	15
PSM	ANEAYPCPCDIGH	1610	sp|Q96DG6|CMBL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=14477	57.646	2	1544.6024	1544.6024	M	R	2	15
PSM	ANMQGLVERLE	1611	sp|P40123-3|CAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24951	95.21	2	1300.6445	1300.6445	M	R	2	13
PSM	APSVPAAEPEYP	1612	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12992	52.258	2	1226.5819	1226.5819	M	K	2	14
PSM	APSVPAAEPEYP	1613	sp|P54819-3|KAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13110	52.722	2	1226.5819	1226.5819	M	K	2	14
PSM	AQETNHSQVPMLCSTGCGFYGNP	1614	sp|Q6FIF0-2|ZFAN6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=19235	74.063	2	2612.073	2612.0730	M	R	2	25
PSM	ARHVFLTGPPGVG	1615	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=14969	59.421	2	1348.7252	1348.7252	M	K	2	15
PSM	ASKEMFEDTVEE	1616	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=16602	65.249	2	1455.6075	1455.6075	M	R	2	14
PSM	ASQSQGIQQLLQAE	1617	sp|O95670-2|VATG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=26040	99.666	2	1541.7686	1541.7686	M	K	2	16
PSM	ASSAASSEHFE	1618	sp|Q9UEU0|VTI1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=8645	35.984	2	1163.4731	1163.4731	M	K	2	13
PSM	ASSAQSGGSSGGPAVPTVQ	1619	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=12731	51.286	2	1685.7857	1685.7857	M	R	2	21
PSM	ATQADLMELDMAMEPDR	1620	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=18721	72.309	3	2025.8329	2025.8329	M	K	2	19
PSM	ATQADLMELDMAMEPDR	1621	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=18861	72.795	3	2025.8329	2025.8329	M	K	2	19
PSM	ATQADLMELDMAMEPDR	1622	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=21103	80.412	3	2009.838	2009.8380	M	K	2	19
PSM	AVAAAAAAAGPAGAGGG	1623	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=16574	65.143	2	1251.6208	1251.6208	M	R	2	19
PSM	AVEELQSIIK	1624	sp|Q92990-2|GLMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=26271	100.6	2	1170.6496	1170.6496	M	R	2	12
PSM	AYHSFLVEPISCHAWN	1625	sp|O15143|ARC1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=24037	91.454	3	1971.8938	1971.8938	M	K	2	18
PSM	CQVGEDYGEPAPEEPPPAP	1626	sp|Q2VPK5-5|CTU2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=18425	71.3	2	2079.8732	2079.8732	M	R	2	21
PSM	CSLGLFPPPPP	1627	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=28829	110.78	2	1222.6056	1222.6056	M	R	2	13
PSM	DDDIAALVVDNGSGMC	1628	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31698	121.5	2	1708.692	1708.6920	M	K	2	18
PSM	GDDRPFVCNAPGCGQ	1629	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=12877	51.811	2	1690.6828	1690.6828	M	R	2	17
PSM	GEAEVGGGGAAGD	1630	sp|Q9NV56|MRGBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6904	28.948	2	1087.4418	1087.4418	M	K	2	15
PSM	GEAEVGGGGAAGD	1631	sp|Q9NV56|MRGBP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4364	18.568	2	1045.4312	1045.4312	M	K	2	15
PSM	GEKSENCGVPEDLLNGL	1632	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25168	96.131	2	1871.8571	1871.8571	M	K	2	19
PSM	KDPDSNPYSLLDTSEPEPPVDSEPGEPPPASA	1633	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=21626	82.321	3	3333.5049	3333.5049	L	R	512	544
PSM	KDVTPPPETEVVLI	1634	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18044	70.029	2	1535.8447	1535.8447	G	K	518	532
PSM	KGIPLATGDTSPEPELLPGAPLPPP	1635	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=23385	88.872	3	2463.3261	2463.3261	L	K	32	57
PSM	KIGNPVPYNEGLGQPQVAPPAPAASPAASS	1636	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16319	64.259	3	2884.4719	2884.4719	V	R	111	141
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	1637	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	24-UNIMOD:35	ms_run[2]:scan=20776	79.211	3	3534.5203	3534.5203	I	R	693	727
PSM	KLGLPPLTPEQQEALQ	1638	sp|Q9UHX1-6|PUF60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17899	69.556	2	1760.9672	1760.9672	A	K	24	40
PSM	KPFLLPVEAVYSVPG	1639	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=24477	93.245	2	1614.9021	1614.9021	E	R	256	271
PSM	KSYELPDGQVITIGNE	1640	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19758	75.706	2	1761.8785	1761.8785	E	R	938	954
PSM	KTPETVVPAAPELQPSTSTDQPVTPEPTS	1641	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16256	64.039	3	3003.4924	3003.4924	V	R	1261	1290
PSM	KTPETVVPAAPELQPSTSTDQPVTPEPTS	1642	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16269	64.077	3	3003.4924	3003.4924	V	R	1261	1290
PSM	MAPAEILNGKEISAQI	1643	sp|P11586|C1TC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=26565	101.86	2	1725.8971	1725.8971	-	R	1	17
PSM	MDEMATTQISKDELDEL	1644	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=24238	92.297	2	2025.8759	2025.8759	-	K	1	18
PSM	MDEQALLGLNPNADSDF	1645	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29519	113.33	2	1906.8255	1906.8255	-	R	1	18
PSM	MDGIVPDIAVGTK	1646	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=23993	91.252	2	1356.6959	1356.6959	-	R	1	14
PSM	MDGIVPDIAVGTK	1647	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24524	93.442	2	1356.6959	1356.6959	-	R	1	14
PSM	MDNSGKEAEAMALLAEAE	1648	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=21874	83.233	2	1952.8343	1952.8343	-	R	1	19
PSM	MDPNCSCSPVGSCACAGSC	1649	sp|P80297|MT1X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11092	45.422	2	2133.6989	2133.6989	-	K	1	20
PSM	MDRSGFGEISSPVI	1650	sp|P57740|NU107_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24676	94.075	2	1535.729	1535.7290	-	R	1	15
PSM	MDVGELLSYQPNRGT	1651	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=27464	105.52	2	1720.809	1720.8090	-	K	1	16
PSM	MEATGTDEVDKL	1652	sp|Q96DT6|ATG4C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13179	52.97	2	1365.597	1365.5970	-	K	1	13
PSM	MEATGTDEVDKL	1653	sp|Q96DT6|ATG4C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=17312	67.684	2	1349.6021	1349.6021	-	K	1	13
PSM	MEDMNEYSNIEEFAEGS	1654	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=25790	98.623	2	2067.7561	2067.7561	-	K	1	18
PSM	MEDMNEYSNIEEFAEGS	1655	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=25896	99.071	2	2067.7561	2067.7561	-	K	1	18
PSM	MEDMNEYSNIEEFAEGS	1656	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27887	107.21	2	2051.7612	2051.7612	-	K	1	18
PSM	MEELSADEIR	1657	sp|O95155-2|UBE4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=18859	72.787	2	1233.5547	1233.5547	-	R	1	11
PSM	MEESVNQMQPLNE	1658	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=11784	47.74	2	1621.66	1621.6600	-	K	1	14
PSM	MEEVPHDCPGADSAQAG	1659	sp|P53384-2|NUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=9168	38.009	2	1827.704	1827.7040	-	R	1	18
PSM	MEGGFGSDFGGSGSG	1660	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=23563	89.549	2	1389.5143	1389.5143	-	K	1	16
PSM	MENGAVYSPTTEEDPGPA	1661	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15037	59.66	2	1921.7888	1921.7888	-	R	1	19
PSM	MEPAVSEPMRDQVA	1662	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=10297	42.35	2	1632.7124	1632.7124	-	R	1	15
PSM	MEPAVSEPMRDQVA	1663	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13164	52.92	2	1616.7174	1616.7174	-	R	1	15
PSM	METGTAPLVAPP	1664	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17853	69.392	2	1240.6009	1240.6009	-	R	1	13
PSM	METPGASASSLLLPAAS	1665	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25090	95.812	2	1659.8026	1659.8026	-	R	1	18
PSM	MEVSPLQPVNENMQVN	1666	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17560	68.495	2	1901.8499	1901.8499	-	K	1	17
PSM	MEVSPLQPVNENMQVN	1667	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17707	68.947	2	1901.8499	1901.8499	-	K	1	17
PSM	MFHGIPATPGIGAPGN	1668	sp|Q9UK41|VPS28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19817	75.902	2	1593.761	1593.7610	-	K	1	17
PSM	MKLNISFPATGCQ	1669	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=19755	75.694	2	1523.7112	1523.7112	-	K	1	14
PSM	MLPSTSVNSLVQGNGVLNSRDAA	1670	sp|Q53HI1|UNC50_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23747	90.278	3	2387.1751	2387.1751	-	R	1	24
PSM	MLQQVPENINFPAEEE	1671	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25340	96.801	2	1944.8775	1944.8775	-	K	1	17
PSM	MMCGAPSATQPATAETQHIADQV	1672	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=21097	80.39	3	2456.077	2456.0770	-	R	1	24
PSM	MMLSTEGREGFVV	1673	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22605	85.946	2	1512.6953	1512.6953	-	K	1	14
PSM	MMNNSGYSDAGLGLGDETDEMPSTE	1674	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=19999	76.519	3	2710.0204	2710.0204	-	K	1	26
PSM	MNAGSDPVVIVSAA	1675	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20605	78.613	2	1387.6653	1387.6653	-	R	1	15
PSM	MNAGSDPVVIVSAA	1676	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20737	79.073	2	1387.6653	1387.6653	-	R	1	15
PSM	MNAGSDPVVIVSAA	1677	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24775	94.486	2	1371.6704	1371.6704	-	R	1	15
PSM	MNALLEQKEQQE	1678	sp|Q6AI12|ANR40_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=18065	70.102	2	1501.7083	1501.7083	-	R	1	13
PSM	MNINDLKLTLS	1679	sp|Q16222-2|UAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22180	84.369	2	1318.6803	1318.6803	-	K	1	12
PSM	MNPEKDFAPLTPNIV	1680	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24288	92.495	2	1742.8549	1742.8549	-	R	1	16
PSM	MNPVYSPVQPGAPYGNP	1681	sp|Q92567-3|F168A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20684	78.879	2	1844.8403	1844.8403	-	K	1	18
PSM	MNQPPQIAPK	1682	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8023	33.456	2	1180.591	1180.5910	-	R	1	11
PSM	MNSNVENLPPHII	1683	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18959	73.121	2	1534.745	1534.7450	-	R	1	14
PSM	MNSNVENLPPHII	1684	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19614	75.215	2	1534.745	1534.7450	-	R	1	14
PSM	MNSNVENLPPHII	1685	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=22791	86.592	2	1518.7501	1518.7501	-	R	1	14
PSM	MPPYTVVYFPVRG	1686	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=19783	75.802	2	1540.7748	1540.7748	-	R	1	14
PSM	MQNPQILAALQE	1687	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25146	96.049	2	1412.697	1412.6970	M	R	2	14
PSM	MQNSHSGVNQLGGVFVNG	1688	sp|P26367|PAX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=21007	80.075	2	1885.8741	1885.8741	-	R	1	19
PSM	MTMDKSELVQ	1689	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=7343	30.767	2	1254.5472	1254.5472	-	K	1	11
PSM	MVGEEKMSL	1690	sp|P35610|SOAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=8706	36.232	2	1096.478	1096.4780	-	R	1	10
PSM	MVGGGGVGGGLLENANPLIYQ	1691	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30773	118.01	2	2073.0201	2073.0201	-	R	1	22
PSM	PAVSLPPKENALF	1692	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19583	75.119	2	1381.7606	1381.7606	M	K	2	15
PSM	PEIVDTCSLASPASVC	1693	sp|P09960-2|LKHA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=17709	68.951	2	1704.7699	1704.7699	M	R	2	18
PSM	PGETEEPRPPEQQDQEGGEAA	1694	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7182	30.13	3	2249.9673	2249.9673	M	K	2	23
PSM	PGIVELPTLEEL	1695	sp|P51970|NDUA8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=28958	111.25	2	1308.7177	1308.7177	M	K	2	14
PSM	PGSLPLNAEACWP	1696	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=22698	86.274	2	1410.6602	1410.6602	M	K	2	15
PSM	PGSLPLNAEACWP	1697	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4	ms_run[2]:scan=22829	86.744	2	1410.6602	1410.6602	M	K	2	15
PSM	PLFATNPFDQDVE	1698	sp|Q92783-2|STAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=24883	94.938	2	1491.6882	1491.6882	M	K	2	15
PSM	PLFATNPFDQDVE	1699	sp|Q92783-2|STAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=25003	95.435	2	1491.6882	1491.6882	M	K	2	15
PSM	PQNEYIELH	1700	sp|O95478|NSA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10326	42.473	2	1141.5404	1141.5404	M	R	2	11
PSM	PVAVGPYGQSQPSCFD	1701	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=15753	62.256	2	1707.7563	1707.7563	M	R	2	18
PSM	PVAVGPYGQSQPSCFD	1702	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:4	ms_run[2]:scan=15884	62.714	2	1707.7563	1707.7563	M	R	2	18
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1703	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=21118	80.463	4	3845.8847	3845.8847	E	R	354	390
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	1704	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=21248	80.941	4	3845.8847	3845.8847	E	R	354	390
PSM	SAFSEAALEK	1705	sp|Q96P16|RPR1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=15337	60.762	2	1093.5292	1093.5292	M	K	2	12
PSM	SAPAGSSHPAASA	1706	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=4776	20.269	2	1151.5207	1151.5207	M	R	2	15
PSM	SDTWSSIQAHK	1707	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=11709	47.462	2	1300.6048	1300.6048	M	K	2	13
PSM	SDVTIVKEGWVQ	1708	sp|Q9Y243-2|AKT3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=20675	78.845	2	1401.714	1401.7140	M	K	2	14
PSM	SEKENNFPPLP	1709	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=19657	75.361	2	1312.6299	1312.6299	M	K	2	13
PSM	SFGSEHYLCSSSSY	1710	sp|Q16352|AINX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=18257	70.761	2	1651.6461	1651.6461	M	R	2	16
PSM	SGELPPNINIKEP	1711	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=20045	76.678	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	1712	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=20320	77.642	2	1448.7511	1448.7511	M	R	2	15
PSM	SGEPGQTSVAPPPEEVEPGSGV	1713	sp|Q9BRT3|MIEN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=17529	68.399	2	2147.9859	2147.9859	M	R	2	24
PSM	SGGASATGPR	1714	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=4080	17.281	2	901.42536	901.4254	M	R	2	12
PSM	SGSSSVAAMK	1715	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6171	25.925	2	965.4488	965.4488	M	K	2	12
PSM	SLKLQASNVTN	1716	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=12186	49.256	2	1215.6459	1215.6459	M	K	2	13
PSM	SLSNKLTLD	1717	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=16297	64.185	2	1031.5499	1031.5499	M	K	2	11
PSM	SNRPNNNPGGSL	1718	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=6925	29.047	2	1267.5905	1267.5905	M	R	2	14
PSM	SQDGASQFQEVI	1719	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=22665	86.166	2	1349.6099	1349.6099	M	R	2	14
PSM	SQDGASQFQEVI	1720	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=22808	86.664	2	1349.6099	1349.6099	M	R	2	14
PSM	SRSVLQPSQQ	1721	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=7911	32.991	2	1170.5993	1170.5993	M	K	2	12
PSM	SSDASQGVITTPPPPSMPHKE	1722	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=10283	42.306	3	2220.0369	2220.0369	M	R	2	23
PSM	STAAFHISSLLE	1723	sp|O75155-2|CAND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=26531	101.71	2	1316.6612	1316.6612	M	K	2	14
PSM	STASSSSSSSSSQTPHPPSQ	1724	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=5997	25.226	3	1974.8403	1974.8403	M	R	2	22
PSM	STRESFNPESYELD	1725	sp|P49903-2|SPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=19738	75.631	2	1714.7322	1714.7322	M	K	2	16
PSM	STRESFNPESYELD	1726	sp|P49903-2|SPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=19882	76.096	2	1714.7322	1714.7322	M	K	2	16
PSM	STSVPQGHTWTQ	1727	sp|Q9NYJ1|COA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=11094	45.431	2	1369.6262	1369.6262	M	R	2	14
PSM	SYTPGVGGDPAQLAQ	1728	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=19000	73.275	2	1501.7049	1501.7049	M	R	2	17
PSM	TELQSALLLR	1729	sp|P62253|UB2G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=24301	92.549	2	1184.6765	1184.6765	M	R	2	12
PSM	TSMASLFSFTSPAVK	1730	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=24600	93.745	2	1630.7913	1630.7913	M	R	2	17
PSM	TTQQIDLQGPGPWGF	1731	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:1	ms_run[2]:scan=32174	123.33	2	1685.8049	1685.8049	M	R	2	17
PSM	VQAWYMDDAPGDP	1732	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=15820	62.487	2	1479.5976	1479.5976	M	R	2	15
PSM	VQAWYMDDAPGDP	1733	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19398	74.598	2	1463.6027	1463.6027	M	R	2	15
PSM	DDDIAALVVDNGSGMC	1734	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31295	119.93861008239999	2	1709.6942	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1735	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=27142	104.21975493413333	2	1709.6942	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1736	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=27904	107.26775171333334	2	1692.6772	1692.6962	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1737	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32776	125.38922488453333	2	1749.7532	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1738	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31975	122.5822537544	2	1766.7572	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1739	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32094	123.01912951626667	2	1765.7522	1764.7542	M	K	2	18
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1740	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:35	ms_run[1]:scan=20585	78.54388236	3	3489.599706	3489.581685	T	-	609	647
PSM	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQ	1741	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=22736	86.38646108879999	3	3477.6012	3477.5802	M	K	2	33
PSM	SNGYEDHMAEDCRGDIG	1742	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=12264	49.556114572	2	1967.7372	1966.7412	M	R	2	19
PSM	AEEQPQVELFVKAGSDGA	1743	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=23450	89.11330803279999	2	1916.9152	1915.9162	M	K	2	20
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPA	1744	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=30304	116.28717393386667	3	3135.3002	3135.2792	M	K	2	32
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGGR	1745	sp|Q16644|MAPK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17812	69.25680971733333	3	2869.341576	2868.334837	-	R	1	32
PSM	METEQPEETFPNTETNGEFGK	1746	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19661	75.3721885616	2	2473.067240	2472.027481	-	R	1	22
PSM	AAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGP	1747	sp|P52272|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=32217	123.4823928376	3	3278.5442	3278.5242	M	K	2	37
PSM	AAQVAPAAASSLGNPPPPPPSEL	1748	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=23894	90.83812892719999	3	2180.1252	2180.1112	M	K	2	25
PSM	AATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQH	1749	sp|P49354|FNTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=12446	50.24109934	4	3428.6382	3428.6132	M	K	2	36
PSM	PAMQPAEIQFAQ	1750	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	3-UNIMOD:35	ms_run[1]:scan=13410	53.84537969946667	2	1345.6418	1345.6331	A	R	3	15
PSM	AGNAEPPPAGAACPQDR	1751	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=8032	33.50049090426667	2	1720.7782	1719.7632	M	R	2	19
PSM	SDAAVDTSSEITTKDL	1752	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=12846	51.70056400666667	2	1694.8052	1693.7892	M	K	2	18
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	1753	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	25-UNIMOD:35	ms_run[1]:scan=16654	65.43725444426667	3	2715.409773	2714.388392	K	R	123	152
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1754	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17669	68.83378991493333	3	3230.421602	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1755	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17429	68.06528087333334	3	3230.421602	3230.402859	Q	R	630	663
PSM	RVVVPATEEEAEVDEFPTDGEMSAQEED	1756	sp|O00541|PESC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	22-UNIMOD:35	ms_run[1]:scan=17608	68.64214132506666	3	3124.364767	3123.335015	A	R	285	313
PSM	MEAAHFFEGTE	1757	sp|P17707|DCAM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1	ms_run[1]:scan=24561	93.58385074426666	2	1310.555407	1309.528503	-	K	1	12
PSM	ATSGGEEAAAAAPAPGTPATGADTTPGWEVAV	1758	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=25653	98.05225563493333	3	2922.3702	2922.3512	M	R	2	34
PSM	SQGDSNPAAIPHAAEDIQGDD	1759	sp|P68402|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=16781	65.88833624613333	2	2149.9182	2148.9192	M	R	2	23
PSM	MEWGSESAAVR	1760	sp|Q7Z2K6|ERMP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12457	50.27089904106666	2	1279.558237	1279.550302	-	R	1	12
PSM	MNTSPGTVGSDPVILATAGYDHTV	1761	sp|Q9BVC4|LST8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=24532	93.47100171306667	3	2460.167283	2460.147871	-	R	1	25
PSM	KATVPVAAATAAEGEGSPPAVAAVAGPPAAAEVGGGVGGSS	1762	sp|O75179|ANR17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=18985	73.224614496	3	3457.774435	3455.753242	E	R	3	44
PSM	SAQSVEEDSILIIPTPDEEE	1763	sp|P17028|ZNF24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=31008	118.8563011696	2	2243.0372	2242.0372	M	K	2	22
PSM	SCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAEN	1764	sp|Q12962|TAF10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,2-UNIMOD:4	ms_run[1]:scan=20288	77.5307355672	3	3587.6522	3587.6312	M	K	2	42
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	1765	sp|Q9HD26|GOPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4,29-UNIMOD:35	ms_run[1]:scan=20897	79.6806699208	2	2605.1152	2605.0992	M	R	2	32
PSM	PAMPSSGPGDTSSSAAE	1766	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=7444	31.1707247304	2	1548.6552	1547.6402	M	R	2	19
PSM	AAAGGGGGGAAAAG	1767	sp|Q9UL25|RAB21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=4608	19.596407264533333	2	956.4363	956.4306	M	R	2	16
PSM	KQQIADLREDL	1768	sp|Q9HC77|CENPJ_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=17172	67.21894113466666	2	1327.734273	1327.709579	L	K	1000	1011
PSM	MPYQYPALTPEQK	1769	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:35	ms_run[1]:scan=12314	49.763256895733335	2	1580.723461	1580.754481	-	K	1	14
PSM	METEQPEETFPNTETNGEFGK	1770	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18083	70.16261801333333	2	2473.028226	2472.027481	-	R	1	22
PSM	AAAAAAALESWQAAAP	1771	sp|Q9UH36|SRR1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=33276	126.99	2	1510.7416	1510.7416	M	R	2	18
PSM	AAAAAAGAGPEMV	1772	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17751	69.074	2	1127.5281	1127.5281	M	R	2	15
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	1773	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4,28-UNIMOD:35	ms_run[2]:scan=24912	95.049	3	3215.2999	3215.2999	M	K	2	32
PSM	AAAEEEDGGPEGPN	1774	sp|Q99942|RNF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=8615	35.874	2	1383.5426	1383.5426	M	R	2	16
PSM	AADSDDGAVSAPAASDGGVS	1775	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8352	34.817	2	1718.7231	1718.7231	M	K	2	22
PSM	AAGTAAALAFLSQES	1776	sp|O75607|NPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=32752	125.31	2	1448.7147	1448.7147	M	R	2	17
PSM	AALHTTPDSPAAQLE	1777	sp|A6NFI3|ZN316_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15298	60.634	2	1562.7577	1562.7577	M	R	2	17
PSM	AANYSSTSTR	1778	sp|Q9BTV4|TMM43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5539	23.433	2	1098.4942	1098.4942	M	R	2	12
PSM	AASAPPPPDKLEGGGGPAPPPAPPSTG	1779	sp|Q9BRQ0|PYGO2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=14760	58.673	3	2431.202	2431.2020	M	R	2	29
PSM	AASQAVEEMRS	1780	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=6563	27.555	2	1235.5452	1235.5452	M	R	2	13
PSM	AATASAGAGGIDG	1781	sp|Q02978-2|M2OM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=9860	40.656	2	1059.4833	1059.4833	M	K	2	15
PSM	AAVQAAEVKVDGSEP	1782	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=16255	64.037	2	1511.7468	1511.7468	M	K	2	17
PSM	AAVQMDPELAK	1783	sp|Q9Y312|AAR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=9618	39.813	2	1229.5962	1229.5962	M	R	2	13
PSM	ADEELEALR	1784	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17124	67.054	2	1086.5193	1086.5193	M	R	2	11
PSM	ADEELEALR	1785	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17264	67.537	2	1086.5193	1086.5193	M	R	2	11
PSM	ADISLDELIR	1786	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=26943	103.41	2	1185.6241	1185.6241	M	K	2	12
PSM	ADKMDMSLDDII	1787	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=28244	108.54	1	1407.6262	1407.6262	M	K	2	14
PSM	ADKPDMGEIASFD	1788	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=15154	60.102	2	1452.6079	1452.6079	M	K	2	15
PSM	ADQLTEEQIAEF	1789	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=27257	104.67	2	1434.6515	1434.6515	M	K	2	14
PSM	ADQLTEEQIAEF	1790	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=27373	105.14	2	1434.6515	1434.6515	M	K	2	14
PSM	ADSELQLVEQ	1791	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=21785	82.92	2	1172.5561	1172.5561	M	R	2	12
PSM	AEAEESPGDPGTASP	1792	sp|Q96EC8-2|YIPF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=10182	41.902	2	1455.6001	1455.6001	M	R	2	17
PSM	AEEEVAKLE	1793	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15559	61.562	2	1058.5132	1058.5132	M	K	2	11
PSM	AEGEDVPPLPTSSGDGWE	1794	sp|Q9NUY8-2|TBC23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=25201	96.264	2	1883.8061	1883.8061	M	K	2	20
PSM	AELGAGGDGH	1795	sp|Q14244-3|MAP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=6772	28.416	2	924.39372	924.3937	M	R	2	12
PSM	AETLEFNDVYQEVKGSMNDG	1796	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,17-UNIMOD:35	ms_run[2]:scan=26278	100.63	3	2302.99	2302.9900	M	R	2	22
PSM	AGAGPAPGLPGAGGPVVPGPGAGIPGKSGEE	1797	sp|Q9BTD8-4|RBM42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=21033	80.171	2	2619.3293	2619.3293	M	R	2	33
PSM	AGAQPGVHALQL	1798	sp|Q9NQ66-2|PLCB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17563	68.505	2	1202.6408	1202.6408	M	K	2	14
PSM	AGITTIEAVK	1799	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15981	63.067	2	1043.5863	1043.5863	M	R	2	12
PSM	AGPESDAQYQFTGI	1800	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18967	73.15	2	1482.6627	1482.6627	M	K	2	16
PSM	AGYEYVSPEQLAGFD	1801	sp|Q9C0D9|EPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=30675	117.66	2	1686.7413	1686.7413	M	K	2	17
PSM	AHSPVQSGLPGMQNL	1802	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=15473	61.249	2	1592.7617	1592.7617	M	K	2	17
PSM	ALSMPLNGLKEED	1803	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=22792	86.596	2	1457.7072	1457.7072	M	K	2	15
PSM	ANSTGKAPPDE	1804	sp|Q68CP9-3|ARID2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4721	20.04	2	1127.5095	1127.5095	M	R	2	13
PSM	AQQAADKYLYVD	1805	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=18687	72.187	2	1425.6776	1425.6776	M	K	2	14
PSM	ARPDDEEGAAVAPGHPLA	1806	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=11105	45.468	3	1813.8595	1813.8595	M	K	2	20
PSM	ASASYHISNLLE	1807	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=21697	82.593	2	1345.6514	1345.6514	M	K	2	14
PSM	ASDCEPALNQAEG	1808	sp|Q9UBB6-2|NCDN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=12185	49.253	2	1402.5671	1402.5671	M	R	2	15
PSM	ASGAGGVGGGGGG	1809	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4924	20.868	2	901.38897	901.3890	M	K	2	15
PSM	ASGGSGGVSVPALWSEVN	1810	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=29140	111.9	2	1714.8162	1714.8162	M	R	2	20
PSM	ASGRPEELWEAVVGAAE	1811	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=31376	120.24	2	1811.869	1811.8690	M	R	2	19
PSM	ASGSGDSVTR	1812	sp|Q92797-2|SYMPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4329	18.417	2	977.4414	977.4414	M	R	2	12
PSM	ASKEMFEDTVEE	1813	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=12324	49.799	2	1471.6025	1471.6025	M	R	2	14
PSM	ASKEMFEDTVEE	1814	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=12638	50.943	2	1471.6025	1471.6025	M	R	2	14
PSM	ASKEMFEDTVEE	1815	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=12762	51.394	2	1471.6025	1471.6025	M	R	2	14
PSM	ASREEVLALQAEVAQ	1816	sp|O95396|MOCS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=22174	84.344	2	1654.8526	1654.8526	M	R	2	17
PSM	ASSSTVPLGFHYET	1817	sp|Q9BXK5-2|B2L13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=20286	77.527	2	1536.7096	1536.7096	M	K	2	16
PSM	ATAATEEPFPFHGLLP	1818	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=31081	119.15	2	1738.8566	1738.8566	M	K	2	18
PSM	ATGGGAEEER	1819	sp|Q9NUD5-2|ZCHC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=4243	18.034	2	1017.4363	1017.4363	M	K	2	12
PSM	ATLIYVDKENGEPGT	1820	sp|O95997|PTTG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=19022	73.353	2	1647.7992	1647.7992	M	R	2	17
PSM	ATLKDQLIYNLL	1821	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=31291	119.92	2	1445.813	1445.8130	M	K	2	14
PSM	ATTATMATSGSA	1822	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=9585	39.691	2	1110.4863	1110.4863	M	R	2	14
PSM	ATVEPETTPTPNPPTTEEE	1823	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=14751	58.644	2	2080.9324	2080.9324	M	K	2	21
PSM	ATVEPETTPTPNPPTTEEE	1824	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15152	60.099	2	2080.9324	2080.9324	M	K	2	21
PSM	ATVQQLEGRW	1825	sp|Q01469|FABP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=21447	81.652	2	1228.62	1228.6200	M	R	2	12
PSM	ATVTATTKVPEI	1826	sp|Q9Y230|RUVB2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=16991	66.6	2	1271.6973	1271.6973	M	R	2	14
PSM	ATYSLANERL	1827	sp|Q9P086|MED11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17732	69.018	2	1178.5932	1178.5932	M	R	2	12
PSM	CNTPTYCDLGKAA	1828	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=13915	55.658	2	1511.6385	1511.6385	M	K	2	15
PSM	DDDIAALVVDNGSGMC	1829	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=31518	120.8	2	1708.692	1708.6920	M	K	2	18
PSM	GEKSENCGVPEDLLNGL	1830	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25720	98.33	2	1871.8571	1871.8571	M	K	2	19
PSM	GPPGPALPATMNNSSSET	1831	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13041	52.453	2	1726.7832	1726.7832	M	R	2	20
PSM	KEILVGDVGQTVDDPYATFV	1832	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=24184	92.073	3	2165.0892	2165.0892	G	K	53	73
PSM	KGPAESPDEGITTTEGEGECEQTPEELEPVE	1833	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	20-UNIMOD:4	ms_run[2]:scan=15966	63.007	3	3343.4409	3343.4409	T	K	886	917
PSM	KGPVFAPPYEPLPENV	1834	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=20268	77.462	2	1752.9087	1752.9087	H	K	223	239
PSM	KGPVFAPPYEPLPENV	1835	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=20410	77.929	2	1752.9087	1752.9087	H	K	223	239
PSM	KPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLP	1836	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18753	72.421	3	2731.4141	2731.4141	S	R	5	38
PSM	KSPEEPSTPGTVVSSPSISTPPIVPDIQ	1837	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=21239	80.906	3	2845.4597	2845.4597	N	K	168	196
PSM	KVLDNYLTSPLPEEVDETSAEDEGVSQ	1838	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=22182	84.376	3	2963.3771	2963.3771	L	R	138	165
PSM	KVPADTEVVCAPPTAYIDFA	1839	sp|P60174-3|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=22841	86.785	3	2163.0558	2163.0558	A	R	70	90
PSM	KVPEIEVTVEGPNNNNPQTSAV	1840	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15771	62.312	3	2335.1656	2335.1656	S	R	639	661
PSM	KVTIAQGGVLPNIQAVLLP	1841	sp|Q99878|H2A1J_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=26946	103.42	2	1930.1615	1930.1615	G	K	100	119
PSM	MDELAGGGGGGPGMAAPP	1842	sp|Q13033-2|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14176	56.576	2	1614.6654	1614.6654	-	R	1	19
PSM	MDGGDDGNLIIK	1843	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13484	54.118	2	1304.5918	1304.5918	-	K	1	13
PSM	MDGGDDGNLIIK	1844	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13614	54.599	2	1304.5918	1304.5918	-	K	1	13
PSM	MDGIVPDIAVGTK	1845	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=24754	94.398	2	1356.6959	1356.6959	-	R	1	14
PSM	MDPNCSCAAGDSCTCAGSC	1846	sp|P02795|MT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=7891	32.901	2	2137.6574	2137.6574	-	K	1	20
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	1847	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16948	66.455	3	2498.0966	2498.0966	-	R	1	28
PSM	MEELDGEPTVTLIPGVNS	1848	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28406	109.18	2	1957.919	1957.9190	-	K	1	19
PSM	MEELSADEIR	1849	sp|O95155-2|UBE4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13135	52.801	2	1249.5496	1249.5496	-	R	1	11
PSM	MEESVNQMQPLNE	1850	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=15901	62.777	2	1605.6651	1605.6651	-	K	1	14
PSM	MEEVVIAGMSG	1851	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=23122	87.842	2	1179.5152	1179.5152	-	K	1	12
PSM	MEEVVIAGMSG	1852	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=23541	89.459	2	1179.5152	1179.5152	-	K	1	12
PSM	MEGGFGSDFGGSGSG	1853	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=23440	89.07	2	1389.5143	1389.5143	-	K	1	16
PSM	MEGLTLSDAEQ	1854	sp|Q96D71-2|REPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=23974	91.175	2	1234.5387	1234.5387	-	K	1	12
PSM	MEGPLSVFGDRSTGETI	1855	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26182	100.25	2	1852.8513	1852.8513	-	R	1	18
PSM	MEGPLSVFGDRSTGETI	1856	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26302	100.73	2	1852.8513	1852.8513	-	R	1	18
PSM	MELEDGVVYQEEPGGSGAVMSE	1857	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=27199	104.44	2	2353.993	2353.9930	-	R	1	23
PSM	MEMTEMTGVSLK	1858	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=13159	52.899	2	1429.6139	1429.6139	-	R	1	13
PSM	MEPAVGGPGPLIVNN	1859	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=24865	94.868	2	1505.7548	1505.7548	-	K	1	16
PSM	MEPAVSEPMRDQVA	1860	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=13037	52.439	2	1616.7174	1616.7174	-	R	1	15
PSM	MEPGPDGPAASGPAAI	1861	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16362	64.408	2	1494.6661	1494.6661	-	R	1	17
PSM	MEPLQQQQQQQQQQQ	1862	sp|Q8IVW6-3|ARI3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8505	35.441	2	1954.8803	1954.8803	-	K	1	16
PSM	MEPPGGSLGPGRGT	1863	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9191	38.096	2	1369.6296	1369.6296	-	R	1	15
PSM	MEPPGGSLGPGRGT	1864	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9307	38.563	2	1369.6296	1369.6296	-	R	1	15
PSM	MEPPGGSLGPGRGT	1865	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=13430	53.915	2	1353.6347	1353.6347	-	R	1	15
PSM	METLQSETKT	1866	sp|Q9BWK5-4|CYREN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=13499	54.177	2	1208.5595	1208.5595	-	R	1	11
PSM	METMASPGKDNY	1867	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9693	40.074	2	1400.5588	1400.5588	-	R	1	13
PSM	MEVDAPGVDGRDGL	1868	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15359	60.847	2	1487.6562	1487.6562	-	R	1	15
PSM	MFLQYYLNEQGD	1869	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=22503	85.566	2	1535.6602	1535.6602	-	R	1	13
PSM	MFQVPDSEGGRAGS	1870	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13771	55.15	2	1494.6409	1494.6409	-	R	1	15
PSM	MHGGGPPSGDSACPL	1871	sp|P24928-2|RPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=9822	40.511	2	1496.6024	1496.6024	-	R	1	16
PSM	MIHGFQSSH	1872	sp|O75663-2|TIPRL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7932	33.076	2	1100.4709	1100.4709	M	R	2	11
PSM	MLGTEGGEGFVV	1873	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25289	96.613	2	1252.5646	1252.5646	M	K	2	14
PSM	MLGTEGGEGFVV	1874	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=30573	117.29	2	1236.5696	1236.5696	M	K	2	14
PSM	MLGTEGGEGFVVKV	1875	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=16342	64.332	2	1437.7174	1437.7174	M	R	2	16
PSM	MLQQVPENINFPAEEE	1876	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25225	96.356	2	1944.8775	1944.8775	-	K	1	17
PSM	MLQQVPENINFPAEEE	1877	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=29058	111.61	2	1928.8826	1928.8826	-	K	1	17
PSM	MLQQVPENINFPAEEE	1878	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=29179	112.05	2	1928.8826	1928.8826	-	K	1	17
PSM	MLSLDFLDDVR	1879	sp|P67812-4|SC11A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=25216	96.325	2	1338.649	1338.6490	-	R	1	12
PSM	MMIHGFQSSH	1880	sp|O75663-2|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=8078	33.684	2	1247.5063	1247.5063	-	R	1	11
PSM	MMLGTEGGEGFVVKV	1881	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24656	93.993	2	1610.7684	1610.7684	-	R	1	16
PSM	MMLSTEGREGFVV	1882	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23332	88.659	2	1512.6953	1512.6953	-	K	1	14
PSM	MQGEAHPSASLID	1883	sp|Q96SK2-4|TM209_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15191	60.251	2	1396.6293	1396.6293	M	R	2	15
PSM	MQGEAHPSASLID	1884	sp|Q96SK2-4|TM209_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11785	47.746	2	1412.6242	1412.6242	M	R	2	15
PSM	MQSTDLGNKESG	1885	sp|Q96DN5-3|TBC31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5447	23.04	2	1323.5613	1323.5613	-	K	1	13
PSM	MRPEPGGCCC	1886	sp|O15270|SPTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5240	22.187	2	1280.4406	1280.4406	-	R	1	11
PSM	MTEWETAAPAVAETPDI	1887	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26618	102.08	2	1888.8401	1888.8401	-	K	1	18
PSM	MTEWETAAPAVAETPDI	1888	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26727	102.53	2	1888.8401	1888.8401	-	K	1	18
PSM	MTEWETAAPAVAETPDI	1889	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=31122	119.3	2	1872.8451	1872.8451	-	K	1	18
PSM	MWSEGRYEYE	1890	sp|Q8NEY8-9|PPHLN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15714	62.097	2	1406.5449	1406.5449	-	R	1	11
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	1891	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14901	59.169	3	2832.4182	2832.4182	M	K	2	30
PSM	PDPSKSAPAP	1892	sp|Q8N257|H2B3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4593	19.54	2	965.48181	965.4818	M	K	2	12
PSM	PENPATDKLQVLQVLD	1893	sp|Q8NI35-4|INADL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=21878	83.252	2	1778.9414	1778.9414	M	R	2	18
PSM	PFPVTTQGSQQTQPPQ	1894	sp|P51003-2|PAPOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11522	46.834	2	1739.8479	1739.8479	M	K	2	18
PSM	PPYTVVYFPVRG	1895	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=19683	75.447	2	1393.7394	1393.7394	M	R	2	14
PSM	PPYTVVYFPVRG	1896	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=19821	75.911	2	1393.7394	1393.7394	M	R	2	14
PSM	PYQYPALTPEQ	1897	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14931	59.283	2	1305.6241	1305.6241	M	K	2	13
PSM	RLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAAT	1898	sp|Q6ZT62-2|BGIN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=19895	76.134	3	3530.8621	3530.8621	D	K	429	467
PSM	SASAPAAEGEGTPTQPASE	1899	sp|P35659-2|DEK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=9674	40.02	2	1798.7857	1798.7857	M	K	2	21
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSN	1900	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=18100	70.212	3	2523.2241	2523.2241	M	R	2	30
PSM	SATVVDAVNAAPLSGS	1901	sp|O95391|SLU7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=23110	87.802	2	1499.7468	1499.7468	M	K	2	18
PSM	SDNGELEDKPPAPPV	1902	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=14277	56.964	2	1605.7522	1605.7522	M	R	2	17
PSM	SDNGELEDKPPAPPV	1903	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=14657	58.293	2	1605.7522	1605.7522	M	R	2	17
PSM	SDQDHSMDEMTAVV	1904	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=14100	56.277	2	1621.6236	1621.6236	M	K	2	16
PSM	SDQQLDCALDLM	1905	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=24546	93.528	2	1465.6065	1465.6065	M	R	2	14
PSM	SDSEKLNLDSIIG	1906	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=24453	93.148	2	1431.7093	1431.7093	M	R	2	15
PSM	SGEPGQTSVAPPPEEVEPGSGV	1907	sp|Q9BRT3|MIEN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=17676	68.86	2	2147.9859	2147.9859	M	R	2	24
PSM	SIMSYNGGAVMAM	1908	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=14120	56.353	2	1420.5673	1420.5673	M	K	2	15
PSM	SLVIPEKFQHIL	1909	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=25573	97.707	2	1464.8341	1464.8341	M	R	2	14
PSM	SQDGASQFQEVI	1910	sp|Q16851-2|UGPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=23217	88.206	2	1349.6099	1349.6099	M	R	2	14
PSM	SQGDSNPAAIPHAAEDIQGDD	1911	sp|P68402-3|PA1B2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=15584	61.643	2	2148.9196	2148.9196	M	R	2	23
PSM	SRSVLQPSQQ	1912	sp|Q9Y2A7|NCKP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=7796	32.513	2	1170.5993	1170.5993	M	K	2	12
PSM	SSEMLPAFIETSNVDK	1913	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=25971	99.373	2	1808.8502	1808.8502	M	K	2	18
PSM	SSFSESALEK	1914	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=12853	51.724	2	1125.519	1125.5190	M	K	2	12
PSM	SSIGTGYDLSASTFSPDG	1915	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=25697	98.236	2	1802.7847	1802.7847	M	R	2	20
PSM	SSKQEIMSDQ	1916	sp|Q9H501|ESF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=4539	19.302	2	1209.5183	1209.5183	M	R	2	12
PSM	SSPQAPEDGQGCGD	1917	sp|O14734|ACOT8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=6564	27.557	2	1445.5365	1445.5365	M	R	2	16
PSM	SSVQQQPPPPR	1918	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=5671	23.999	2	1261.6415	1261.6415	M	R	2	13
PSM	STGTFVVSQPLNY	1919	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=25371	96.917	2	1453.7089	1453.7089	M	R	2	15
PSM	TEWETAAPAVAETPDIKLFG	1920	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=30254	116.09	2	2187.0736	2187.0736	M	K	2	22
PSM	TSPEIASLSWGQM	1921	sp|Q9H7C9-3|AAMDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=26397	101.13	2	1463.6602	1463.6602	M	K	2	15
PSM	VDHLANTEINSQ	1922	sp|Q96S99|PKHF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:1	ms_run[2]:scan=14618	58.143	2	1381.6474	1381.6474	M	R	2	14
PSM	VPPVQVSPLIKLG	1923	sp|P56385|ATP5I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=20222	77.306	2	1345.8333	1345.8333	M	R	2	15
PSM	MDDDIAALVVDNGSGMC	1924	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=31836	122.06056976106667	2	1840.750462	1839.732502	-	K	1	18
PSM	DDDIAALVVDNGSGMC	1925	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31635	121.2729108616	2	1709.6902	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	1926	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31587	121.07394770693332	2	1709.6902	1708.6912	M	K	2	18
PSM	EEEIAALVIDNGSGMC	1927	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32284	123.72385806000001	2	1749.7752	1748.7592	M	K	2	18
PSM	AGVEEVAASGSHLNGDLDPDDREEGAASTAEEAA	1928	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=20628	78.67642309813333	3	3383.4962	3381.4712	M	K	2	36
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1929	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=16732	65.72269798026667	3	3505.598311	3505.576600	T	-	609	647
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	1930	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=17966	69.78432078613334	4	5340.4582	5340.4222	M	R	2	70
PSM	SNGYEDHMAEDC	1931	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=6105	25.6649308024	2	1484.4909	1484.4815	M	R	2	14
PSM	TELQSALLLR	1932	sp|P62253|UB2G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=24284	92.48063979386667	2	1184.6833	1184.6760	M	R	2	12
PSM	MENGAVYSPTTEEDPGPA	1933	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1	ms_run[1]:scan=18889	72.88964600293333	2	1905.805370	1905.793839	-	R	1	19
PSM	PIKVGDAIPAVEVFEGEPGN	1934	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=24154	91.94364183466668	3	2037.0542	2037.0412	A	K	3	23
PSM	PIKVGDAIPAVEVFEGEPGN	1935	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=24049	91.50978861386668	2	2037.0552	2037.0412	A	K	3	23
PSM	PIKVGDAIPAVEVFEGEPGN	1936	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=24272	92.43410486986666	3	2037.0542	2037.0412	A	K	3	23
PSM	MDLFGDLPEPERSP	1937	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1	ms_run[1]:scan=29581	113.56560426373333	2	1644.765236	1643.750124	-	R	1	15
PSM	ADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQ	1938	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=21916	83.366151688	4	4972.3942	4972.3632	M	R	2	58
PSM	AAAAAGAASGLPGPVAQGL	1939	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=25260	96.49091073706667	2	1590.8459	1590.8360	A	K	3	22
PSM	PAMQPAEIQFAQ	1940	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=16700	65.6027989712	2	1329.6492	1329.6382	A	R	3	15
PSM	AAAEEEDGGPEGPNRE	1941	sp|Q99942|RNF5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=7778	32.4469173496	2	1668.7182	1668.6862	M	R	2	18
PSM	MDQVMQFVEPSRQFV	1942	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=23028	87.47217622346668	2	1914.884639	1913.865171	-	K	1	16
PSM	MNSNVENLPPHII	1943	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20678	78.85610733093334	2	1534.756994	1534.744979	-	R	1	14
PSM	ATYLEFIQQNEERDGV	1944	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=29726	114.07751915253333	2	1953.9312	1952.9112	M	R	2	18
PSM	SFDPNLLHNNGHNGYPNGTSAAL	1945	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=21819	83.0488081176	3	2452.1202	2451.1202	M	R	2	25
PSM	AAAGAGPGQEAGAGPGPGAVANATGAEEGEM	1946	sp|Q9UBL3|ASH2L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,31-UNIMOD:35	ms_run[1]:scan=16132	63.59435493813333	3	2680.1842	2680.1662	M	K	2	33
PSM	MEPGPDGPAASGPAAI	1947	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16225	63.92333824746667	2	1494.675556	1494.666060	-	R	1	17
PSM	ASNVTNKTD	1948	sp|P07910|HNRPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=4620	19.63955692293333	2	990.4685	990.4613	M	P	2	11
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1949	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18362	71.09896529893334	4	3230.4202	3230.4022	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	1950	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20195	77.21102346213334	4	3215.4232	3214.4072	Q	R	630	663
PSM	AAAAAAAGAAGSAAPAAAAGAPGSGGAPSGSQGVLIGD	1951	sp|Q96S94|CCNL2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=23486	89.2460445656	3	2989.4832	2988.4532	M	R	2	40
PSM	SRSYNDELQFLE	1952	sp|Q9Y3I0|RTCB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=23697	90.07320312106667	2	1542.6942	1541.6992	M	K	2	14
PSM	MEERGDSEPTPGCSGLGPGGV	1953	sp|Q8WW01|SEN15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=13865	55.49363638533334	2	2146.897196	2145.894299	-	R	1	22
PSM	MDVERLQEAL	1954	sp|Q9NY27|PP4R2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1	ms_run[1]:scan=25382	96.95261379653333	2	1244.602747	1244.607088	-	K	1	11
PSM	AHSPVQSGLPGMQNL	1955	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=21030	80.16426440240001	2	1576.7756	1576.7663	M	K	2	17
PSM	MMCGAPSATQPATAETQHIADQV	1956	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,3-UNIMOD:4	ms_run[1]:scan=16502	64.89469534853333	3	2488.081149	2488.066861	-	R	1	24
PSM	PAVSLPPKENALF	1957	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=19153	73.80250824586666	2	1381.7685	1381.7600	M	K	2	15
PSM	MELEDGVVYQEEPGGSGAVMSE	1958	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,20-UNIMOD:35	ms_run[1]:scan=25154	96.08325963066666	3	2370.004715	2369.987924	-	R	1	23
PSM	PQNEYIELH	1959	sp|O95478|NSA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=10304	42.38069152986667	2	1141.5490	1141.5399	M	R	2	11
PSM	AEAAAAAGGTGLGAGASYGSAAD	1960	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=18566	71.76715213813333	2	1907.8622	1907.8492	M	R	2	25
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	1961	sp|Q9HD26|GOPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4,29-UNIMOD:35	ms_run[1]:scan=20903	79.70504907040001	3	2605.1132	2605.0992	M	R	2	32
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	1962	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,7-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=27559	105.91131790293333	3	2929.3232	2929.3042	M	R	2	33
PSM	ASPGHSDLGEVAPEI	1963	sp|Q8TCY9-2|URGCP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=18609	71.91578226773332	2	1519.7198	1519.7149	M	K	2	17
PSM	METEQPEETFPNTETNGEFGK	1964	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17489	68.26519604133334	3	2473.027565	2472.027481	-	R	1	22
PSM	RDEVVSPLPSALQGPSGSLSAPPAASVISAPPSSSS	1965	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=23873	90.75700645893333	3	3404.757064	3401.731444	C	R	325	361
PSM	AAAAAAAPSGGGGGGEEERLEE	1966	sp|P51608-2|MECP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=12225	49.408	2	1997.8926	1997.8926	M	K	2	24
PSM	AAAAAVGNAVPCGA	1967	sp|Q9HD20|AT131_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=17037	66.752	2	1240.587	1240.5870	M	R	2	16
PSM	AAADGALPEAAALEQPAELPASV	1968	sp|P23025|XPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=29386	112.82	2	2203.1008	2203.1008	M	R	2	25
PSM	AAEPNKTEIQTLF	1969	sp|Q8N6H7|ARFG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=22923	87.077	2	1502.7617	1502.7617	M	K	2	15
PSM	AAGGAVAAAPEC	1970	sp|Q9UL63|MKLN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=10059	41.416	2	1085.4812	1085.4812	M	R	2	14
PSM	AALAPLPPLPAQF	1971	sp|Q9NP79|VTA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=32842	125.6	2	1346.7598	1346.7598	M	K	2	15
PSM	AAPPGEYFSVGSQVSC	1972	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=23984	91.216	2	1696.7403	1696.7403	M	R	2	18
PSM	AAQVAPAAASSLGNPPPPPPSEL	1973	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=23766	90.338	3	2180.1113	2180.1113	M	K	2	25
PSM	AASEAAVVSSPSL	1974	sp|Q8WWH5|TRUB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=19827	75.927	2	1229.6139	1229.6139	M	K	2	15
PSM	AASGKLSTC	1975	sp|Q8WVM0|TFB1M_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=5901	24.913	2	935.43823	935.4382	M	R	2	11
PSM	AASTAAGKQ	1976	sp|Q9BZJ0-2|CRNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=3910	16.496	2	845.4243	845.4243	M	R	2	11
PSM	ADAEVIILPK	1977	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20572	78.498	2	1109.6332	1109.6332	M	K	2	12
PSM	ADDAGLETPLCSEQFGSGEA	1978	sp|Q96GQ5|RUSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=25112	95.911	2	2094.8688	2094.8688	M	R	2	22
PSM	ADEDGEGIHPSAPH	1979	sp|Q96L92-3|SNX27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7823	32.617	2	1472.6168	1472.6168	M	R	2	16
PSM	ADEEKLPPGWE	1980	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=17174	67.225	2	1311.5983	1311.5983	M	K	2	13
PSM	ADEEKLPPGWE	1981	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=17182	67.246	2	1311.5983	1311.5983	M	K	2	13
PSM	ADIDNKEQSELDQDLDDVEEVEEEETGEET	1982	sp|P55209-2|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=31664	121.38	3	3493.4387	3493.4387	M	K	2	32
PSM	ADKEAAFDDAVEE	1983	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=14858	59.015	2	1450.61	1450.6100	M	R	2	15
PSM	ADKMDMSLDDII	1984	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=25172	96.145	2	1423.6211	1423.6211	M	K	2	14
PSM	ADKPDMGEIASFD	1985	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20199	77.227	2	1436.613	1436.6130	M	K	2	15
PSM	AEAALLLLPEAAAE	1986	sp|Q96JB2-2|COG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=33836	128.55	2	1422.7606	1422.7606	M	R	2	16
PSM	AEEQPQVELFV	1987	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=28777	110.59	2	1329.6452	1329.6452	M	K	2	13
PSM	AEGTAEAPLENGGGGDSGAGALE	1988	sp|Q96G46-3|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=18032	69.985	2	2070.8978	2070.8978	M	R	2	25
PSM	AELGAGGDGH	1989	sp|Q14244-3|MAP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6792	28.491	2	924.39372	924.3937	M	R	2	12
PSM	AELQEVQITEE	1990	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=21863	83.198	2	1329.63	1329.6300	M	K	2	13
PSM	AENGESSGPPRPS	1991	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5868	24.785	2	1325.5848	1325.5848	M	R	2	15
PSM	AENVVEPGPPSAK	1992	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=10404	42.775	2	1335.667	1335.6670	M	R	2	15
PSM	AENVVEPGPPSAK	1993	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=10545	43.322	2	1335.667	1335.6670	M	R	2	15
PSM	AEPASVAAESLAGS	1994	sp|Q9NQT5-2|EXOS3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20948	79.858	2	1300.6147	1300.6147	M	R	2	16
PSM	AESDWDTVTVL	1995	sp|O60869-2|EDF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=29671	113.88	2	1276.5823	1276.5823	M	R	2	13
PSM	AEVGEIIEGC	1996	sp|Q92993-2|KAT5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=24817	94.66	2	1117.4961	1117.4961	M	R	2	12
PSM	AGLNSLEAVK	1997	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=16047	63.304	2	1042.5659	1042.5659	M	R	2	12
PSM	AGLSDLELR	1998	sp|Q8NC56|LEMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20002	76.527	2	1014.5346	1014.5346	M	R	2	11
PSM	AGSSSLEAVR	1999	sp|P09493-5|TPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9360	38.791	2	1017.5091	1017.5091	M	R	2	12
PSM	AGSSSLEAVR	2000	sp|P09493-5|TPM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9471	39.25	2	1017.5091	1017.5091	M	R	2	12
PSM	AKDAGLIEANGEL	2001	sp|Q14186|TFDP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=17827	69.306	2	1341.6776	1341.6776	M	K	2	15
PSM	AKISSPTETE	2002	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7582	31.719	2	1103.5346	1103.5346	M	R	2	12
PSM	ALETVPKDL	2003	sp|P63272|SPT4H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=18999	73.272	2	1026.5597	1026.5597	M	R	2	11
PSM	AQEVSEYLSQNP	2004	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=25821	98.752	2	1405.6361	1405.6361	M	R	2	14
PSM	AQPGPASQPDVSLQQ	2005	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=14705	58.489	2	1563.7529	1563.7529	M	R	2	17
PSM	ASADKNGGSVSSVSSS	2006	sp|Q6PJF5-2|RHDF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5430	22.963	2	1480.6641	1480.6641	M	R	2	18
PSM	ASFVTEVLAHSG	2007	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=31454	120.54	2	1258.6194	1258.6194	M	R	2	14
PSM	ASGQGPGPP	2008	sp|Q16611-2|BAK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7185	30.141	1	808.37153	808.3715	M	R	2	11
PSM	ASKEMFEDTVEE	2009	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=16476	64.796	2	1455.6075	1455.6075	M	R	2	14
PSM	ASNVTNKTDP	2010	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5825	24.605	2	1087.5146	1087.5146	M	R	2	12
PSM	ASNVTNKTDP	2011	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5937	25.026	2	1087.5146	1087.5146	M	R	2	12
PSM	ASPAASSVRPP	2012	sp|Q9H875|PKRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=9569	39.628	2	1080.5564	1080.5564	M	R	2	13
PSM	ATQAHSLSYAGCNFL	2013	sp|Q9Y2P8|RCL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=21938	83.439	2	1680.7566	1680.7566	M	R	2	17
PSM	ATQAHSLSYAGCNFL	2014	sp|Q9Y2P8|RCL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=22069	83.931	2	1680.7566	1680.7566	M	R	2	17
PSM	ATVEPETTPTPNPPTTEEE	2015	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=14887	59.123	2	2080.9324	2080.9324	M	K	2	21
PSM	ATVEPETTPTPNPPTTEEE	2016	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=15019	59.605	2	2080.9324	2080.9324	M	K	2	21
PSM	AVAAAAAAAGPAGAGGG	2017	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=16560	65.087	2	1251.6208	1251.6208	M	R	2	19
PSM	DDDIAALVVDNGSGMC	2018	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:4	ms_run[2]:scan=25393	97.003	2	1650.6865	1650.6865	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2019	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=31693	121.48	2	1692.6971	1692.6971	M	K	2	18
PSM	GPPGPALPATMNNSSSET	2020	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=10106	41.608	2	1742.7781	1742.7781	M	R	2	20
PSM	GQTVNEDSMDVK	2021	sp|Q9UQR0|SCML2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=4345	18.487	2	1337.5769	1337.5769	M	K	2	14
PSM	GVTCVSQMPVAEG	2022	sp|Q9H944-2|MED20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=8013	33.414	2	1349.5955	1349.5955	M	K	2	15
PSM	KAFLADPSAFVAAAPVAAATTAAPAAAAAPA	2023	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=25108	95.894	3	2751.4596	2751.4596	V	K	204	235
PSM	KEPELLEPIPYEFMA	2024	sp|P46778|RL21_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:35	ms_run[2]:scan=24192	92.108	2	1820.8906	1820.8906	G	-	146	161
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	2025	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14155	56.491	3	2773.4246	2773.4246	G	K	61	94
PSM	KLLPEYPGVLSDVQEE	2026	sp|P00374|DYR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=20763	79.161	2	1814.9302	1814.9302	Y	K	158	174
PSM	KMPDEPEEPVVAVSSPAVPPPT	2027	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=14892	59.14	2	2288.1246	2288.1246	A	K	456	478
PSM	KSYELPDGQVITIGNE	2028	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=22960	87.213	2	1761.8785	1761.8785	E	R	938	954
PSM	KSYELPDGQVITIGNE	2029	sp|Q6S8J3|POTEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=22967	87.24	2	1761.8785	1761.8785	E	R	938	954
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	2030	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=20423	77.967	3	2750.4201	2750.4201	N	R	143	170
PSM	KTPVEEVPAAIAPFQG	2031	sp|Q15393-3|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18790	72.549	2	1652.8774	1652.8774	H	R	124	140
PSM	MDADDSRAP	2032	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=7915	33.009	2	1018.4026	1018.4026	-	K	1	10
PSM	MDDWKPSPLI	2033	sp|Q8WZA1|PMGT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22119	84.135	2	1258.5904	1258.5904	-	K	1	11
PSM	MDDYSLDEFR	2034	sp|Q8N3Y1-2|FBXW8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19324	74.372	2	1347.5289	1347.5289	-	R	1	11
PSM	MDELQDVQLTEI	2035	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27747	106.65	2	1490.681	1490.6810	-	K	1	13
PSM	MDETVAEFIK	2036	sp|Q96H22-2|CENPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20639	78.727	2	1239.5693	1239.5693	-	R	1	11
PSM	MDGGDDGNLII	2037	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22713	86.315	2	1176.4969	1176.4969	-	K	1	12
PSM	MDGTEGSAGQPGPAE	2038	sp|Q9BZ67-2|FRMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6913	28.993	2	1460.5726	1460.5726	-	R	1	16
PSM	MDIRPNHTIYINNMND	2039	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=12808	51.558	2	2033.8935	2033.8935	-	K	1	17
PSM	MDPFTEKLLE	2040	sp|Q9NQW6-2|ANLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23777	90.377	2	1279.6006	1279.6006	-	R	1	11
PSM	MDVGELLSYQPN	2041	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=32099	123.04	2	1406.6388	1406.6388	-	R	1	13
PSM	MDVGELLSYQPNRGT	2042	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23002	87.367	2	1736.8039	1736.8040	-	K	1	16
PSM	MEDGGLTAFEEDQ	2043	sp|Q96RG2-4|PASK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21947	83.472	2	1498.577	1498.5770	-	R	1	14
PSM	MEDHQHVPIDIQTS	2044	sp|Q96JB5|CK5P3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12357	49.908	2	1706.757	1706.7570	-	K	1	15
PSM	MEDHQHVPIDIQTS	2045	sp|Q96JB5|CK5P3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=14958	59.38	2	1690.7621	1690.7621	-	K	1	15
PSM	MEDMNEYSNIEEFAEGS	2046	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26237	100.46	2	2067.7561	2067.7561	-	K	1	18
PSM	MEDMNEYSNIEEFAEGS	2047	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=28058	107.83	2	2051.7612	2051.7612	-	K	1	18
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	2048	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20181	77.164	3	2482.1017	2482.1017	-	R	1	28
PSM	MEEDQELER	2049	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7851	32.728	2	1235.4976	1235.4976	-	K	1	10
PSM	MEEERGSALAAESALE	2050	sp|Q5EBL4|RIPL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16236	63.969	2	1749.7727	1749.7727	-	K	1	17
PSM	MEEISLANLDTN	2051	sp|Q96GX2|A7L3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24331	92.672	2	1406.6235	1406.6235	-	K	1	13
PSM	MEEVVIAGMSG	2052	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=15056	59.739	2	1195.5101	1195.5101	-	K	1	12
PSM	MEEVVIAGMSG	2053	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=15333	60.75	2	1195.5101	1195.5101	-	K	1	12
PSM	MEEVVIAGMSG	2054	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=15472	61.245	2	1195.5101	1195.5101	-	K	1	12
PSM	MEEVVIAGMSG	2055	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=23416	88.987	2	1179.5152	1179.5152	-	K	1	12
PSM	MEGGFGSDFGGSGSG	2056	sp|Q9Y5L4|TIM13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18181	70.492	2	1405.5092	1405.5092	-	K	1	16
PSM	MEGHDPKEPEQL	2057	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7828	32.633	2	1466.6348	1466.6348	-	R	1	13
PSM	MEGPGLGSQC	2058	sp|Q8IUH4|ZDH13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=9380	38.88	2	1092.4216	1092.4216	-	R	1	11
PSM	MEGPLSVFGD	2059	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=32869	125.7	2	1092.4798	1092.4798	-	R	1	11
PSM	MEGPLSVFGD	2060	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=33005	126.12	2	1092.4798	1092.4798	-	R	1	11
PSM	MEMTEMTGVSLK	2061	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=17204	67.328	2	1413.619	1413.6190	-	R	1	13
PSM	MENMAEEELLPLE	2062	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26811	102.86	2	1620.6899	1620.6899	-	K	1	14
PSM	MENMAEEELLPLE	2063	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=29345	112.67	2	1604.695	1604.6950	-	K	1	14
PSM	MEPPGGSLGPGRGT	2064	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9057	37.579	2	1369.6296	1369.6296	-	R	1	15
PSM	MEQVNELKE	2065	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9648	39.927	2	1176.5333	1176.5333	-	K	1	10
PSM	MESQEPTESSQNG	2066	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=8163	34.056	2	1464.5675	1464.5675	-	K	1	14
PSM	METILEQQR	2067	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11840	47.962	2	1204.5758	1204.5758	-	R	1	10
PSM	METILEQQR	2068	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=19992	76.496	2	1188.5809	1188.5809	-	R	1	10
PSM	METILEQQR	2069	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20122	76.965	2	1188.5809	1188.5809	-	R	1	10
PSM	MEVLAAETTSQQE	2070	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=25663	98.098	2	1477.6606	1477.6606	-	R	1	14
PSM	MEVSPLQPVNENMQVN	2071	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21619	82.292	2	1885.855	1885.8550	-	K	1	17
PSM	MEVTGDAGVPESGEI	2072	sp|O00273-2|DFFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18617	71.949	2	1547.6661	1547.6661	-	R	1	16
PSM	MEVTGDAGVPESGEI	2073	sp|O00273-2|DFFA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=23372	88.828	2	1531.6712	1531.6712	-	R	1	16
PSM	MFQVPDSEGGRAGS	2074	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=18519	71.618	2	1478.646	1478.6460	-	R	1	15
PSM	MHSLATAAPVPTTLAQVD	2075	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20052	76.701	3	1879.935	1879.9350	-	R	1	19
PSM	MHSLATAAPVPTTLAQVD	2076	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20058	76.722	3	1879.935	1879.9350	-	R	1	19
PSM	MMLGTEGGEGFVV	2077	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24567	93.608	2	1399.6	1399.6000	-	K	1	14
PSM	MMLGTEGGEGFVV	2078	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29512	113.31	2	1383.605	1383.6050	-	K	1	14
PSM	MNDTVTIRT	2079	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=13732	55.011	2	1091.5281	1091.5281	-	R	1	10
PSM	MNGDQNSDVYAQE	2080	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9534	39.487	2	1527.5784	1527.5784	-	K	1	14
PSM	MNGTLDHPDQPDLDAI	2081	sp|Q92879-2|CELF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=22863	86.871	2	1792.7938	1792.7938	-	K	1	17
PSM	MNNHVSSKPSTM	2082	sp|O95573|ACSL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4911	20.818	2	1389.6017	1389.6017	-	K	1	13
PSM	MNTSPGTVGSDPVILATAGYDHTV	2083	sp|Q9BVC4-5|LST8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24481	93.265	3	2460.1479	2460.1479	-	R	1	25
PSM	MPFLELDTNLPAN	2084	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=23271	88.419	2	1489.7123	1489.7123	-	R	1	14
PSM	MQDAENVAVPEAAEE	2085	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=20214	77.279	2	1643.6985	1643.6985	-	R	1	16
PSM	MQNDAGEFVDLYVP	2086	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=31076	119.13	2	1654.7185	1654.7185	-	R	1	15
PSM	MQNDAGEFVDLYVP	2087	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=31197	119.57	2	1654.7185	1654.7185	-	R	1	15
PSM	MTSEVIEDEKQFYS	2088	sp|Q9BV86-2|NTM1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19573	75.089	2	1762.7607	1762.7607	-	K	1	15
PSM	MVGGGGVGGGLLENANPLIYQ	2089	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30777	118.02	2	2073.0201	2073.0201	-	R	1	22
PSM	MVGGGGVGGGLLENANPLIYQ	2090	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30859	118.31	2	2073.0201	2073.0201	-	R	1	22
PSM	PAVLGFEGSAN	2091	sp|Q9NPF4|OSGEP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14909	59.198	2	1060.5189	1060.5189	M	K	2	13
PSM	PEINTNHLD	2092	sp|Q13907|IDI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7097	29.772	2	1051.4934	1051.4934	M	K	2	11
PSM	PEPAKSAPAP	2093	sp|Q16778|H2B2E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4550	19.349	2	963.50255	963.5025	M	K	2	12
PSM	PFLELDTNLPAN	2094	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=23375	88.837	2	1342.6769	1342.6769	M	R	2	14
PSM	PFLELDTNLPAN	2095	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=23501	89.301	2	1342.6769	1342.6769	M	R	2	14
PSM	PFLELDTNLPAN	2096	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=23615	89.761	2	1342.6769	1342.6769	M	R	2	14
PSM	PFLELDTNLPAN	2097	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=23734	90.23	2	1342.6769	1342.6769	M	R	2	14
PSM	PLYEGLGSGGE	2098	sp|Q9NZ32|ARP10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13449	53.988	2	1077.4979	1077.4979	M	K	2	13
PSM	PPYTVVYFPVRG	2099	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=20131	76.994	2	1393.7394	1393.7394	M	R	2	14
PSM	PSSSDTALGGGGGLSWAE	2100	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=19582	75.116	2	1647.7376	1647.7376	M	K	2	20
PSM	PVAVGPYGQSQPSCFD	2101	sp|P60602-2|ROMO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:4	ms_run[2]:scan=15694	62.04	3	1707.7563	1707.7563	M	R	2	18
PSM	PYQYPALTPEQ	2102	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15063	59.767	2	1305.6241	1305.6241	M	K	2	13
PSM	PYQYPALTPEQK	2103	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12873	51.796	2	1433.7191	1433.7191	M	K	2	14
PSM	RAGPVVVVAPGPPVTTATSAPVTLVAPGEA	2104	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=21853	83.165	3	2780.5436	2780.5436	S	R	29	59
PSM	RAGPVVVVAPGPPVTTATSAPVTLVAPGEA	2105	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=21868	83.217	3	2780.5436	2780.5436	S	R	29	59
PSM	RAGPVVVVAPGPPVTTATSAPVTLVAPGEA	2106	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=22008	83.694	3	2780.5436	2780.5436	S	R	29	59
PSM	RVELPGTAVPSVPEDAAPAS	2107	sp|P55011-3|S12A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16196	63.821	2	1962.0058	1962.0058	A	R	31	51
PSM	SAEVPEAASAEEQ	2108	sp|P56211|ARP19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=12227	49.415	2	1358.5838	1358.5838	M	K	2	15
PSM	SAEVPEAASAEEQKEMED	2109	sp|P56211|ARP19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=12563	50.649	2	2006.8263	2006.8263	M	K	2	20
PSM	SANEDQEMELEAL	2110	sp|Q6NW29|RWDD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=21750	82.806	2	1535.6297	1535.6297	M	R	2	15
PSM	SAQGDCEFLVQ	2111	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=20442	78.039	2	1294.55	1294.5500	M	R	2	13
PSM	SATAATAPPAAPAGEGGPPAPPPNLTSN	2112	sp|P63027|VAMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=17891	69.523	3	2523.2241	2523.2241	M	R	2	30
PSM	SCINLPTVLPGSPSKT	2113	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=22482	85.493	2	1711.8815	1711.8815	M	R	2	18
PSM	SDDKPFLCTAPGCGQ	2114	sp|P15336-7|ATF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=15228	60.378	2	1693.7076	1693.7076	M	R	2	17
PSM	SDQDHSMDEMTAVV	2115	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=8455	35.228	2	1637.6185	1637.6185	M	K	2	16
PSM	SDQIKFIMDSLN	2116	sp|Q8WYA0-3|IFT81_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=25151	96.07	2	1467.6915	1467.6915	M	K	2	14
PSM	SDTAVADTR	2117	sp|Q9UMY4-3|SNX12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=5596	23.676	2	976.44615	976.4462	M	R	2	11
PSM	SEKENNFPPLP	2118	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=17984	69.834	2	1312.6299	1312.6299	M	K	2	13
PSM	SESGHSQPGLYGIE	2119	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=14991	59.495	2	1501.6685	1501.6685	M	R	2	16
PSM	SGALDVLQM	2120	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=22502	85.563	2	990.4692	990.4692	M	K	2	11
PSM	SGALDVLQM	2121	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=22763	86.494	2	990.4692	990.4692	M	K	2	11
PSM	SGALDVLQMKEEDVL	2122	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=27830	106.97	2	1687.8339	1687.8339	M	K	2	17
PSM	SGDSSGRGPEG	2123	sp|Q9NXX6-2|NSE4A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=3996	16.898	2	1046.4265	1046.4265	M	R	2	13
PSM	SGELPPNINIKEP	2124	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=19175	73.869	2	1448.7511	1448.7511	M	R	2	15
PSM	SGGGPSGGGPGGSG	2125	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=4233	17.989	2	1028.4159	1028.4159	M	R	2	16
PSM	SLSDWHLAV	2126	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=26563	101.85	2	1068.524	1068.5240	M	K	2	11
PSM	SLVIPEKFQHIL	2127	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=25788	98.616	2	1464.8341	1464.8341	M	R	2	14
PSM	SLYPSLEDLKVD	2128	sp|O00560-2|SDCB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=26627	102.12	2	1419.7133	1419.7133	M	K	2	14
PSM	SLYPSLEDLKVD	2129	sp|O00560-2|SDCB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=26734	102.56	2	1419.7133	1419.7133	M	K	2	14
PSM	SSIGTGYDLSASTFSPDG	2130	sp|P25788-2|PSA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=25584	97.755	2	1802.7847	1802.7847	M	R	2	20
PSM	STGTFVVSQPLNY	2131	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=25256	96.476	2	1453.7089	1453.7089	M	R	2	15
PSM	STPAVPQDLQLPPSQ	2132	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=22190	84.41	2	1618.8203	1618.8203	M	R	2	17
PSM	STPAVPQDLQLPPSQ	2133	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=23389	88.886	2	1618.8203	1618.8203	M	R	2	17
PSM	STPPLAASGMAPGPFAGPQAQQAA	2134	sp|Q96HR3-2|MED30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=21920	83.38	2	2280.0845	2280.0845	M	R	2	26
PSM	SVELEEALPVTTAEGMA	2135	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1,16-UNIMOD:35	ms_run[2]:scan=26985	103.6	2	1803.8448	1803.8448	M	K	2	19
PSM	SVNYAAGLSPYAD	2136	sp|Q8N6T7-2|SIR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=23127	87.862	2	1368.6198	1368.6198	M	K	2	15
PSM	SYAEKPDEIT	2137	sp|Q9NWU2|GID8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=10509	43.188	2	1193.5452	1193.5452	M	K	2	12
PSM	SYTPGVGGDPAQLAQ	2138	sp|O15400-2|STX7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=18862	72.798	2	1501.7049	1501.7049	M	R	2	17
PSM	TSMASLFSFTSPAVK	2139	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=30023	115.23	2	1614.7963	1614.7963	M	R	2	17
PSM	TTPNKTPPGADP	2140	sp|Q9UM13|APC10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:1	ms_run[2]:scan=6339	26.628	2	1236.5986	1236.5986	M	K	2	14
PSM	VGQLSEGAIAAIMQ	2141	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=23736	90.237	2	1386.7177	1386.7177	M	K	2	16
PSM	VMEKPSPLLVG	2142	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=10345	42.557	2	1184.6475	1184.6475	M	R	2	13
PSM	DDDIAALVVDNGSGMC	2143	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30489	116.9789022096	2	1693.6912	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2144	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32108	123.06557709973335	2	1693.7042	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2145	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=28188	108.30812121546666	2	1693.7222	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2146	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31896	122.29062436720001	2	1693.6912	1692.6962	M	K	2	18
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	2147	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=20182	77.16850481013333	3	2849.444012	2849.424444	P	R	634	661
PSM	AETLSGLGDSGAAGAAALSSASSETGT	2148	sp|Q15424|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=26126	100.03953748746667	3	2380.1022	2380.0872	M	R	2	29
PSM	SETAPAAPAAPAPAE	2149	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=11878	48.12818537253334	2	1391.6638	1391.6564	M	K	2	17
PSM	ETAPAAPAAPAPAE	2150	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=8209	34.259893777866665	2	1262.6234	1262.6138	S	K	3	17
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2151	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17682	68.87420430853334	3	3506.600765	3505.576600	T	-	609	647
PSM	AAVAAAGAGEPQSPDELLP	2152	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=26321	100.79958799466667	2	1804.8962	1804.8842	A	K	3	22
PSM	ETAPAAPAAAPPAE	2153	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=7975	33.2565280792	2	1262.6226	1262.6138	S	K	3	17
PSM	SNGYEDHMAEDCRGDIG	2154	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=12546	50.57009689466667	2	1967.7372	1966.7412	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	2155	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=8854	36.82597313546667	2	1983.7332	1982.7362	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	2156	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=9316	38.598897879733336	2	1983.7352	1982.7362	M	R	2	19
PSM	SNGYEDHMAEDCRGDIG	2157	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=8972	37.27683645973333	2	1983.7342	1982.7362	M	R	2	19
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPP	2158	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=28721	110.37842285386667	3	3296.4222	3296.4002	M	K	2	31
PSM	ASQSQGIQQLLQAE	2159	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=26063	99.76840991706668	2	1541.7774	1541.7680	M	K	2	16
PSM	MDGIVPDIAVGTK	2160	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21006	80.07142337706667	2	1373.702848	1372.690818	-	R	1	14
PSM	SEAGEATTTTTTTLPQAPTEAAAAAPQD	2161	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=18286	70.84656913573333	3	2743.2852	2743.2662	M	P	2	30
PSM	ADDLDFETGDAGASATFPMQCSAL	2162	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,21-UNIMOD:4	ms_run[1]:scan=31902	122.30935131999999	3	2531.0602	2531.0462	M	R	2	26
PSM	AAAEAANCIMEVSCGQAESSE	2163	sp|Q99873-3|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=23494	89.27489640453334	3	2241.8952	2241.8822	M	K	2	23
PSM	ASGQGPGPPRQECGEPALPSASEEQVAQDTEEVF	2164	sp|Q16611|BAK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=24780	94.5049168488	3	3595.6212	3595.6002	M	R	2	36
PSM	MEQEPQNGEPAEIKII	2165	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1	ms_run[1]:scan=22238	84.59855950106666	2	1866.915586	1866.903330	-	R	1	17
PSM	AFLASGPYLTHQQ	2166	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=14812	58.86340602133334	2	1432.7252	1431.7142	M	K	2	15
PSM	AGITTIEAVK	2167	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=16047	63.303638232266664	2	1043.5902	1043.5858	M	R	2	12
PSM	PSETPQAEVGPTGCPH	2168	sp|P0DN79|CBSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	14-UNIMOD:4	ms_run[1]:scan=7812	32.57010186746667	2	1663.7242	1662.7302	M	R	2	18
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQ	2169	sp|Q9H2V7|SPNS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=26480	101.48690801786667	4	4714.1582	4714.1312	M	R	2	49
PSM	AEGSAVSDPQHAA	2170	sp|Q9H2C0|GAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=7184	30.135621540266666	2	1281.5502	1280.5632	M	R	2	15
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	2171	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	22-UNIMOD:35	ms_run[1]:scan=16089	63.45401227706667	3	2714.407513	2714.388392	K	R	123	152
PSM	AEAEEDCHSDTV	2172	sp|Q9UK97-2|FBX9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,7-UNIMOD:4	ms_run[1]:scan=7594	31.766113854933334	2	1403.5232	1403.5142	M	R	2	14
PSM	SFDPNLLHNNGHNGYPNGTSAAL	2173	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=22073	83.94656209013333	3	2452.1182	2451.1202	M	R	2	25
PSM	PAIMTMLADHAA	2174	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=10406	42.785705276	2	1240.5832	1240.5942	M	R	2	14
PSM	AETAAGVGRF	2175	sp|Q12788|TBL3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=13665	54.7896518968	2	1019.5085	1019.5031	M	K	2	12
PSM	AENGESSGPPRPS	2176	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=5949	25.068080703466666	2	1326.5762	1325.5842	M	R	2	15
PSM	AENGESSGPPRPS	2177	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=6120	25.725180120266668	2	1326.5772	1325.5842	M	R	2	15
PSM	AENGESSGPPRPS	2178	sp|Q9UHD9|UBQL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=6238	26.1987745064	2	1326.5772	1325.5842	M	R	2	15
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2179	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17974	69.80448718186668	3	3230.423081	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2180	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19940	76.30456099439999	3	3215.428569	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2181	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18132	70.31955639013333	3	3230.423081	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2182	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18559	71.7476772128	3	3230.423715	3230.402859	Q	R	630	663
PSM	PGGLLLGDVAPNFEANTTVG	2183	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=27235	104.58136491226666	2	1941.9802	1940.9842	M	R	2	22
PSM	SSEMLPAFIETSNVDK	2184	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=26087	99.86948837493333	2	1809.8582	1808.8502	M	K	2	18
PSM	ADQGEKENPM	2185	sp|P62913-2|RL11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,10-UNIMOD:35	ms_run[1]:scan=4162	17.669173118666667	2	1175.4838	1175.4759	M	R	2	12
PSM	MEERGDSEPTPGCSGLGPGGV	2186	sp|Q8WW01|SEN15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=16436	64.67606188906667	2	2130.922703	2129.899384	-	R	1	22
PSM	AAAAGAAAAAAAEGEAPAEMGALLLE	2187	sp|Q96KQ7|EHMT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,20-UNIMOD:35	ms_run[1]:scan=31446	120.516862164	3	2326.1382	2325.1152	M	K	2	28
PSM	VDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWD	2188	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,27-UNIMOD:35,31-UNIMOD:35	ms_run[1]:scan=20710	78.97788130320001	3	4003.5542	4001.5282	M	R	2	40
PSM	PFLELDTNLPAN	2189	sp|A6NHG4|DDTL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=24569	93.6131337416	2	1343.6712	1342.6762	M	R	2	14
PSM	METVISSDSSPAVENEHPQETPESNNSVYTSFM	2190	sp|P54619|AAKG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20941	79.83341264373333	3	3716.581681	3716.561798	-	K	1	34
PSM	AQPGTLNLNNEVVKM	2191	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,15-UNIMOD:35	ms_run[1]:scan=16593	65.21336649466667	2	1684.8562	1684.8452	M	R	2	17
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	2192	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=22377	85.09977886426667	3	3105.4092	3105.3902	M	R	2	37
PSM	RVTEAPCYPGAPSTEASGQTGPQEPTSA	2193	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=11655	47.28760818453333	3	2847.309472	2845.282466	P	R	517	545
PSM	MDELAGGGGGGPGMAAPP	2194	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17574	68.53733582853333	2	1598.680382	1598.670493	-	R	1	19
PSM	SDEKNLGVSQ	2195	sp|Q9H4L5|OSBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=7003	29.36579378133333	2	1117.5327	1117.5246	M	K	3	13
PSM	MEQPMQNGEEDRPLGGGEGHQPAGN	2196	sp|Q00994-2|BEX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=8028	33.47906393946667	3	2708.139243	2708.119107	-	R	1	26
PSM	TSTGKDGGAQHAQYVGPY	2197	sp|Q8IWQ3|BRSK2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=9844	40.6016772152	3	1877.8652	1877.8542	M	R	2	20
PSM	MPYQYPALTPEQK	2198	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=12304	49.71793851493333	2	1580.723461	1580.754481	-	K	1	14
PSM	MEPEQMLEGQTQVAENPHSEYGLTDNVE	2199	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=19692	75.47468787173334	3	3248.395126	3248.376169	-	R	1	29
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	2200	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=20552	78.42848315173333	4	3482.709848	3482.688399	N	R	398	434
PSM	AAAAAAGAGPEMV	2201	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=13464	54.044	2	1143.523	1143.5230	M	R	2	15
PSM	AAAAAATAAAAASI	2202	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=26971	103.54	2	1142.5932	1142.5932	M	R	2	16
PSM	AAAAAATAAAAASI	2203	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=27073	103.96	2	1142.5932	1142.5932	M	R	2	16
PSM	AAAAAGLGGGGAGPGPEAGDFLA	2204	sp|P23610|HAP40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=27211	104.49	2	1895.9014	1895.9014	M	R	2	25
PSM	AAAADSFSGGPAGV	2205	sp|Q96E14|RMI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=19595	75.149	2	1218.5517	1218.5517	M	R	2	16
PSM	AAAAVSSAK	2206	sp|P49914|MTHFS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5990	25.204	2	816.43413	816.4341	M	R	2	11
PSM	AAAEAANCIMEVSCGQAESSE	2207	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=28164	108.23	3	2225.8875	2225.8875	M	K	2	23
PSM	AAAEEEPKP	2208	sp|P55263-3|ADK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6842	28.687	2	982.46074	982.4607	M	K	2	11
PSM	AAEAADLGLGAAVPVEL	2209	sp|Q9Y5Q8-2|TF3C5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=32524	124.54	2	1607.8407	1607.8407	M	R	2	19
PSM	AAEPNKTEIQTLF	2210	sp|Q8N6H7|ARFG2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=22793	86.601	2	1502.7617	1502.7617	M	K	2	15
PSM	AAHGGSAASSAL	2211	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6999	29.351	2	1040.4887	1040.4887	M	K	2	14
PSM	AALGSPSHTF	2212	sp|Q96HJ9|FMC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=14304	57.072	2	1028.4927	1028.4927	M	R	2	12
PSM	AANATTNPSQLLPLELVDKCIGS	2213	sp|Q9Y4Y9|LSM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,20-UNIMOD:4	ms_run[2]:scan=31629	121.25	3	2453.2472	2453.2472	M	R	2	25
PSM	AAQGVGPGPGSAAPPGLEAA	2214	sp|Q6P582|MZT2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18934	73.051	2	1715.8479	1715.8479	M	R	2	22
PSM	AASEVAGVVANAPSPPESSSLCAS	2215	sp|Q8ND24-2|RN214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,22-UNIMOD:4	ms_run[2]:scan=24499	93.337	3	2299.0638	2299.0638	M	K	2	26
PSM	ADAAASPVGK	2216	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6130	25.761	2	927.46616	927.4662	M	R	2	12
PSM	ADAAPQLGK	2217	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8141	33.963	2	911.47125	911.4712	M	R	2	11
PSM	ADGGAASQDESSAAAAAAADS	2218	sp|P14859-5|PO2F1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=14028	56.005	2	1834.7453	1834.7453	M	R	2	23
PSM	ADHSFSDGVPSDSVEAA	2219	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=14870	59.057	2	1731.7224	1731.7224	M	K	2	19
PSM	ADHSFSDGVPSDSVEAA	2220	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=15000	59.531	2	1731.7224	1731.7224	M	K	2	19
PSM	ADKMDMSLDDII	2221	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=24853	94.823	2	1423.6211	1423.6211	M	K	2	14
PSM	ADNLSDTLK	2222	sp|P52306-6|GDS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12658	51.019	2	1017.4979	1017.4979	M	K	2	11
PSM	ADSKEGVLPLTAASTAPISFGFT	2223	sp|Q92917|GPKOW_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=31069	119.1	2	2321.1791	2321.1791	M	R	2	25
PSM	AEEQEFTQLC	2224	sp|Q53GT1|KLH22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=20907	79.716	2	1295.534	1295.5340	M	K	2	12
PSM	AEFTSYKETASS	2225	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=13342	53.595	2	1361.5987	1361.5987	M	R	2	14
PSM	AENPSLENH	2226	sp|O00505|IMA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=6820	28.605	2	1051.4571	1051.4571	M	R	2	11
PSM	AERGELDLTGA	2227	sp|P13984|T2FB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=15021	59.609	2	1172.5673	1172.5673	M	K	2	13
PSM	AESDWDTVTVL	2228	sp|O60869-2|EDF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=29787	114.3	2	1276.5823	1276.5823	M	R	2	13
PSM	AGSVADSDAVV	2229	sp|Q3ZCW2|LEGL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=14936	59.304	2	1031.4771	1031.4771	M	K	2	13
PSM	AGYEYVSPEQLAGFDKY	2230	sp|Q9C0D9|EPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=27127	104.17	2	1977.8996	1977.8996	M	K	2	19
PSM	AKISSPTETE	2231	sp|P31949|S10AB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7692	32.161	2	1103.5346	1103.5346	M	R	2	12
PSM	ALETVPKDL	2232	sp|P63272|SPT4H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18869	72.823	2	1026.5597	1026.5597	M	R	2	11
PSM	AMSSGGSGGGVPEQEDSVLF	2233	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=24231	92.266	2	1967.8419	1967.8419	M	R	2	22
PSM	AMSSGGSGGGVPEQEDSVLF	2234	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=24354	92.758	2	1967.8419	1967.8419	M	R	2	22
PSM	AMSSGGSGGGVPEQEDSVLF	2235	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=24474	93.234	2	1967.8419	1967.8419	M	R	2	22
PSM	AMSSGGSGGGVPEQEDSVLF	2236	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=26470	101.45	2	1951.8469	1951.8469	M	R	2	22
PSM	APLDLDKYVEIA	2237	sp|O00743-2|PPP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=23126	87.858	2	1345.7129	1345.7129	M	R	2	14
PSM	AQESPKNSAAEIPVTSNGEVDDS	2238	sp|P53367-3|ARFP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=13631	54.668	3	2386.0772	2386.0772	M	R	2	25
PSM	AQFVRNLVE	2239	sp|O75964|ATP5L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25250	96.453	2	1116.5928	1116.5928	M	K	2	11
PSM	AQGLIEVER	2240	sp|Q9BU02-2|THTPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=15971	63.022	2	1055.5611	1055.5611	M	K	2	11
PSM	AQWNQLQQLDT	2241	sp|P40763-3|STAT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25093	95.826	2	1385.6575	1385.6575	M	R	2	13
PSM	ARGSVSDEEMMEL	2242	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=15024	59.617	2	1510.628	1510.6280	M	R	2	15
PSM	ASASYHISNLLE	2243	sp|Q86VP6-2|CAND1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=21827	83.083	2	1345.6514	1345.6514	M	K	2	14
PSM	ASLLKVDQEV	2244	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=20989	80.01	2	1142.6183	1142.6183	M	K	2	12
PSM	ASPGHSDLGEVAPEI	2245	sp|Q8TCY9-2|URGCP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18644	72.038	2	1519.7155	1519.7155	M	K	2	17
PSM	ASSSGSKAEFIVGG	2246	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=13950	55.771	2	1337.6463	1337.6463	M	K	2	16
PSM	ATFVSELEAAK	2247	sp|Q96BN2|TADA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25685	98.189	2	1206.6132	1206.6132	M	K	2	13
PSM	ATFVSELEAAK	2248	sp|Q96BN2|TADA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25799	98.664	2	1206.6132	1206.6132	M	K	2	13
PSM	AVQESAAQLSMTL	2249	sp|Q7L5Y9-5|MAEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=24653	93.981	2	1405.6759	1405.6759	M	K	2	15
PSM	AVSTGVKVP	2250	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12711	51.212	2	898.51238	898.5124	M	R	2	11
PSM	AVSTGVKVP	2251	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12839	51.67	2	898.51238	898.5124	M	R	2	11
PSM	AVSTGVKVP	2252	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12961	52.133	2	898.51238	898.5124	M	R	2	11
PSM	AVSTGVKVP	2253	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=13087	52.624	2	898.51238	898.5124	M	R	2	11
PSM	AVTLDKDAYY	2254	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=17623	68.68	2	1199.571	1199.5710	M	R	2	12
PSM	CDKEFMWAL	2255	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=27893	107.23	2	1240.5257	1240.5257	M	K	2	11
PSM	CSLGLFPPPPP	2256	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=28718	110.36	2	1222.6056	1222.6056	M	R	2	13
PSM	CSLGLFPPPPP	2257	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=28947	111.21	2	1222.6056	1222.6056	M	R	2	13
PSM	CSLGLFPPPPP	2258	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=29184	112.07	2	1222.6056	1222.6056	M	R	2	13
PSM	DDDIAALVVDNGSGMC	2259	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=24246	92.329	2	1708.692	1708.6920	M	K	2	18
PSM	GDPSKQDILTIF	2260	sp|Q9NP61-2|ARFG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=28149	108.17	2	1374.7031	1374.7031	M	K	2	14
PSM	GDPSKQDILTIF	2261	sp|Q9NP61-2|ARFG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=28263	108.62	2	1374.7031	1374.7031	M	K	2	14
PSM	GEKSENCGVPEDLLNGL	2262	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25052	95.641	2	1871.8571	1871.8571	M	K	2	19
PSM	GNRGMEELIPLVN	2263	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25315	96.698	2	1482.7501	1482.7501	M	K	2	15
PSM	GNRGMEELIPLVN	2264	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25439	97.166	2	1482.7501	1482.7501	M	K	2	15
PSM	GPPGPALPATMNNSSSET	2265	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:35	ms_run[2]:scan=9989	41.137	2	1742.7781	1742.7781	M	R	2	20
PSM	GSGPIDPKELL	2266	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=22807	86.662	2	1166.6183	1166.6183	M	K	2	13
PSM	GVQVETISPGDGRTFP	2267	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16194	63.813	2	1658.8264	1658.8264	M	K	2	18
PSM	GVTCVSQMPVAEG	2268	sp|Q9H944-2|MED20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:4	ms_run[2]:scan=12312	49.752	2	1333.6006	1333.6006	M	K	2	15
PSM	KAQFAQPEILIGTIPGAGGTQ	2269	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=22181	84.372	3	2096.1266	2096.1266	E	R	157	178
PSM	KGIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNS	2270	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=18282	70.83	3	3375.608	3375.6080	A	R	642	678
PSM	KGIPLATGDTSPEPELLPGAPLPPP	2271	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=23516	89.354	3	2463.3261	2463.3261	L	K	32	57
PSM	KLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTS	2272	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=24553	93.556	3	3518.5254	3518.5254	I	R	693	727
PSM	KLLDAVDTYIPVPA	2273	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=24294	92.518	2	1513.8392	1513.8392	Q	R	238	252
PSM	KLPTAPFGCAPGTSFLQVTPPTSQNTTA	2274	sp|Q8ND82|Z280C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:4	ms_run[2]:scan=23499	89.297	3	2888.4378	2888.4378	S	R	522	550
PSM	KLVQDVANNTNEEAGDGTTTATVLA	2275	sp|P10809-2|CH60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=14330	57.155	3	2531.2351	2531.2351	A	R	96	121
PSM	KPVAVPEEQPVAESGLLA	2276	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16088	63.449	2	1832.9884	1832.9884	S	R	320	338
PSM	KTAPVQAPPAPVIVTETPEPAMTSGVY	2277	sp|Q9UKY7|CDV3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	22-UNIMOD:35	ms_run[2]:scan=17954	69.737	2	2766.415	2766.4150	N	R	143	170
PSM	KTPETVVPAAPELQPSTSTDQPVTPEPTS	2278	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16226	63.926	3	3003.4924	3003.4924	V	R	1261	1290
PSM	KTPETVVPAAPELQPSTSTDQPVTPEPTS	2279	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16235	63.965	3	3003.4924	3003.4924	V	R	1261	1290
PSM	KTPVEEVPAAIAPFQG	2280	sp|Q15393-3|SF3B3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=18821	72.65	2	1652.8774	1652.8774	H	R	124	140
PSM	KVPADTEVVCAPPTAYIDFA	2281	sp|P60174-3|TPIS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=22981	87.294	2	2163.0558	2163.0558	A	R	70	90
PSM	KVVAPTISSPVCQEQLVEAG	2282	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:4	ms_run[2]:scan=16532	64.992	3	2111.0933	2111.0933	T	R	721	741
PSM	MDAAEVEFLAE	2283	sp|Q9Y248|PSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=31800	121.93	2	1265.5486	1265.5486	-	K	1	12
PSM	MDDKELIEYF	2284	sp|Q14232-2|EI2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26193	100.3	2	1359.5904	1359.5904	-	K	1	11
PSM	MDDKGDPSNEEAP	2285	sp|Q9BTC0-2|DIDO1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=8709	36.24	2	1445.5617	1445.5617	-	K	1	14
PSM	MDFLLGNPFSSPVGQ	2286	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=33175	126.66	2	1665.7709	1665.7709	-	R	1	16
PSM	MDGASAEQDGLQED	2287	sp|Q08378-4|GOGA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10506	43.181	2	1522.5729	1522.5729	-	R	1	15
PSM	MDGIVPDIAVGTK	2288	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23675	89.993	2	1372.6908	1372.6908	-	R	1	14
PSM	MDGIVPDIAVGTK	2289	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=23883	90.799	2	1356.6959	1356.6959	-	R	1	14
PSM	MDNLSDTLK	2290	sp|P52306-2|GDS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=17171	67.216	2	1077.5012	1077.5012	-	K	1	10
PSM	MDPLFQQTH	2291	sp|O14653-3|GOSR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15184	60.219	2	1173.5125	1173.5125	-	K	1	10
PSM	MDPLFQQTH	2292	sp|O14653-3|GOSR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=20987	80.005	2	1157.5175	1157.5175	-	K	1	10
PSM	MDPSGVKVLETAEDIQE	2293	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22677	86.196	2	1917.8877	1917.8877	-	R	1	18
PSM	MDSAGQDINLNSPN	2294	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13816	55.312	2	1532.6413	1532.6413	-	K	1	15
PSM	MDSVEKGAATSVSNP	2295	sp|Q8NFW8-2|NEUA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9997	41.168	2	1549.693	1549.6930	-	R	1	16
PSM	MDYLTTFTEKSG	2296	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22201	84.457	2	1449.6334	1449.6334	-	R	1	13
PSM	MEAAAEPGNLAGV	2297	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=22764	86.497	2	1270.5864	1270.5864	-	R	1	14
PSM	MEATGVLPFV	2298	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30588	117.34	2	1120.5474	1120.5474	-	R	1	11
PSM	MEDLVQDGVASPATPGTG	2299	sp|Q8IWJ2-3|GCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25337	96.79	2	1785.8091	1785.8091	-	K	1	19
PSM	MEDMNEYSNIEEFAEGS	2300	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26010	99.542	2	2067.7561	2067.7561	-	K	1	18
PSM	MEDYTKIE	2301	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=16193	63.812	2	1069.4638	1069.4638	-	K	1	9
PSM	MEDYTKIE	2302	sp|P06493-2|CDK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=16208	63.868	2	1069.4638	1069.4638	-	K	1	9
PSM	MEEASEGGGND	2303	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4324	18.396	2	1152.3877	1152.3877	-	R	1	12
PSM	MEEDQELER	2304	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7722	32.272	2	1235.4976	1235.4976	-	K	1	10
PSM	MEEEQDLPEQPVK	2305	sp|Q99504-5|EYA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11748	47.609	2	1628.724	1628.7240	-	K	1	14
PSM	MEEVVIAGMSG	2306	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=23246	88.324	2	1179.5152	1179.5152	-	K	1	12
PSM	MEGNRDEAE	2307	sp|Q8TBM8|DJB14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=5511	23.32	2	1091.419	1091.4190	-	K	1	10
PSM	MELLCHEVDPVR	2308	sp|P30279-2|CCND2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=16809	65.989	2	1554.717	1554.7171	-	R	1	13
PSM	MEPAVSEPMRDQVA	2309	sp|Q15738|NSDHL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=16475	64.792	2	1600.7225	1600.7225	-	R	1	15
PSM	MEPEEGTPLW	2310	sp|Q9NX08|COMD8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24703	94.183	2	1245.5224	1245.5224	-	R	1	11
PSM	MEPGPDGPAASGPAAI	2311	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=20736	79.071	2	1478.6711	1478.6711	-	R	1	17
PSM	MEQANPLRPDGES	2312	sp|Q9BU64|CENPO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=14422	57.459	2	1484.6566	1484.6566	-	K	1	14
PSM	METILEQQR	2313	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11966	48.443	2	1204.5758	1204.5758	-	R	1	10
PSM	MEVAANCSL	2314	sp|Q96RS6|NUDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=13613	54.597	2	1051.4314	1051.4314	-	R	1	10
PSM	MFEEKASSPSG	2315	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12334	49.824	2	1210.5176	1210.5176	-	K	1	12
PSM	MHPAGLAAAAAGTP	2316	sp|Q5BJH7-4|YIF1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=15799	62.419	2	1276.6234	1276.6234	-	R	1	15
PSM	MLGNSAPGPAT	2317	sp|P20248|CCNA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10462	43.034	2	1072.4859	1072.4859	-	R	1	12
PSM	MLGTEGGEGFVV	2318	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=17685	68.883	2	1210.554	1210.5540	M	K	2	14
PSM	MLGTEGGEGFVV	2319	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25410	97.064	2	1252.5646	1252.5646	M	K	2	14
PSM	MMLGTEGGEGFVV	2320	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28369	109.03	2	1383.605	1383.6050	-	K	1	14
PSM	MNAGSDPVVIVSAA	2321	sp|Q9BWD1|THIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=24662	94.02	2	1371.6704	1371.6704	-	R	1	15
PSM	MNIMDFNVK	2322	sp|Q9Y371|SHLB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20419	77.956	2	1168.5257	1168.5257	-	K	1	10
PSM	MNPTETKAV	2323	sp|P20810-4|ICAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6309	26.499	2	1047.4907	1047.4907	-	K	1	10
PSM	MPFLELDTNLPAN	2324	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=26369	101.01	2	1473.7174	1473.7174	-	R	1	14
PSM	MQNPQILAALQE	2325	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=21459	81.697	2	1354.6915	1354.6915	M	R	2	14
PSM	MTMDKSELVQ	2326	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10594	43.513	2	1238.5523	1238.5523	-	K	1	11
PSM	MTMDKSELVQ	2327	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=11177	45.707	2	1238.5523	1238.5523	-	K	1	11
PSM	MTMDKSELVQ	2328	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=15496	61.329	2	1222.5574	1222.5574	-	K	1	11
PSM	MTTDEGAKNNEESPTATVAEQGEDITS	2329	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=16401	64.552	3	2866.2298	2866.2298	-	K	1	28
PSM	MVDYYEVLGVQ	2330	sp|O75190-2|DNJB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=22459	85.418	2	1330.6115	1330.6115	-	R	1	12
PSM	PAVSLPPKENALF	2331	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=20160	77.084	2	1381.7606	1381.7606	M	K	2	15
PSM	PDELTEPGRATPA	2332	sp|Q9NP08|HMX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7704	32.207	2	1352.6572	1352.6572	M	R	2	15
PSM	PEFLEDPSVLT	2333	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=22128	84.164	2	1245.6129	1245.6129	M	K	2	13
PSM	PGSLPLNAEACWP	2334	sp|Q01581|HMCS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:4	ms_run[2]:scan=22566	85.806	2	1410.6602	1410.6602	M	K	2	15
PSM	PLENLEEEGLP	2335	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=19284	74.244	2	1238.603	1238.6030	M	K	2	13
PSM	PLFTANPFEQDVE	2336	sp|O75886-2|STAM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=25113	95.914	2	1505.7038	1505.7038	M	K	2	15
PSM	PPPQGDVTALFLGPPGLG	2337	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=28753	110.49	2	1731.9196	1731.9196	M	K	2	20
PSM	PPYTVVYFPVRG	2338	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=19473	74.786	2	1393.7394	1393.7394	M	R	2	14
PSM	PSETPQAEVGPTGCPH	2339	sp|P35520|CBS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:4	ms_run[2]:scan=7285	30.528	3	1662.7308	1662.7308	M	R	2	18
PSM	PTTQQSPQDEQE	2340	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4119	17.465	2	1386.5899	1386.5899	M	K	2	14
PSM	PYQYPALTPEQ	2341	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=15193	60.257	2	1305.6241	1305.6241	M	K	2	13
PSM	RAIAELGIYPAVDPLDSTS	2342	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=23646	89.876	2	1987.0262	1987.0262	S	R	387	406
PSM	RVMTIPYQPMPASSPVICAGGQD	2343	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=15218	60.337	3	2506.1655	2506.1655	G	R	177	200
PSM	SAAQVSSSR	2344	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4681	19.887	2	933.45157	933.4516	M	R	2	11
PSM	SAAVTAGKLA	2345	sp|P53350|PLK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=10773	44.223	2	929.5182	929.5182	M	R	2	12
PSM	SAGSATHPGAGG	2346	sp|Q7Z7F0-4|KHDC4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=4208	17.872	2	1010.4417	1010.4417	M	R	2	14
PSM	SAIQNLHSFDPFADAS	2347	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=28528	109.66	2	1760.8006	1760.8006	M	K	2	18
PSM	SATVVDAVNAAPLSGS	2348	sp|O95391|SLU7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=23236	88.282	2	1499.7468	1499.7468	M	K	2	18
PSM	SCGRPPPDVDGMITL	2349	sp|Q9BRL6-2|SRSF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=18073	70.128	2	1671.7596	1671.7596	M	K	2	17
PSM	SEKENNFPPLP	2350	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18124	70.298	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	2351	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18619	71.951	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	2352	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18762	72.448	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	2353	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=19034	73.393	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	2354	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=19950	76.341	2	1312.6299	1312.6299	M	K	2	13
PSM	SETAPAAPAAAPPAE	2355	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8214	34.279	2	1349.6463	1349.6463	M	K	2	17
PSM	SETAPAAPAAAPPAE	2356	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8263	34.47	2	1349.6463	1349.6463	M	K	2	17
PSM	SGALDVLQM	2357	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=22632	86.04	2	990.4692	990.4692	M	K	2	11
PSM	SGDEMIFDPTMSK	2358	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=15488	61.302	2	1530.6218	1530.6218	M	K	2	15
PSM	SGELPPNINIKEP	2359	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=18498	71.548	2	1448.7511	1448.7511	M	R	2	15
PSM	SGPDVETPSAIQIC	2360	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=21607	82.251	2	1514.6923	1514.6923	M	R	2	16
PSM	SHTILLVQPT	2361	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=17243	67.469	2	1149.6394	1149.6394	M	K	2	12
PSM	SIMSYNGGAVMAM	2362	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=19722	75.582	2	1404.5724	1404.5724	M	K	2	15
PSM	SKAHPPEL	2363	sp|P62308|RUXG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=7074	29.669	2	919.47633	919.4763	M	K	2	10
PSM	SNGYEDHMAEDCRGDIG	2364	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8308	34.647	2	1982.7371	1982.7371	M	R	2	19
PSM	SQERPTFY	2365	sp|Q16539-5|MK14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=12604	50.803	2	1068.4876	1068.4876	M	R	2	10
PSM	SSAAEPPPPPPPESAPS	2366	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=11858	48.044	2	1655.7679	1655.7679	M	K	2	19
PSM	SSEMLPAFIETSNVDK	2367	sp|Q8TBZ6|TM10A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=22403	85.2	2	1824.8451	1824.8451	M	K	2	18
PSM	SSEPPPPYPGGPTAPLLEE	2368	sp|Q9H305-3|CDIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=25143	96.04	2	1975.9415	1975.9415	M	K	2	21
PSM	SSGIHVALVTGGN	2369	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=16851	66.149	2	1252.6412	1252.6412	M	K	2	15
PSM	SSLAVRDPAMD	2370	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=13970	55.82	2	1202.5601	1202.5601	M	R	2	13
PSM	SSSPWEPATLR	2371	sp|P22307-3|NLTP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=17256	67.511	2	1271.6146	1271.6146	M	R	2	13
PSM	STSVPQGHTWTQ	2372	sp|Q9NYJ1|COA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=11224	45.859	2	1369.6262	1369.6262	M	R	2	14
PSM	TELQSALLLR	2373	sp|P62253|UB2G1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=24417	92.996	2	1184.6765	1184.6765	M	R	2	12
PSM	TEWETAAPAVAETPDI	2374	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=27411	105.3	2	1741.8047	1741.8047	M	K	2	18
PSM	TMDKSELVQ	2375	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=10517	43.217	2	1091.5169	1091.5169	M	K	2	11
PSM	TQQGAALQNYNNELV	2376	sp|O43805|SSNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=21308	81.156	2	1703.8115	1703.8115	M	K	2	17
PSM	TQQGAALQNYNNELV	2377	sp|O43805|SSNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=21445	81.648	2	1703.8115	1703.8115	M	K	2	17
PSM	TSEVIEDEKQFYS	2378	sp|Q9BV86-2|NTM1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=20594	78.583	2	1615.7253	1615.7253	M	K	2	15
PSM	TTETFVKDI	2379	sp|Q9BQ15|SOSB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=19483	74.81	2	1094.5496	1094.5496	M	K	2	11
PSM	VDYYEVLGVQ	2380	sp|O75190-2|DNJB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=30968	118.71	2	1225.5867	1225.5867	M	R	2	12
PSM	VEQGDAAPLL	2381	sp|A4D1U4|DEN11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:1	ms_run[2]:scan=23431	89.042	2	1053.5342	1053.5342	M	R	2	12
PSM	VFFTCNACGESV	2382	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=16886	66.25	2	1389.5693	1389.5693	M	K	2	14
PSM	VGQLSEGAIAAIMQ	2383	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:35	ms_run[2]:scan=17500	68.303	2	1402.7126	1402.7126	M	K	2	16
PSM	DDDIAALVVDNGSGMC	2384	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30750	117.91922893546666	2	1692.6980	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2385	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31741	121.68495386453333	2	1710.6952	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2386	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=29594	113.61320155946667	2	1692.6942	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2387	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31720	121.59641900426666	2	1710.6952	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2388	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31877	122.21709779493334	2	1710.7082	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2389	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31651	121.3325585408	2	1709.6902	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2390	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32967	126.00915195786666	2	1709.7052	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2391	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32153	123.2372591984	2	1692.6822	1692.6962	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2392	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32347	123.94757722986667	2	1748.7539	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2393	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=30977	118.74236448933334	2	1765.7512	1764.7542	M	K	2	18
PSM	AAAAAAAAAGAAGG	2394	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=17915	69.61639467573333	2	1012.5010	1012.4932	A	R	3	17
PSM	AGVEEVAASGSHLNGDLDPDD	2395	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=23220	88.2166876536	2	2109.9122	2108.9132	M	R	2	23
PSM	AAVAAAGAGEPQSPDELLP	2396	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=26206	100.3473849352	2	1804.8962	1804.8842	A	K	3	22
PSM	AEEQPQVELFVKAGSDGA	2397	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=23432	89.04487306666667	3	1915.9262	1915.9162	M	K	2	20
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPP	2398	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=28714	110.35161892986666	3	3296.4222	3296.4002	M	K	2	31
PSM	ATGANATPLDFPSK	2399	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=17520	68.37257054693333	2	1430.6945	1430.7036	M	K	2	16
PSM	PIKVGDAIPAVEVFEGEPGN	2400	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=24391	92.89080382213334	3	2037.0542	2037.0412	A	K	3	23
PSM	MDVGELLSYQPNRGT	2401	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1	ms_run[1]:scan=27431	105.3739093656	2	1720.821666	1720.809035	-	K	1	16
PSM	DEELEALR	2402	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=17192	67.28669277520001	1	973.4747	973.4711	A	R	3	11
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAG	2403	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=13660	54.7682624984	5	6491.7882	6490.7622	M	K	2	71
PSM	ADVEDGEETCALASHSGSSGS	2404	sp|Q9UBF6|RBX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,10-UNIMOD:4	ms_run[1]:scan=13465	54.0467447464	3	2106.8422	2106.8282	M	K	2	23
PSM	SSDASQGVITTPPPPSMPH	2405	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=13069	52.554088756266665	3	1962.9142	1962.8992	M	K	2	21
PSM	METPGASASSLLLPAASRPP	2406	sp|Q96DF8|ESS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22302	84.83847238773333	3	2010.020977	2010.009192	-	R	1	21
PSM	MEQEPQNGEPAEIKII	2407	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1	ms_run[1]:scan=22110	84.09876518533333	2	1866.915586	1866.903330	-	R	1	17
PSM	MLSTEGREGFVV	2408	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19153	73.80250824586666	2	1382.6642	1381.6542	M	K	2	14
PSM	SDAAVDTSSEITTKDL	2409	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=17409	68.0007855608	2	1693.8002	1693.7892	M	K	2	18
PSM	GVQVETISPGDGRTFP	2410	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=16415	64.59800181466667	2	1658.8382	1658.8262	M	K	2	18
PSM	MNSNVENLPPHII	2411	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20638	78.72201859786666	2	1534.756994	1534.744979	-	R	1	14
PSM	MEPGPDGPAASGPAAI	2412	sp|P19623|SPEE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1	ms_run[1]:scan=20607	78.61801720933333	2	1478.678980	1478.671145	-	R	1	17
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2413	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19342	74.43339117093333	3	3214.418762	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2414	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20271	77.47570907306667	3	3214.426802	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2415	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19848	75.9895031176	3	3215.428569	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2416	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20536	78.3716273224	3	3214.426802	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2417	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19695	75.48939190053333	3	3216.431603	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2418	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18276	70.81313386533334	3	3230.424320	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2419	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19586	75.13077781093332	3	3215.430009	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2420	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18800	72.5894211304	3	3214.427765	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2421	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19367	74.50626144986667	3	3214.4182	3214.4072	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2422	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18636	72.01196491173333	3	3231.425693	3230.402859	Q	R	630	663
PSM	PGGLLLGDVAPNFEANTTVG	2423	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21		ms_run[1]:scan=27243	104.61133541866667	2	1941.9802	1940.9842	M	R	2	22
PSM	KAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMT	2424	sp|P26368|U2AF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:35,18-UNIMOD:35,37-UNIMOD:35	ms_run[1]:scan=24758	94.41434252373332	4	3807.968911	3807.946071	Y	R	108	146
PSM	SAEVETSEGVDESEK	2425	sp|P30519|HMOX2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=9430	39.07572181413333	2	1637.7022	1636.6942	M	K	2	17
PSM	MEKPSPLLVG	2426	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=18172	70.45936362	1	1111.6011	1111.5942	V	R	3	13
PSM	SGSSSVAAMK	2427	sp|P63218|GBG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=6163	25.88915185786667	1	965.4551	965.4483	M	K	2	12
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	2428	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,24-UNIMOD:35	ms_run[1]:scan=17043	66.77131527706666	3	2838.216286	2838.196020	-	K	1	25
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	2429	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19841	75.96484679493332	3	2822.216217	2822.201105	-	K	1	25
PSM	RPCAPEPAASPAGPEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEA	2430	sp|P84157|MXRA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	3-UNIMOD:4	ms_run[1]:scan=22204	84.46788967440001	4	5236.4022	5236.3682	S	R	58	113
PSM	RPCAPEPAASPAGPEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEA	2431	sp|P84157|MXRA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	3-UNIMOD:4	ms_run[1]:scan=22085	83.99734089066666	4	5236.4022	5236.3682	S	R	58	113
PSM	AAAAGAAAAAAAEGEAPAEMGALLLE	2432	sp|Q96KQ7|EHMT2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,20-UNIMOD:35	ms_run[1]:scan=31427	120.43912133093333	3	2326.1382	2325.1152	M	K	2	28
PSM	ATPGNLGSSVLASKT	2433	sp|P48426|PI42A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=16622	65.3085697192	2	1443.7628	1443.7564	M	K	2	17
PSM	SAQSVEEDSILIIPTPDEEE	2434	sp|P17028|ZNF24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=30982	118.759512328	2	2243.0472	2242.0372	M	K	2	22
PSM	MEVEAVCGGAGEVEAQDSDPAPAFS	2435	sp|P35250|RFC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=23422	89.01094835066667	2	2582.083836	2580.063215	-	K	1	26
PSM	MESGPRAELGAGAPPAVVA	2436	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16333	64.30091650693333	2	1836.916353	1836.903999	-	R	1	20
PSM	KSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQPPQQPNVSSA	2437	sp|O75157|T22D2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=17378	67.90054037306666	4	4907.463132	4907.428561	L	-	734	781
PSM	SYGRPPPDVEGMTSL	2438	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=16082	63.422729079999996	2	1662.7662	1662.7552	M	K	2	17
PSM	ASPAASSVRPP	2439	sp|Q9H875|PKRI1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=9657	39.9582505728	2	1080.5615	1080.5558	M	R	2	13
PSM	AVAAAAAAAGPAGAGGG	2440	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=16642	65.38173783466667	2	1251.6274	1251.6202	M	R	2	19
PSM	MESRDPAQPMSPGEATQSGA	2441	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=7750	32.3662240552	3	2121.891858	2119.878649	-	R	1	21
PSM	MESRDPAQPMSPGEATQSGA	2442	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10165	41.841689121866665	3	2103.895905	2103.883734	-	R	1	21
PSM	ANMQGLVERLE	2443	sp|P40123|CAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,3-UNIMOD:35	ms_run[1]:scan=16839	66.09849512746668	2	1317.6342	1316.6392	M	R	2	13
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	2444	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=25150	96.06496596773333	3	3348.3002	3346.2712	M	K	2	31
PSM	AATAAEAVASGSGEP	2445	sp|Q9NWT6|HIF1N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=18237	70.70046597679999	2	1329.6133	1329.6043	M	R	2	17
PSM	MNINDLKLTLS	2446	sp|Q16222|UAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22211	84.49819145653333	2	1318.689249	1318.680253	-	K	1	12
PSM	MEPAAGSSMEPSADWLATAAA	2447	sp|P42771|CDN2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=25542	97.5793239624	2	2136.909967	2136.897987	-	R	1	22
PSM	KPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPV	2448	sp|Q2M2I8|AAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35	ms_run[1]:scan=13444	53.96622240426667	3	3201.642086	3201.624083	Q	R	566	598
PSM	AESGESGGPPGSQDSAAGAEGAGAPAAAASAEP	2449	sp|Q9UMX0|UBQL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=14418	57.44457230693333	3	2823.2252	2823.2062	M	K	2	35
PSM	MEEVRCPEHGTFCFL	2450	sp|Q9UNY4|TTF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=20755	79.13179895066668	2	1968.827925	1968.816841	-	K	1	16
PSM	MEGGLADGEPDRTSLLGDS	2451	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18521	71.62231980053333	2	1976.874469	1976.863316	-	K	1	20
PSM	MNLEQERPFVCSAPGCSQ	2452	sp|Q02930-2|CREB5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=16998	66.61791846506667	3	2166.930275	2166.913260	-	R	1	19
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	2453	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=20525	78.32816525066667	4	3482.709848	3482.688399	N	R	398	434
PSM	AAAAELSLLE	2454	sp|O43324-2|MCA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=30080	115.45	2	1028.539	1028.5390	M	K	2	12
PSM	AAALGASGGAGAGDDDFDQFD	2455	sp|Q96EV2-2|RBM33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=25797	98.657	2	1968.7973	1968.7973	M	K	2	23
PSM	AADGQCSLPASW	2456	sp|Q86YN1-2|DOPP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=22901	87.002	2	1303.5503	1303.5503	M	R	2	14
PSM	AAEADGPLK	2457	sp|O75352-2|MPU1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8001	33.376	2	912.45526	912.4553	M	R	2	11
PSM	AAEEVLQTVDHY	2458	sp|Q96G01-4|BICD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=27012	103.71	2	1415.6569	1415.6569	M	K	2	14
PSM	AAFGILSYEH	2459	sp|Q93074-3|MED12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=25774	98.561	2	1148.5502	1148.5502	M	R	2	12
PSM	AAPEGSGLGEDA	2460	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=11927	48.299	1	1114.4778	1114.4778	M	R	2	14
PSM	AAPGAPAEYGYI	2461	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=22902	87.004	2	1220.5714	1220.5714	M	R	2	14
PSM	AAPVDLELK	2462	sp|O60925|PFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17212	67.356	2	996.54916	996.5492	M	K	2	11
PSM	AAPVDLELK	2463	sp|O60925|PFD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17353	67.818	2	996.54916	996.5492	M	K	2	11
PSM	AAPVGPVKFW	2464	sp|Q9H5Z1-2|DHX35_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=25037	95.579	2	1112.6019	1112.6019	M	R	2	12
PSM	AAQGEPQVQF	2465	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=19306	74.317	2	1115.5247	1115.5247	M	K	2	12
PSM	AASQAVEEM	2466	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7455	31.212	2	992.41208	992.4121	M	R	2	11
PSM	AASSSSSSAGGVSGSSVTGSGFSVSDLAPP	2467	sp|Q96DE5|APC16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=25902	99.099	2	2641.1991	2641.1991	M	R	2	32
PSM	AATTGSGVKVP	2468	sp|Q13404-8|UB2V1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=10828	44.432	2	1028.5502	1028.5502	M	R	2	13
PSM	AAVDLEKL	2469	sp|P17858|PFKAL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=20125	76.971	2	899.4964	899.4964	M	R	2	10
PSM	AAVQMDPELAK	2470	sp|Q9Y312|AAR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=14976	59.446	2	1213.6013	1213.6013	M	R	2	13
PSM	ACSPDAVVSPSSAFL	2471	sp|Q93100-4|KPBB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=27179	104.36	2	1548.713	1548.7130	M	R	2	17
PSM	ADDLDFETGDAGASATFPMQCSAL	2472	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[2]:scan=28997	111.4	2	2547.0417	2547.0418	M	R	2	26
PSM	ADEEKLPPGWE	2473	sp|O15428|PINL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17673	68.851	2	1311.5983	1311.5983	M	K	2	13
PSM	ADGELNVDSLIT	2474	sp|P62140|PP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=28180	108.28	2	1287.6194	1287.6194	M	R	2	14
PSM	ADGQVAELLL	2475	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=31803	121.94	2	1069.5655	1069.5655	M	R	2	12
PSM	ADHNPDSDSTP	2476	sp|Q96BT3-3|CENPT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5173	21.913	2	1196.4582	1196.4582	M	R	2	13
PSM	ADKEAAFDDAVEE	2477	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=13125	52.77	2	1450.61	1450.6100	M	R	2	15
PSM	ADKEAFDDAVEE	2478	sp|Q09028-2|RBBP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=14523	57.807	2	1379.5729	1379.5729	M	R	2	14
PSM	ADLDKLNIDSIIQ	2479	sp|P36873|PP1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=28404	109.17	2	1498.7879	1498.7879	M	R	2	15
PSM	ADNEKLDNQ	2480	sp|O00629|IMA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5330	22.566	2	1087.4782	1087.4782	M	R	2	11
PSM	AEDMETKI	2481	sp|P14854|CX6B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=7621	31.879	2	993.43248	993.4325	M	K	2	10
PSM	AENHCELLSPA	2482	sp|Q9NXV2|KCTD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=13293	53.406	2	1281.566	1281.5660	M	R	2	13
PSM	AGAATQASLESAP	2483	sp|Q9BXR0-2|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=14771	58.708	2	1214.5779	1214.5779	M	R	2	15
PSM	AGAATQASLESAP	2484	sp|Q9BXR0-2|TGT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=14900	59.168	2	1214.5779	1214.5779	M	R	2	15
PSM	AGSEQQRP	2485	sp|Q8N584-3|TT39C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4385	18.657	2	913.42536	913.4254	M	R	2	10
PSM	AGYEYVSPEQLAGFD	2486	sp|Q9C0D9|EPT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=30794	118.08	2	1686.7413	1686.7413	M	K	2	17
PSM	ALHVPKAPGFAQML	2487	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=23514	89.348	2	1520.8174	1520.8174	M	K	2	16
PSM	AMDQVNALCEQLV	2488	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,2-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=25612	97.873	2	1547.696	1547.6960	M	K	2	15
PSM	ANALASATCE	2489	sp|P48059|LIMS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=14709	58.506	2	1048.4495	1048.4495	M	R	2	12
PSM	ANNDAVLK	2490	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6846	28.703	2	885.4556	885.4556	M	R	2	10
PSM	ANRGPAYGLS	2491	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=10129	41.693	2	1046.5145	1046.5145	M	R	2	12
PSM	ANSAKAEEYE	2492	sp|O43148|MCES_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7158	30.03	2	1152.4935	1152.4935	M	K	2	12
PSM	APIKVGDAIPAVEVFEGEPGN	2493	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=24021	91.382	2	2108.079	2108.0790	M	K	2	23
PSM	APIKVGDAIPAVEVFEGEPGN	2494	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=24132	91.85	3	2108.079	2108.0790	M	K	2	23
PSM	AQQQMTSSQ	2495	sp|Q712K3|UB2R2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=5526	23.38	2	1049.4448	1049.4448	M	K	2	11
PSM	ARGSVSDEEMMEL	2496	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=15169	60.154	2	1510.628	1510.6280	M	R	2	15
PSM	ASGADSKGDDLSTAIL	2497	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=19422	74.655	2	1561.7471	1561.7471	M	K	2	18
PSM	ASGVAVSDGVIKVFNDM	2498	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=29981	115.07	2	1749.8607	1749.8607	M	K	2	19
PSM	ASLSLAPVNIF	2499	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=33224	126.82	2	1172.6441	1172.6441	M	K	2	13
PSM	ASLSTWSSPAEP	2500	sp|Q92888-3|ARHG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=22986	87.315	2	1273.5826	1273.5826	M	R	2	14
PSM	ASNKTTLQ	2501	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=4893	20.754	2	903.46616	903.4662	M	K	2	10
PSM	ASNPERGEILLTELQGDS	2502	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=24892	94.97	2	1969.9593	1969.9593	M	R	2	20
PSM	ASQNRDPAATSVAAA	2503	sp|O00762-3|UBE2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8133	33.927	2	1470.7063	1470.7063	M	R	2	17
PSM	ASQPPPPPKPWET	2504	sp|Q92968|PEX13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=14545	57.888	2	1472.73	1472.7300	M	R	2	15
PSM	ASSEQAEQPSQPSSTPGSENVLP	2505	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17384	67.916	2	2368.0666	2368.0666	M	R	2	25
PSM	ASSSTVPLGFHYET	2506	sp|Q9BXK5-2|B2L13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=20158	77.078	2	1536.7096	1536.7096	M	K	2	16
PSM	ASVAVDPQPSVVT	2507	sp|Q99541|PLIN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17468	68.194	2	1310.6718	1310.6718	M	R	2	15
PSM	ATKAVCVL	2508	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=13540	54.34	2	902.48954	902.4895	M	K	2	10
PSM	ATVEPETTPTPNPPTTEEEKTESNQEVANPEHYI	2509	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=19435	74.684	3	3820.7439	3820.7439	M	K	2	36
PSM	AVPGCNKDSV	2510	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=8055	33.593	2	1087.4968	1087.4968	M	R	2	12
PSM	AVPPTYADLGKSA	2511	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16734	65.726	2	1330.6769	1330.6769	M	R	2	15
PSM	AVPPTYADLGKSA	2512	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17068	66.856	2	1330.6769	1330.6769	M	R	2	15
PSM	AVSVTPIRDT	2513	sp|Q9NR56-3|MBNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12783	51.462	2	1099.5873	1099.5873	M	K	2	12
PSM	CSLGLFPPPPP	2514	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=28602	109.93	2	1222.6056	1222.6056	M	R	2	13
PSM	CSLGLFPPPPP	2515	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=29304	112.51	2	1222.6056	1222.6056	M	R	2	13
PSM	CSLGLFPPPPP	2516	sp|Q9NRG9-2|AAAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=29446	113.05	2	1222.6056	1222.6056	M	R	2	13
PSM	DDDIAALVVDNGSGMC	2517	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=32012	122.71	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2518	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=32140	123.18	2	1692.6971	1692.6971	M	K	2	18
PSM	GEAGAGAGASGGPEASPEAEVV	2519	sp|Q9BTY7|HGH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16254	64.034	2	1910.8494	1910.8494	M	K	2	24
PSM	GEIEQRPTPGS	2520	sp|Q9Y4F1-3|FARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=7808	32.55	2	1211.5782	1211.5782	M	R	2	13
PSM	GSGPIDPKELL	2521	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=22933	87.117	2	1166.6183	1166.6183	M	K	2	13
PSM	GSSQSVEIPGGGTEGYHVL	2522	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=21002	80.056	2	1914.8959	1914.8959	M	R	2	21
PSM	GTRDDEYDYLF	2523	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=24352	92.755	2	1434.5939	1434.5939	M	K	2	13
PSM	GVQVETISPGDG	2524	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10524	43.242	2	1157.5564	1157.5564	M	R	2	14
PSM	GVQVETISPGDG	2525	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16266	64.069	2	1199.567	1199.5670	M	R	2	14
PSM	KEPNPPIDEVISTPGVVA	2526	sp|P52294|IMA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=18818	72.638	2	1860.9833	1860.9833	S	R	112	130
PSM	KSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASP	2527	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:4	ms_run[2]:scan=22142	84.219	4	4371.1792	4371.1792	P	K	451	498
PSM	KTITYQAVPSEVPNEEP	2528	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=13437	53.94	2	1900.9418	1900.9418	A	K	210	227
PSM	KVGINYQPPTVVPGGDLA	2529	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=17649	68.769	2	1823.9781	1823.9781	F	K	236	254
PSM	KVVSQYSSLLSPMSVNAVM	2530	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=17317	67.706	2	2071.033	2071.0330	S	K	144	163
PSM	MDAPRQVVNFGPGPA	2531	sp|Q9Y617-2|SERC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=20780	79.236	2	1596.7719	1596.7719	-	K	1	16
PSM	MDEVEQDQHEA	2532	sp|Q8N4C6-6|NIN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6927	29.057	2	1387.5198	1387.5198	-	R	1	12
PSM	MDGIVPDIAVGT	2533	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=30863	118.33	2	1228.6009	1228.6009	-	K	1	13
PSM	MDIRPNHTIYINNMND	2534	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=12797	51.517	2	2033.8935	2033.8935	-	K	1	17
PSM	MDNLSDTLK	2535	sp|P52306-2|GDS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11463	46.64	2	1093.4961	1093.4961	-	K	1	10
PSM	MDPNTIIEAL	2536	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29246	112.3	2	1173.5587	1173.5587	-	R	1	11
PSM	MDSLEEPQK	2537	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7222	30.28	2	1133.4911	1133.4911	-	K	1	10
PSM	MDSLEEPQK	2538	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7333	30.728	2	1133.4911	1133.4911	-	K	1	10
PSM	MDVGELLSYQPN	2539	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26441	101.32	2	1422.6337	1422.6337	-	R	1	13
PSM	MDVGELLSYQPN	2540	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26545	101.78	2	1422.6337	1422.6337	-	R	1	13
PSM	MEAAAEPGNLAGV	2541	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17624	68.682	2	1286.5813	1286.5813	-	R	1	14
PSM	MEAAAEPGNLAGV	2542	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17776	69.149	2	1286.5813	1286.5813	-	R	1	14
PSM	MEATGVLPFV	2543	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30731	117.86	2	1120.5474	1120.5474	-	R	1	11
PSM	MEATGVLPFV	2544	sp|Q13045-2|FLII_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=33307	127.1	2	1104.5525	1104.5525	-	R	1	11
PSM	MEDMNEYSNIEEFAEGS	2545	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27768	106.73	2	2051.7612	2051.7612	-	K	1	18
PSM	MEDSMDMDMSPL	2546	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=22036	83.809	2	1474.4972	1474.4972	-	R	1	13
PSM	MEDSMDMDMSPL	2547	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,5-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=22156	84.276	2	1474.4972	1474.4972	-	R	1	13
PSM	MEDSMDMDMSPL	2548	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=25816	98.736	2	1458.5023	1458.5023	-	R	1	13
PSM	MEEDQELER	2549	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=11243	45.925	2	1219.5027	1219.5027	-	K	1	10
PSM	MEELDGEPTVTLIPGVNS	2550	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28605	109.95	2	1957.919	1957.9190	-	K	1	19
PSM	MEEVVIAGMSG	2551	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=30802	118.1	2	1163.5202	1163.5202	-	K	1	12
PSM	MEGPLSVFGD	2552	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28439	109.31	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	2553	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28550	109.75	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	2554	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28665	110.17	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	2555	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28787	110.63	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	2556	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28905	111.05	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGVAVVTAGSVGAA	2557	sp|Q9BYE7-3|PCGF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19092	73.585	2	1375.6653	1375.6653	-	K	1	16
PSM	MELVQVLK	2558	sp|Q9UI09-2|NDUAC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20637	78.719	2	1016.5576	1016.5576	-	R	1	9
PSM	MEMTEMTGVSLK	2559	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=18914	72.972	2	1413.619	1413.6190	-	R	1	13
PSM	MENGAVYSPTTEEDPGPA	2560	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15185	60.222	2	1921.7888	1921.7888	-	R	1	19
PSM	MENGYTYEDY	2561	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16862	66.185	2	1341.4707	1341.4707	-	K	1	11
PSM	MEPPGGSLGPGRGT	2562	sp|O60610-2|DIAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=13182	52.985	2	1353.6347	1353.6347	-	R	1	15
PSM	MESGDEAAIE	2563	sp|Q8TDP1|RNH2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9564	39.608	2	1108.423	1108.4230	-	R	1	11
PSM	MESRDPAQPMSPGEATQSGA	2564	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=10241	42.14	2	2103.8837	2103.8837	-	R	1	21
PSM	MESTPSRGLN	2565	sp|Q92759|TF2H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6056	25.456	2	1148.5132	1148.5132	-	R	1	11
PSM	MESTPSRGLN	2566	sp|Q92759|TF2H4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=9100	37.729	2	1132.5183	1132.5183	-	R	1	11
PSM	MEVSPLQPVNENMQVN	2567	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17541	68.439	2	1901.8499	1901.8499	-	K	1	17
PSM	MFGAGDEDDTDFLSPSGGA	2568	sp|Q5T1M5-3|FKB15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26428	101.26	2	1945.7524	1945.7524	-	R	1	20
PSM	MHGGGPPSGDSACPL	2569	sp|P24928-2|RPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=12750	51.346	2	1480.6075	1480.6075	-	R	1	16
PSM	MHSLATAAPVPTTLAQVD	2570	sp|Q92600-3|CNOT9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=23190	88.103	2	1863.94	1863.9400	-	R	1	19
PSM	MKETIMNQE	2571	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=8753	36.411	2	1180.5104	1180.5104	-	K	1	10
PSM	MLGPEGGEGFVV	2572	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=31373	120.23	2	1232.5747	1232.5747	M	K	2	14
PSM	MLGSGFKAE	2573	sp|P53990-2|IST1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12259	49.533	2	996.45863	996.4586	-	R	1	10
PSM	MLGTEGGEGFVV	2574	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=30691	117.71	2	1236.5696	1236.5696	M	K	2	14
PSM	MLGTEGGEGFVVKV	2575	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=16398	64.54	2	1437.7174	1437.7174	M	R	2	16
PSM	MLLELSEEH	2576	sp|Q86X83-2|COMD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=12144	49.096	2	1115.5169	1115.5169	-	K	1	10
PSM	MMLGPEGGEGFVVKL	2577	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24830	94.722	2	1636.7841	1636.7841	-	R	1	16
PSM	MNIMDFNVK	2578	sp|Q9Y371|SHLB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=14499	57.727	2	1184.5206	1184.5206	-	K	1	10
PSM	MNIMDFNVK	2579	sp|Q9Y371|SHLB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=20803	79.313	2	1168.5257	1168.5257	-	K	1	10
PSM	MNLFNLDRF	2580	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=31969	122.56	2	1210.5805	1210.5805	-	R	1	10
PSM	MNLLPNIESPVT	2581	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27499	105.65	2	1384.6908	1384.6908	-	R	1	13
PSM	MNSNVENLPPHII	2582	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=22382	85.125	2	1518.7501	1518.7501	-	R	1	14
PSM	MPMFIVNTNVP	2583	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=21832	83.096	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	2584	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=21970	83.553	2	1277.6148	1277.6148	-	R	1	12
PSM	MPYQYPALTPEQK	2585	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=12150	49.123	2	1580.7545	1580.7545	-	K	1	14
PSM	MQNDAGEFVDLYVP	2586	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=31308	119.99	2	1654.7185	1654.7185	-	R	1	15
PSM	MQNDAGEFVDLYVP	2587	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=32554	124.64	2	1638.7236	1638.7236	-	R	1	15
PSM	MQNVINTVKG	2588	sp|Q9NT62-2|ATG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=19552	75.023	2	1144.591	1144.5910	-	K	1	11
PSM	MQPPPPGPLGDCL	2589	sp|Q9BXJ8-2|TACAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=22475	85.469	2	1435.6476	1435.6476	-	R	1	14
PSM	MQSPAVLVTSR	2590	sp|Q53T59|H1BP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17727	69.001	2	1229.6438	1229.6438	-	R	1	12
PSM	MQTPVNIPVPVL	2591	sp|Q9H840|GEMI7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30367	116.52	2	1364.7374	1364.7374	-	R	1	13
PSM	MSTGTFVVSQPLNY	2592	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=19763	75.722	2	1558.7337	1558.7337	-	R	1	15
PSM	MVGEEKMSL	2593	sp|P35610|SOAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14305	57.074	2	1080.4831	1080.4831	-	R	1	10
PSM	MVGVKPVGSDPDFQPELSGAGS	2594	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35	ms_run[2]:scan=15803	62.432	2	2189.031	2189.0310	-	R	1	23
PSM	MYNGIGLPTP	2595	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24485	93.282	2	1119.527	1119.5270	-	R	1	11
PSM	PAPEQASLVEEGQPQT	2596	sp|Q99569-2|PKP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11791	47.77	2	1679.8002	1679.8002	M	R	2	18
PSM	PAVSLPPKENALF	2597	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=19166	73.844	2	1381.7606	1381.7606	M	K	2	15
PSM	PAVSLPPKENALF	2598	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=20821	79.385	2	1381.7606	1381.7606	M	K	2	15
PSM	PEFLEDPSVLT	2599	sp|P42167-2|LAP2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=22244	84.621	2	1245.6129	1245.6129	M	K	2	13
PSM	PEPSKSAPAP	2600	sp|Q99877|H2B1N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=4310	18.341	2	979.49746	979.4975	M	K	2	12
PSM	PGLVDSNPAPPESQE	2601	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11028	45.174	2	1535.7104	1535.7104	M	K	2	17
PSM	PLAQLADPWQ	2602	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=21805	83.002	2	1137.5819	1137.5819	M	K	2	12
PSM	PLENLEEEGLP	2603	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=19437	74.687	2	1238.603	1238.6030	M	K	2	13
PSM	PLENLEEEGLP	2604	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=19590	75.141	2	1238.603	1238.6030	M	K	2	13
PSM	PLENLEEEGLP	2605	sp|Q15008|PSMD6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=19732	75.617	2	1238.603	1238.6030	M	K	2	13
PSM	PNFCAAPNCT	2606	sp|O43422-2|P52K_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=8894	36.975	2	1150.4536	1150.4536	M	R	2	12
PSM	PPPQGDVTALFLGPPGLG	2607	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=28849	110.85	2	1731.9196	1731.9196	M	K	2	20
PSM	PPPQGDVTALFLGPPGLG	2608	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=28870	110.93	2	1731.9196	1731.9196	M	K	2	20
PSM	PSSTSPDQGDDLENCIL	2609	sp|Q5T7W7|TSTD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:4	ms_run[2]:scan=19246	74.099	2	1846.7891	1846.7891	M	R	2	19
PSM	PYQYPALTPEQK	2610	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11488	46.73	3	1433.7191	1433.7191	M	K	2	14
PSM	PYQYPALTPEQK	2611	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12541	50.558	2	1433.7191	1433.7191	M	K	2	14
PSM	RAIVDALPPPCESACTVPTDVD	2612	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=17405	67.985	3	2382.1195	2382.1195	A	K	260	282
PSM	RGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVE	2613	sp|Q8TF71|MOT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=14299	57.05	3	3064.4738	3064.4738	A	K	12	45
PSM	RIPSAVGYQPTLATDMGTMQE	2614	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:35	ms_run[2]:scan=15620	61.783	3	2281.0719	2281.0719	G	R	324	345
PSM	SDKPDLSEVE	2615	sp|P0CG35|TB15B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=11834	47.937	1	1159.5245	1159.5245	M	K	2	12
PSM	SDLQAAEGPGSWSPTA	2616	sp|Q6PL24|TMED8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=22092	84.026	2	1614.7162	1614.7162	M	R	2	18
PSM	SDQQLDCALDLM	2617	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=24434	93.064	2	1465.6065	1465.6065	M	R	2	14
PSM	SDQQLDCALDLM	2618	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=31365	120.2	2	1449.6116	1449.6116	M	R	2	14
PSM	SEDSSALPWSIN	2619	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=26999	103.66	2	1346.599	1346.5990	M	R	2	14
PSM	SETAPAAPAAAPPAE	2620	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=8234	34.361	2	1391.6569	1391.6569	M	K	2	17
PSM	SETDHIASTSSD	2621	sp|Q7Z3E2|CC186_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6295	26.436	2	1290.5212	1290.5212	M	K	2	14
PSM	SGELPPNINIKEP	2622	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=20508	78.266	2	1448.7511	1448.7511	M	R	2	15
PSM	SGEPGQTSVAPPPEEVEPGSGV	2623	sp|Q9BRT3|MIEN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17841	69.351	2	2147.9859	2147.9859	M	R	2	24
PSM	SGLGENLDPLASDS	2624	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=25257	96.479	2	1415.6416	1415.6416	M	R	2	16
PSM	SIMSYNGGAVMAM	2625	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=17876	69.466	2	1404.5724	1404.5724	M	K	2	15
PSM	SIMSYNGGAVMAM	2626	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=19068	73.517	2	1404.5724	1404.5724	M	K	2	15
PSM	SIMSYNGGAVMAM	2627	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=23411	88.967	2	1388.5774	1388.5774	M	K	2	15
PSM	SLICSISNEVPEHPCVSPVSNHVYE	2628	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,4-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24427	93.038	3	2894.3215	2894.3215	M	R	2	27
PSM	SLKLQASNVTN	2629	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12175	49.217	2	1215.6459	1215.6459	M	K	2	13
PSM	SNGYEDHMAEDCRGDIG	2630	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8401	35.008	2	1982.7371	1982.7371	M	R	2	19
PSM	SNIYIQEPPTNG	2631	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=17698	68.919	2	1373.6463	1373.6463	M	K	2	14
PSM	SQYTEKEPAAMDQESG	2632	sp|O43164-2|PJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=8101	33.785	2	1827.7469	1827.7469	M	K	2	18
PSM	SRCAQAAEVAATVPGAGVGNVGL	2633	sp|Q7L5N7|PCAT2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=21769	82.874	3	2196.0957	2196.0957	M	R	2	25
PSM	SRGPSSAVLPSALGS	2634	sp|O95685|PPR3D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16353	64.371	2	1426.7416	1426.7416	M	R	2	17
PSM	SRQSTLYSFFP	2635	sp|P52701-2|MSH6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=26285	100.65	2	1373.6616	1373.6616	M	K	2	13
PSM	SSAPTTPPSVDKVDGFS	2636	sp|Q16537-2|2A5E_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16473	64.789	2	1732.8156	1732.8156	M	R	2	19
PSM	SSEAETQQPPAAPPAAPALSAADT	2637	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=18366	71.11	3	2319.0866	2319.0866	M	K	2	26
PSM	SSILPFTPPIVK	2638	sp|P84022|SMAD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=27126	104.16	2	1339.7751	1339.7751	M	R	2	14
PSM	SSKQEIMSDQ	2639	sp|Q9H501|ESF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6782	28.453	2	1193.5234	1193.5234	M	R	2	12
PSM	SSKTASTNNIAQA	2640	sp|Q9UBI6|GBG12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=6161	25.881	2	1333.6474	1333.6474	M	R	2	15
PSM	STVKEQLIE	2641	sp|P07864|LDHC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12281	49.628	2	1087.5761	1087.5761	M	K	2	11
PSM	SVELEEALPVTTAEGMA	2642	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:35	ms_run[2]:scan=20293	77.547	2	1761.8342	1761.8342	M	K	2	19
PSM	SYGRPPPDVEGMTSL	2643	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=16129	63.583	2	1662.7559	1662.7559	M	K	2	17
PSM	SYTLDSLGNPSAY	2644	sp|P07197|NFM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=26304	100.73	2	1428.6409	1428.6409	M	R	2	15
PSM	TASSVEQLR	2645	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=10441	42.945	2	1031.5247	1031.5247	M	K	2	11
PSM	TDSKYFTTT	2646	sp|Q10567-4|AP1B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12389	50.03	2	1104.4975	1104.4975	M	K	2	11
PSM	TGYTPDEKL	2647	sp|O95139-2|NDUB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8448	35.2	2	1022.492	1022.4920	M	R	2	11
PSM	TGYTPDEKL	2648	sp|O95139-2|NDUB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12850	51.718	2	1064.5026	1064.5026	M	R	2	11
PSM	TGYTPDEKL	2649	sp|O95139-2|NDUB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=12971	52.176	2	1064.5026	1064.5026	M	R	2	11
PSM	TLEAIRYS	2650	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1	ms_run[2]:scan=16542	65.03	2	993.51311	993.5131	M	R	2	10
PSM	TMDKSELVQ	2651	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:1,2-UNIMOD:35	ms_run[2]:scan=7285	30.528	2	1107.5118	1107.5118	M	K	2	11
PSM	VLLESEQFLTELT	2652	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=28504	109.58	2	1520.7974	1520.7974	M	R	2	15
PSM	VQAWYMDDAPGDP	2653	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=15562	61.568	2	1479.5976	1479.5976	M	R	2	15
PSM	VQAWYMDDAPGDP	2654	sp|Q9BV57|MTND_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=15690	62.026	2	1479.5976	1479.5976	M	R	2	15
PSM	DDDIAALVVDNGSGMC	2655	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31812	121.97293742906666	2	1710.7082	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2656	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=27899	107.24660595973334	2	1692.6915	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2657	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30570	117.2804189976	2	1694.6962	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2658	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30622	117.46619457039999	2	1693.6942	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2659	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30703	117.75825080853333	2	1694.7002	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2660	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31042	118.99073975253333	2	1709.7292	1708.6912	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2661	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=29632	113.7526526544	2	1693.6872	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	2662	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31937	122.44178371493334	2	1693.6912	1692.6962	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2663	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=22484	85.4980904632	2	1722.7142	1722.7432	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2664	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=31662	121.37233329173334	2	1764.7642	1764.7542	M	K	2	18
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGP	2665	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=25460	97.25326803760001	3	2451.2382	2451.2232	M	R	2	32
PSM	PGLVDSNPAPPESQE	2666	sp|Q14061|COX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=11429	46.53142816933334	2	1536.7062	1535.7102	M	K	2	17
PSM	GLVDSNPAPPESQE	2667	sp|Q14061|COX17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=10132	41.70067557146667	2	1438.6658	1438.6571	P	K	3	17
PSM	ADISESSGADCKGDP	2668	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=8537	35.57529917066667	2	1549.6342	1549.6202	A	R	3	18
PSM	PYQYPALTPEQK	2669	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=12549	50.586155055733336	2	1434.7132	1433.7182	M	K	2	14
PSM	PYQYPALTPEQK	2670	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=12653	51.001106318666665	2	1433.7302	1433.7182	M	K	2	14
PSM	PYQYPALTPEQK	2671	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=12356	49.9056684856	2	1433.7270	1433.7186	M	K	2	14
PSM	PAEILNGKEISAQI	2672	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=16374	64.44714261066666	2	1481.8182	1481.8082	A	R	3	17
PSM	SKGPAVGIDLGTTYSCVGVFQHG	2673	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=23688	90.0363012648	3	2393.1722	2391.1522	M	K	2	25
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2674	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:35	ms_run[1]:scan=18661	72.0927416104	4	3489.603168	3489.581685	T	-	609	647
PSM	AAAVAAAGAGEPQSPDELLP	2675	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=28132	108.10992107866667	2	1877.9202	1875.9212	M	K	2	22
PSM	AAAAGGGGPGTAVGATGSGIAAAAAGLAVY	2676	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=31031	118.94977143093334	3	2400.2242	2399.2072	M	R	2	32
PSM	PPYTVVYFPVRG	2677	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=20476	78.164410104	2	1394.7312	1393.7392	M	R	2	14
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPP	2678	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=28716	110.35808349546666	3	3296.4222	3296.4002	M	K	2	31
PSM	AENDVDNELLDYEDDEVETAAGGDGAEAPA	2679	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=30192	115.86749565733334	3	3135.3002	3135.2792	M	K	2	32
PSM	ADDLDFETGDAGASATFPMQCSAL	2680	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,21-UNIMOD:4	ms_run[1]:scan=31790	121.88926703146667	3	2531.0602	2531.0462	M	R	2	26
PSM	ADDLDFETGDAGASATFPMQCSAL	2681	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=28978	111.32901599306666	3	2547.0562	2547.0412	M	R	2	26
PSM	ASFVTEVLAHSGRLE	2682	sp|O43264|ZW10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=29700	113.98416796960001	2	1656.8592	1656.8462	M	K	2	17
PSM	SSAAEPPPPPPPESAPS	2683	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=12013	48.625235885066665	2	1656.7842	1655.7672	M	K	2	19
PSM	MDLFGDLPEPERSP	2684	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=29229	112.236074008	2	1643.761243	1643.750124	-	R	1	15
PSM	METEQPEETFPNTETNGEFGK	2685	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=16910	66.32709349173334	3	2456.0742	2456.0322	-	R	1	22
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINAS	2686	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14532	57.84365497493333	4	5747.4932	5747.4542	M	K	2	64
PSM	SSDASQGVITTPPPPSMPH	2687	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=17192	67.28669277520001	2	1946.9212	1946.9042	M	K	2	21
PSM	GEAAVAAGPCPL	2688	sp|Q9Y664|KPTN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,10-UNIMOD:4	ms_run[1]:scan=18445	71.37375494266666	2	1153.5471	1153.5432	M	R	3	15
PSM	SHTILLVQPTK	2689	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=13049	52.47973106773334	2	1277.7416	1277.7338	M	R	2	13
PSM	SSVQQQPPPPR	2690	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=5701	24.134264611466666	2	1261.6522	1261.6412	M	R	2	13
PSM	MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAA	2691	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,22-UNIMOD:35	ms_run[1]:scan=23297	88.51993753893333	3	3405.578339	3405.555196	-	R	1	34
PSM	MMIHGFQSSH	2692	sp|O75663|TIPRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[1]:scan=8054	33.59029238586667	2	1247.519419	1247.506329	-	R	1	11
PSM	MTTDEGAKNNEESPTATVAEQGEDITS	2693	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14255	56.8814888832	3	2882.242761	2882.224737	-	K	1	28
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	2694	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	25-UNIMOD:35	ms_run[1]:scan=16497	64.87464794346667	3	2715.409773	2714.388392	K	R	123	152
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	2695	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	22-UNIMOD:35	ms_run[1]:scan=16065	63.36245661706666	3	2714.407513	2714.388392	K	R	123	152
PSM	SFDPNLLHNNGHNGYPNGTSAAL	2696	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=21404	81.50461303866668	3	2452.1212	2451.1202	M	R	2	25
PSM	MNYMPGTASLIEDIDK	2697	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=23473	89.19593885946666	2	1870.842669	1870.832868	-	K	1	17
PSM	KTEFTQGMILPTMNGESVDPVGQPAL	2698	sp|O95433|AHSA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=20562	78.45927888533333	3	2791.358205	2791.340833	L	K	156	182
PSM	MDNSGKEAEAMALLAEAE	2699	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=22206	84.47583954826668	2	1953.853489	1952.834324	-	R	1	19
PSM	MDNSGKEAEAMALLAEAE	2700	sp|P54920|SNAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=28133	108.11527257786666	2	1921.860791	1920.844494	-	R	1	19
PSM	RPCAPEPAASPAGPEEPGEPAGLGELGEPAGPGEPEGPGDPAAAPAEAEEQAVEA	2701	sp|P84157|MXRA7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	3-UNIMOD:4	ms_run[1]:scan=22130	84.17195209306666	4	5236.4022	5236.3682	S	R	58	113
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	2702	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17094	66.94004535493333	3	2498.113468	2498.096623	-	R	1	28
PSM	KEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELAS	2703	sp|Q96CX2|KCD12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=26096	99.90837986186666	3	3627.784201	3626.747547	H	R	148	184
PSM	MEQPGAAASGAGGGSEEPGGG	2704	sp|O60879|DIAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=11872	48.105418875733335	2	1815.759129	1814.737721	-	R	1	22
PSM	MEVEAVCGGAGEVEAQDSDPAPAFS	2705	sp|P35250|RFC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[1]:scan=23343	88.70716514906667	3	2580.077933	2580.063215	-	K	1	26
PSM	ALHVPKAPGFAQML	2706	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=23566	89.5558757112	2	1520.8264	1520.8168	M	K	2	16
PSM	PAVSLPPKENALF	2707	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=20365	77.78844614746666	2	1381.7682	1381.7600	M	K	2	15
PSM	AEGTAEAPLENGGGGDSGAGALE	2708	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=18427	71.3081971872	2	2071.8982	2070.8972	M	R	2	25
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQ	2709	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=22509	85.59250228026667	3	3105.4092	3105.3902	M	R	2	37
PSM	MDELAGGGGGGPGMAAPP	2710	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=14310	57.09065839013333	2	1614.674078	1614.665408	-	R	1	19
PSM	KMLFSPEEMDLSQEQPLDAQQGPPEPAQESLSGSES	2711	sp|Q32P28|P3H1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=20298	77.56282925706667	4	3947.777040	3947.756475	V	K	695	731
PSM	AVAAAAAAAGPAGAGGG	2712	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=16685	65.53948666293334	2	1251.6274	1251.6202	M	R	2	19
PSM	MESRDPAQPMSPGEATQSGA	2713	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=12914	51.960595202933334	3	2087.901725	2087.888819	-	R	1	21
PSM	ADGELNVDSLIT	2714	sp|P62140|PP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=28063	107.84656619626666	2	1287.6269	1287.6189	M	R	2	14
PSM	AEEGIAAGGVMDVNTALQEVL	2715	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,11-UNIMOD:35	ms_run[1]:scan=33266	126.96305946986666	2	2144.0422	2144.0302	M	K	2	23
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	2716	sp|Q9HD26|GOPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=24996	95.40128326986665	2	2589.1172	2589.1042	M	R	2	32
PSM	SAGGPCPAAAGGGPGGASCSVGAPGGVSMF	2717	sp|Q9HD26|GOPC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,6-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=25039	95.58675692613333	3	2589.1202	2589.1042	M	R	2	32
PSM	MESMAVATDGGERPGVPAGSGLSASQ	2718	sp|P49069|CAMLG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=13679	54.82994533333333	3	2535.137519	2535.121733	-	R	1	27
PSM	MEAAVGVPDGGDQGGAGP	2719	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14590	58.04957424053334	2	1641.707222	1641.694066	-	R	1	19
PSM	MEVGGDTAAPAPGGAEDLEDTQFPSEEA	2720	sp|Q7L1V2|MON1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=23267	88.3978632	3	2848.205294	2848.186895	-	R	1	29
PSM	SADGAEADGSTQVTVEEPVQQPSVVD	2721	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=19333	74.40018930853333	3	2656.2122	2656.1982	M	R	2	28
PSM	SAAEAGGVFH	2722	sp|Q9BRF8|CPPED_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=11968	48.4500768728	2	986.4602	986.4452	M	R	2	12
PSM	AGAQPGVHALQLEPPTVVETL	2723	sp|Q01970|PLCB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=26645	102.19738207626666	3	2168.1612	2168.1472	M	R	2	23
PSM	SLVIRNLQ	2724	sp|P58557|YBEY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=18656	72.07781444693335	2	983.5818	983.5759	M	R	2	10
PSM	MDCEVNNGSSL	2725	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=16392	64.52006494133333	2	1266.493227	1266.485653	-	R	1	12
PSM	MFPTGFSSPSPSAAAAAQEV	2726	sp|Q13620-1|CUL4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25866	98.94105132373333	2	2009.916387	2009.904058	-	R	1	21
PSM	RGEAEELGEDDEGLAPEDALLADD	2727	sp|Q86UZ6|ZBT46_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=11451	46.60282975573333	3	2530.148389	2528.103816	P	K	542	566
PSM	MEDGGLTAFEEDQ	2728	sp|Q96RG2|PASK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21960	83.5187131024	2	1498.585602	1498.576970	-	R	1	14
PSM	AEPWGNELASAAA	2729	sp|P42773|CDN2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=25487	97.35752114453334	2	1327.6118	1327.6039	M	R	2	15
PSM	SGGGTETPVGCEAAPGGGS	2730	sp|Q8TDH9|BL1S5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=10495	43.14724238506667	2	1688.7172	1688.6942	M	K	2	21
PSM	KVVAPTISSPVCQEQLVEAG	2731	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:4	ms_run[1]:scan=16525	64.9712223752	3	2111.105179	2111.093256	T	R	721	741
PSM	KNQNEIDTLQEV	2732	sp|A6NK53|ZN233_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=24379	92.85187257733334	2	1430.685463	1429.704888	H	R	82	94
PSM	MDRPAAAAAAGCEGGGGPNPGPAGG	2733	sp|Q13613|MTMR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=12324	49.79936504693333	3	2206.961016	2206.948400	-	R	1	26
PSM	MEQPGQDPTSDDVMDSFLE	2734	sp|O95801|TTC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=23553	89.5106259616	2	2213.875184	2213.861661	-	K	1	20
PSM	METEQPEETFPNTETNGEFGK	2735	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1	ms_run[1]:scan=20341	77.71000338106666	3	2457.031367	2456.032566	-	R	1	22
PSM	METEQPEETFPNTETNGEFGK	2736	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17644	68.75681984986666	3	2473.027437	2472.027481	-	R	1	22
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2737	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:35	ms_run[1]:scan=18377	71.14705858266666	3	3489.601718	3489.581685	T	-	609	647
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2738	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17840	69.3491842184	3	3505.597574	3505.576600	T	-	609	647
PSM	AAAAASAPQQLSDEELFSQL	2739	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=31726	121.62	2	2088.0011	2088.0011	M	R	2	22
PSM	AAAAELSLLE	2740	sp|O43324-2|MCA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30195	115.88	2	1028.539	1028.5390	M	K	2	12
PSM	AAAAGGPCV	2741	sp|Q5SRE5-2|NU188_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=10199	41.969	2	814.36434	814.3643	M	R	2	11
PSM	AAAAVVEFQ	2742	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=22432	85.32	2	946.476	946.4760	M	R	2	11
PSM	AAADGALPEAAALEQPAELPASV	2743	sp|P23025|XPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=29415	112.93	2	2203.1008	2203.1008	M	R	2	25
PSM	AAATGAVAASAASGQAEG	2744	sp|Q9NWH9|SLTM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=14047	56.081	2	1501.7009	1501.7009	M	K	2	20
PSM	AADTQVSETL	2745	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=15701	62.06	2	1075.5033	1075.5033	M	K	2	12
PSM	AAEDELQLP	2746	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=24099	91.712	2	1026.487	1026.4870	M	R	2	11
PSM	AAEEVLQTVDHY	2747	sp|Q96G01-4|BICD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27123	104.15	2	1415.6569	1415.6569	M	K	2	14
PSM	AAERQEAL	2748	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7449	31.191	2	928.46141	928.4614	M	R	2	10
PSM	AAGTSSYWEDLR	2749	sp|O95249|GOSR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20892	79.661	2	1396.6259	1396.6259	M	K	2	14
PSM	AAIPSSGSLVATHDYY	2750	sp|Q9H3Y8-2|PPDPF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=21122	80.478	2	1692.7995	1692.7995	M	R	2	18
PSM	AAMAVGGAGGS	2751	sp|O14744-5|ANM5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=6687	28.074	2	905.39128	905.3913	M	R	2	13
PSM	AAQGVGPGPGSAAPPGLEAA	2752	sp|Q6P582|MZT2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=19064	73.505	2	1715.8479	1715.8479	M	R	2	22
PSM	AASQAVEEM	2753	sp|O15160-2|RPAC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=7344	30.772	2	992.41208	992.4121	M	R	2	11
PSM	AATASAGVPATVSE	2754	sp|O60518|RNBP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=13492	54.147	2	1272.6198	1272.6198	M	K	2	16
PSM	AAVLQQVLE	2755	sp|P12270-2|TPR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=32150	123.23	2	1011.5601	1011.5601	M	R	2	11
PSM	AAVQAAEVKVDGSEP	2756	sp|Q15046|SYK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=14840	58.957	2	1511.7468	1511.7468	M	K	2	17
PSM	AAVQVVGSWPSVQP	2757	sp|Q6AI08|HEAT6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27805	106.87	2	1465.7565	1465.7565	M	R	2	16
PSM	ADAWEEIR	2758	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18540	71.685	2	1030.472	1030.4720	M	R	2	10
PSM	ADGEEPEK	2759	sp|Q8TBC4|UBA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=4263	18.127	2	915.38216	915.3822	M	K	2	10
PSM	ADKMDMSLDDII	2760	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=28170	108.25	2	1407.6262	1407.6262	M	K	2	14
PSM	ADKPDMGEIASFD	2761	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=17316	67.7	2	1452.6079	1452.6079	M	K	2	15
PSM	ADKPDMGEIASFD	2762	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20330	77.67	2	1436.613	1436.6130	M	K	2	15
PSM	AEAEESPGDPGTASP	2763	sp|Q96EC8-2|YIPF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=10060	41.419	2	1455.6001	1455.6001	M	R	2	17
PSM	AEAPPVSGTF	2764	sp|Q12986-3|NFX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18870	72.825	2	1016.4815	1016.4815	M	K	2	12
PSM	AEEGIAAGGVMDVNTALQEVL	2765	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=33273	126.99	2	2144.0307	2144.0307	M	K	2	23
PSM	AEEQPQVELFV	2766	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=28896	111.02	2	1329.6452	1329.6452	M	K	2	13
PSM	AEIIQERIED	2767	sp|Q9NYH9|UTP6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20577	78.516	2	1256.6248	1256.6248	M	R	2	12
PSM	AELDQLPDESSSA	2768	sp|Q5TKA1-3|LIN9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=19927	76.255	2	1402.61	1402.6100	M	K	2	15
PSM	AERPEDLNLPNAVIT	2769	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=21774	82.888	2	1692.8683	1692.8683	M	R	2	17
PSM	AESSDKLY	2770	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=9546	39.54	2	953.43419	953.4342	M	R	2	10
PSM	AETLEFNDVYQEV	2771	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=29454	113.08	2	1597.7148	1597.7148	M	K	2	15
PSM	AGAAPTTAFGQAVIGPPGSG	2772	sp|Q9H9Y4|GPN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=24436	93.073	2	1767.8792	1767.8792	M	K	2	22
PSM	AGNAEPPPAGAACPQD	2773	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=9661	39.973	2	1563.6624	1563.6624	M	R	2	18
PSM	AKWGEGDP	2774	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=9951	41.003	2	900.39775	900.3977	M	R	2	10
PSM	AKYQGEVQSL	2775	sp|Q96K19-5|RN170_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=13432	53.921	2	1163.5823	1163.5823	M	K	2	12
PSM	ALDPADQHL	2776	sp|Q7Z7K0|COXM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=15322	60.722	2	1020.4876	1020.4876	M	R	2	11
PSM	ALPAGPAEAACALCQ	2777	sp|Q5TA31|RN187_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=24168	91.999	2	1540.7014	1540.7014	M	R	2	17
PSM	ALSMPLNGL	2778	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30018	115.21	2	956.5001	956.5001	M	K	2	11
PSM	ALSMPLNGL	2779	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30129	115.63	2	956.5001	956.5001	M	K	2	11
PSM	AMESTATAAVAAELVSAD	2780	sp|P49321-4|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=31965	122.54	2	1748.8138	1748.8138	M	K	2	20
PSM	ANRGPAYGLS	2781	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=10018	41.25	2	1046.5145	1046.5145	M	R	2	12
PSM	APEVLPKP	2782	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=8268	34.492	2	849.496	849.4960	M	R	2	10
PSM	APGQLALFSVSD	2783	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=23257	88.363	2	1203.6136	1203.6136	M	K	2	14
PSM	APVEHVVADAGAFL	2784	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=20718	79.005	2	1394.7194	1394.7194	M	R	2	16
PSM	AQPPPDVEGDDCLPAY	2785	sp|Q9NUI1-2|DECR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=22192	84.419	2	1784.7563	1784.7563	M	R	2	18
PSM	AQVAMSTLPVEDEESSES	2786	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=23451	89.116	2	1949.8412	1949.8412	M	R	2	20
PSM	ARDLIGPALPPGF	2787	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27105	104.08	2	1364.7452	1364.7452	M	K	2	15
PSM	ASATAPAAAVPTLASPLEQL	2788	sp|O95273-2|CCDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=31397	120.33	2	1920.0204	1920.0204	M	R	2	22
PSM	ASGVAVSDGVI	2789	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20177	77.154	2	1015.5186	1015.5186	M	K	2	13
PSM	ASLSTWSSPAEP	2790	sp|Q92888-3|ARHG1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=23108	87.795	2	1273.5826	1273.5826	M	R	2	14
PSM	ASSSTVPLGFHYET	2791	sp|Q9BXK5-2|B2L13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20367	77.796	2	1536.7096	1536.7096	M	K	2	16
PSM	ASVGECPAPVPVKD	2792	sp|P56134-3|ATPK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=12340	49.85	2	1466.7075	1466.7075	M	K	2	16
PSM	ASVSSATFSGHGA	2793	sp|Q7Z4H3-3|HDDC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=12038	48.717	2	1219.5469	1219.5469	M	R	2	15
PSM	ATETVELH	2794	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=9790	40.404	2	940.45018	940.4502	M	K	2	10
PSM	ATNFLAHE	2795	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=16296	64.183	2	943.43995	943.4399	M	K	2	10
PSM	ATNWGSLLQD	2796	sp|P48637-2|GSHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=28906	111.05	2	1145.5353	1145.5353	M	K	2	12
PSM	ATQVEPLLPGGATLLQAEEHGGLV	2797	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=31371	120.22	3	2441.2802	2441.2802	M	R	2	26
PSM	AVQESAAQLSMTL	2798	sp|Q7L5Y9-5|MAEA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27261	104.7	2	1389.681	1389.6810	M	K	2	15
PSM	AYNDTDRNQTE	2799	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5645	23.884	2	1367.559	1367.5590	M	K	2	13
PSM	CDKEFMWAL	2800	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=25134	95.999	2	1256.5206	1256.5206	M	K	2	11
PSM	CDKEFMWAL	2801	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=25255	96.474	2	1256.5206	1256.5206	M	K	2	11
PSM	GAVTDDEVIR	2802	sp|Q6I9Y2|THOC7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11738	47.571	2	1115.5459	1115.5459	M	K	2	12
PSM	GDTSEDASIH	2803	sp|Q92620-2|PRP16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5755	24.353	2	1072.4309	1072.4309	M	R	2	12
PSM	GSEDHGAQNPSC	2804	sp|O94953-2|KDM4B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,12-UNIMOD:4	ms_run[2]:scan=4098	17.368	2	1299.4786	1299.4786	M	K	2	14
PSM	GSGPIDPKELL	2805	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=22670	86.176	2	1166.6183	1166.6183	M	K	2	13
PSM	KAPVSSTESVIQSNTPTPPPSQPLNETAEEES	2806	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=15530	61.444	3	3350.6002	3350.6002	T	R	825	857
PSM	KFQSCLSPEEPAPESPQVPEAPGGSAV	2807	sp|Q99576-4|T22D3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:4	ms_run[2]:scan=16627	65.324	3	2794.312	2794.3120	E	-	96	123
PSM	KGIPGFGNTGNISGAPVTYPSAGAQGVNNTASGNNS	2808	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=18242	70.718	3	3375.608	3375.6080	A	R	642	678
PSM	KINETDTFGPGDDDEIQFDDIGDDDEDIDDI	2809	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=26705	102.45	3	3485.4278	3485.4278	A	-	114	145
PSM	KLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDAS	2810	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=25508	97.443	3	3503.6315	3503.6315	I	R	685	719
PSM	KPQPLQQPSQPQQPPPTQQAVA	2811	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=9145	37.913	3	2392.2499	2392.2499	L	R	3	25
PSM	KPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLP	2812	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=18713	72.286	3	2731.4141	2731.4141	S	R	5	38
PSM	KTPETVVPTAPELQASASTDQPVTSEPTS	2813	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=16151	63.66	3	2967.4561	2967.4561	V	R	1220	1249
PSM	KVGINYQPPTVVPGGDLA	2814	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=17805	69.24	2	1823.9781	1823.9781	F	K	236	254
PSM	KVPLPSLSPTMQAGTIA	2815	sp|P10515|ODP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:35	ms_run[2]:scan=16304	64.203	2	1725.9335	1725.9335	Q	R	93	110
PSM	MDEMATTQISKDELDEL	2816	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=21244	80.927	2	2041.8708	2041.8708	-	K	1	18
PSM	MDEMATTQISKDELDEL	2817	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=24218	92.213	2	2025.8759	2025.8759	-	K	1	18
PSM	MDEVEQDQHEA	2818	sp|Q8N4C6-6|NIN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7079	29.693	2	1387.5198	1387.5198	-	R	1	12
PSM	MDFEDDYTHSAC	2819	sp|Q5BKZ1-2|ZN326_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15200	60.274	2	1547.5181	1547.5181	-	R	1	13
PSM	MDFENLFSKPPNPALG	2820	sp|Q8N5P1|ZC3H8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27811	106.89	2	1833.8607	1833.8607	-	K	1	17
PSM	MDGFAGSLDDSISAASTSDVQD	2821	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26047	99.701	2	2245.9169	2245.9169	-	R	1	23
PSM	MDKYDDLGLEAS	2822	sp|Q9UGP4|LIMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16245	64.001	2	1413.597	1413.5970	-	K	1	13
PSM	MDPFTEKLLE	2823	sp|Q9NQW6-2|ANLN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27729	106.58	2	1263.6057	1263.6057	-	R	1	11
PSM	MDSAGQDINLNSPN	2824	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18313	70.935	2	1516.6464	1516.6464	-	K	1	15
PSM	MDSAGQDINLNSPN	2825	sp|O43399-2|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18455	71.399	2	1516.6464	1516.6464	-	K	1	15
PSM	MDTLDRVV	2826	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=21976	83.578	2	989.48518	989.4852	-	K	1	9
PSM	MDVLVSECSA	2827	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=16669	65.484	2	1167.4788	1167.4788	-	R	1	11
PSM	MDVLVSECSA	2828	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=25291	96.616	2	1151.4839	1151.4839	-	R	1	11
PSM	MDYLTTFTEKSG	2829	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27592	106.04	2	1433.6384	1433.6384	-	R	1	13
PSM	MEADIITNL	2830	sp|Q96EA4-2|SPDLY_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26009	99.536	2	1076.506	1076.5060	-	R	1	10
PSM	MEDLGENTMVLSTL	2831	sp|Q9Y6D9|MD1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=26070	99.799	2	1625.7164	1625.7164	-	R	1	15
PSM	MEDMNEYSNIEEFAEGS	2832	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28174	108.26	2	2051.7612	2051.7612	-	K	1	18
PSM	MEEASEGGGND	2833	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=7966	33.216	2	1136.3928	1136.3928	-	R	1	12
PSM	MEEISLANLDTN	2834	sp|Q96GX2|A7L3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=29090	111.73	2	1390.6286	1390.6286	-	K	1	13
PSM	MEEVVIAGMSG	2835	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=22169	84.325	2	1179.5152	1179.5152	-	K	1	12
PSM	MEEVVIAGMSG	2836	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30919	118.53	2	1163.5202	1163.5202	-	K	1	12
PSM	MEGGGGIPLETL	2837	sp|Q6P4H8-2|ACKMT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25148	96.057	2	1230.5802	1230.5802	-	K	1	13
PSM	MEGLDDGPDFLSEED	2838	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25957	99.315	2	1725.6563	1725.6563	M	R	2	17
PSM	MEGPLSVFGD	2839	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29023	111.48	2	1108.4747	1108.4747	-	R	1	11
PSM	MEGPLSVFGD	2840	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29141	111.9	2	1108.4747	1108.4747	-	R	1	11
PSM	MEKTELIQ	2841	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9299	38.534	2	1048.5111	1048.5111	-	K	1	9
PSM	MEKTELIQ	2842	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=13612	54.596	2	1032.5161	1032.5161	-	K	1	9
PSM	MENFQKVE	2843	sp|P24941-2|CDK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9440	39.114	2	1081.475	1081.4750	-	K	1	9
PSM	MENMAEEELLPLE	2844	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26697	102.41	2	1620.6899	1620.6899	-	K	1	14
PSM	MEPVGCCGEC	2845	sp|Q8NEZ5-2|FBX22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4,7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=8206	34.25	2	1255.3978	1255.3978	-	R	1	11
PSM	MEQEPQNGEPAEI	2846	sp|Q8N0X7|SPART_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13304	53.441	2	1528.6352	1528.6352	-	K	1	14
PSM	MESAGLEQLL	2847	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27928	107.36	2	1147.5431	1147.5431	-	R	1	11
PSM	MESMFSSPAEAALQ	2848	sp|Q9BQC3-2|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=20465	78.123	2	1571.6484	1571.6484	-	R	1	15
PSM	MEVSPLQPVNENMQVN	2849	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21485	81.805	2	1885.855	1885.8550	-	K	1	17
PSM	MFEEKASSPSG	2850	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8080	33.693	2	1226.5125	1226.5125	-	K	1	12
PSM	MFPAAPSP	2851	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17190	67.278	1	874.38949	874.3895	-	R	1	9
PSM	MFSWLGTDDR	2852	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24146	91.912	2	1284.5445	1284.5445	-	R	1	11
PSM	MFTSTGSSGLY	2853	sp|Q8NBM4-5|UBAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=12755	51.368	2	1165.4961	1165.4961	-	K	1	12
PSM	MHFSIPETES	2854	sp|Q15036-2|SNX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15334	60.752	2	1234.5176	1234.5176	-	R	1	11
PSM	MISAAQLLDELMG	2855	sp|O95232-2|LC7L3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=33329	127.17	2	1464.684	1464.6840	-	R	1	14
PSM	MKETIMNQE	2856	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8130	33.913	2	1180.5104	1180.5104	-	K	1	10
PSM	MLGAVEGPRW	2857	sp|Q14012|KCC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20029	76.614	2	1172.5648	1172.5648	-	K	1	11
PSM	MLGTEGGEGFVV	2858	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=20464	78.12	2	1194.5591	1194.5591	M	K	2	14
PSM	MLQNVTPHN	2859	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9347	38.728	2	1110.5128	1110.5128	-	K	1	10
PSM	MLQNVTPHN	2860	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9460	39.202	2	1110.5128	1110.5128	-	K	1	10
PSM	MLQNVTPHN	2861	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=14521	57.8	2	1094.5179	1094.5179	-	K	1	10
PSM	MMPTPVILL	2862	sp|Q99832|TCPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=28540	109.71	2	1087.5657	1087.5657	-	K	1	10
PSM	MMPTPVILL	2863	sp|Q99832|TCPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=28658	110.15	2	1087.5657	1087.5657	-	K	1	10
PSM	MNGEADCPTDLEMAAP	2864	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=16763	65.826	2	1794.6747	1794.6747	-	K	1	17
PSM	MNGEADCPTDLEMAAP	2865	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=20138	77.012	2	1778.6797	1778.6797	-	K	1	17
PSM	MNHQQQQQQQ	2866	sp|Q93009|UBP7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=4166	17.685	2	1338.5735	1338.5735	-	K	1	11
PSM	MNPVYSPGSSGVPYANA	2867	sp|A1KXE4-2|F168B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19711	75.545	2	1767.7774	1767.7774	-	K	1	18
PSM	MNSIKNVPA	2868	sp|O75146-2|HIP1R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8283	34.539	2	1030.5117	1030.5117	-	R	1	10
PSM	MPMFIVNTNVP	2869	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=21568	82.101	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	2870	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=21578	82.14	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	2871	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=21699	82.6	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	2872	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=24491	93.304	2	1261.6199	1261.6199	-	R	1	12
PSM	MPMFIVNTNVP	2873	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=24606	93.768	2	1261.6199	1261.6199	-	R	1	12
PSM	MQSDDVIWDTLGN	2874	sp|Q9BXY0|MAK16_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28805	110.7	2	1550.6559	1550.6559	-	K	1	14
PSM	MQSPAVLVTSR	2875	sp|Q53T59|H1BP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=17777	69.152	2	1229.6438	1229.6438	-	R	1	12
PSM	MQTPVNIPVPVL	2876	sp|Q9H840|GEMI7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30252	116.09	2	1364.7374	1364.7374	-	R	1	13
PSM	MQTPVNIPVPVL	2877	sp|Q9H840|GEMI7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=32690	125.11	2	1348.7425	1348.7425	-	R	1	13
PSM	MSLIINTFYSN	2878	sp|Q58FF6|H90B4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=22211	84.498	2	1317.6275	1317.6275	-	K	1	12
PSM	MSLIINTFYSN	2879	sp|Q58FF6|H90B4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=22336	84.97	2	1317.6275	1317.6275	-	K	1	12
PSM	MTLEAIRYS	2880	sp|Q9BV20-2|MTNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=16205	63.858	2	1140.5485	1140.5485	-	R	1	10
PSM	MTLEAIRYS	2881	sp|Q9BV20-2|MTNA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=21767	82.866	2	1124.5536	1124.5536	-	R	1	10
PSM	MVGGGGVGGGLLENANPLIYQ	2882	sp|Q9Y3D0|CIA2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:35	ms_run[2]:scan=25130	95.982	2	2031.0095	2031.0095	-	R	1	22
PSM	MVNFTVDQI	2883	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=21151	80.575	2	1065.5165	1065.5165	-	R	1	10
PSM	MYNGIGLPTP	2884	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24602	93.751	2	1119.527	1119.5270	-	R	1	11
PSM	MYNGIGLPTP	2885	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27821	106.93	2	1103.5321	1103.5321	-	R	1	11
PSM	MYNGIGLPTP	2886	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=27938	107.39	2	1103.5321	1103.5321	-	R	1	11
PSM	PAGPVQAVPPPPPVPTEPKQPTEEEASS	2887	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=14944	59.331	3	2832.4182	2832.4182	M	K	2	30
PSM	PAMPSSGPGDTSSSAAE	2888	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=7431	31.121	2	1547.641	1547.6410	M	R	2	19
PSM	PAVSLPPKENALF	2889	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=20380	77.833	2	1381.7606	1381.7606	M	K	2	15
PSM	PFLELDTNLPAN	2890	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=24636	93.903	2	1342.6769	1342.6769	M	R	2	14
PSM	PFPVTTQGSQQTQPPQ	2891	sp|P51003-2|PAPOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11124	45.541	3	1739.8479	1739.8479	M	K	2	18
PSM	PMFIVNTNVP	2892	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:35	ms_run[2]:scan=17828	69.308	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	2893	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:35	ms_run[2]:scan=18945	73.08	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	2894	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:35	ms_run[2]:scan=19363	74.496	2	1146.5743	1146.5743	M	R	2	12
PSM	PYQYPALTPEQ	2895	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=14799	58.814	2	1305.6241	1305.6241	M	K	2	13
PSM	PYQYPALTPEQK	2896	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=13203	53.068	2	1433.7191	1433.7191	M	K	2	14
PSM	RDEVVSPLPSALQGPSGSLSAPPAASVISAPPSSSS	2897	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=23960	91.119	3	3401.7314	3401.7314	C	R	325	361
PSM	SAADEVDGLGVA	2898	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20289	77.532	2	1144.5248	1144.5248	M	R	2	14
PSM	SAQSVEEDSILIIPTPDEEE	2899	sp|P17028-2|ZNF24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30865	118.33	2	2242.0376	2242.0376	M	K	2	22
PSM	SCGRPPPDVDGMITL	2900	sp|Q9BRL6-2|SRSF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=18217	70.644	2	1671.7596	1671.7596	M	K	2	17
PSM	SCGRPPPDVDGMITL	2901	sp|Q9BRL6-2|SRSF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=22678	86.199	2	1655.7647	1655.7647	M	K	2	17
PSM	SDEASAITSYE	2902	sp|Q6PEV8-2|F199X_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18076	70.141	2	1213.4986	1213.4986	M	K	2	13
PSM	SDHGDVSLPPED	2903	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=10901	44.704	2	1308.547	1308.5470	M	R	2	14
PSM	SDHGDVSLPPED	2904	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11021	45.15	2	1308.547	1308.5470	M	R	2	14
PSM	SDHGDVSLPPED	2905	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11154	45.635	2	1308.547	1308.5470	M	R	2	14
PSM	SDKPDLSEVE	2906	sp|P0CG35|TB15B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11849	47.999	2	1159.5245	1159.5245	M	K	2	12
PSM	SDTWSSIQAH	2907	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=14602	58.092	2	1172.5098	1172.5098	M	K	2	12
PSM	SEDLAKQLASY	2908	sp|O75940|SPF30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=22782	86.562	2	1265.6139	1265.6139	M	K	2	13
PSM	SEEIITPVYCTGVSAQVQ	2909	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,10-UNIMOD:4	ms_run[2]:scan=25029	95.544	2	2021.9616	2021.9616	M	K	2	20
PSM	SEKSVEAAAELSA	2910	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=15141	60.053	2	1332.6409	1332.6409	M	K	2	15
PSM	SEKSVEAAAELSA	2911	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=15269	60.535	2	1332.6409	1332.6409	M	K	2	15
PSM	SGELPPNINIKEP	2912	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20649	78.766	2	1448.7511	1448.7511	M	R	2	15
PSM	SGELPPNINIKEP	2913	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=20773	79.198	2	1448.7511	1448.7511	M	R	2	15
PSM	SIMSYNGGAVMAM	2914	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35,11-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=14106	56.303	2	1420.5673	1420.5673	M	K	2	15
PSM	SIMSYNGGAVMAM	2915	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=23902	90.87	2	1388.5774	1388.5774	M	K	2	15
PSM	SLVIRNLQ	2916	sp|P58557-4|YBEY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18630	71.989	2	983.57638	983.5764	M	R	2	10
PSM	SLVIRNLQ	2917	sp|P58557-4|YBEY_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=18761	72.447	2	983.57638	983.5764	M	R	2	10
PSM	SLYPSLEDLKVD	2918	sp|O00560-2|SDCB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=26848	103.02	2	1419.7133	1419.7133	M	K	2	14
PSM	SPAAAAAGAGE	2919	sp|A8CG34|P121C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=4432	18.85	2	871.40356	871.4036	M	R	2	13
PSM	SQGPPTGESSEPEA	2920	sp|Q9UPR3|SMG5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8700	36.206	2	1413.5896	1413.5896	M	K	2	16
PSM	SQYTEKEPAAMDQESG	2921	sp|O43164-2|PJA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11372	46.346	2	1811.752	1811.7520	M	K	2	18
PSM	SSVQQQPPPP	2922	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=8110	33.824	2	1105.5404	1105.5404	M	R	2	12
PSM	STGDSFETRFE	2923	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=16529	64.985	2	1316.5521	1316.5521	M	K	2	13
PSM	STPAVPQDLQLPPSQ	2924	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=22305	84.845	2	1618.8203	1618.8203	M	R	2	17
PSM	STPAVPQDLQLPPSQ	2925	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=22436	85.328	2	1618.8203	1618.8203	M	R	2	17
PSM	SVELEEALPVTTAEGMA	2926	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30420	116.73	2	1787.8499	1787.8499	M	K	2	19
PSM	SYAEKPDEIT	2927	sp|Q9NWU2|GID8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=10630	43.654	2	1193.5452	1193.5452	M	K	2	12
PSM	SYDYHQNWG	2928	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=14702	58.479	2	1210.468	1210.4680	M	R	2	11
PSM	TDSKYFTTN	2929	sp|P63010|AP2B1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=11584	47.049	2	1117.4928	1117.4928	M	K	2	11
PSM	TSPEIASLSWGQM	2930	sp|Q9H7C9-3|AAMDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,13-UNIMOD:35	ms_run[2]:scan=26287	100.66	2	1463.6602	1463.6602	M	K	2	15
PSM	TSSKIEMPGEV	2931	sp|O94788-2|AL1A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=9833	40.555	2	1234.5751	1234.5751	M	K	2	13
PSM	TTDEGAKNNEESPTATVAEQGEDITS	2932	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=11684	47.38	3	2693.1788	2693.1788	M	K	2	28
PSM	TTSASSHLN	2933	sp|P15104|GLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=5225	22.133	2	958.43559	958.4356	M	K	2	11
PSM	TTSGALFPSLVPGS	2934	sp|Q16186|ADRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=30938	118.6	2	1374.7031	1374.7031	M	R	2	16
PSM	TTSGALFPSLVPGS	2935	sp|Q16186|ADRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1	ms_run[2]:scan=31052	119.03	2	1374.7031	1374.7031	M	R	2	16
PSM	VDMMDLPRS	2936	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=16523	64.966	2	1120.4893	1120.4893	M	R	2	11
PSM	VDMMDLPRS	2937	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=16658	65.448	2	1120.4893	1120.4893	M	R	2	11
PSM	VDYYEVLGVQ	2938	sp|O75190-2|DNJB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=22267	84.706	2	1183.5761	1183.5761	M	R	2	12
PSM	VMEKPSPLLVG	2939	sp|Q13283-2|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=12648	50.981	2	1168.6526	1168.6526	M	R	2	13
PSM	VPPVQVSPLI	2940	sp|P56385|ATP5I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	19		ms_run[2]:scan=19952	76.348	2	1047.6328	1047.6328	M	K	2	12
PSM	DDDIAALVVDNGSGMC	2941	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30132	115.64444737973334	2	1693.6912	1692.6962	M	K	2	18
PSM	DDIAALVVDNGSGMC	2942	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,15-UNIMOD:4	ms_run[1]:scan=31461	120.5718721832	2	1577.6789	1577.6696	D	K	3	18
PSM	DDIAALVVDNGSGMC	2943	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	15-UNIMOD:4	ms_run[1]:scan=23676	89.9985995208	2	1535.6712	1535.6592	D	K	3	18
PSM	EEEIAALVIDNGSGMC	2944	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31793	121.90444587146666	2	1748.7292	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2945	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32223	123.51056350293334	2	1748.7422	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	2946	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=33492	127.70710441760001	2	1749.7602	1748.7592	M	K	2	18
PSM	AGVEEVAASGSHLNGDLDPDD	2947	sp|P50579|MAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=22445	85.3616226896	2	2109.9112	2108.9132	M	R	2	23
PSM	AAAVAAAGAGEPQSPDELLP	2948	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=28118	108.053298184	2	1876.9132	1875.9212	M	K	2	22
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	2949	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=17607	68.6385100752	3	3091.4052	3089.3742	M	R	2	40
PSM	SNGYEDHMAEDCRGDIG	2950	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=12103	48.9549941184	2	1967.7362	1966.7412	M	R	2	19
PSM	PYTVVYFPVRG	2951	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=18213	70.63575626906666	2	1296.6913	1296.6861	P	R	3	14
PSM	MMEGLDDGPDFLSEED	2952	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[1]:scan=25561	97.655627392	2	1872.703027	1872.691742	-	R	1	17
PSM	KGLAAAEPTANGGLALASIEDQGAAAGGYCGS	2953	sp|Q15758|AAAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	30-UNIMOD:4	ms_run[1]:scan=21060	80.25772830160001	3	2949.420188	2947.398165	S	R	10	42
PSM	MDGIVPDIAVGTK	2954	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22936	87.12649954506666	2	1372.688679	1372.690818	-	R	1	14
PSM	MDGIVPDIAVGTK	2955	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20663	78.8096555544	2	1372.695770	1372.690818	-	R	1	14
PSM	APIKVGDAIPAVEVFEGEPGN	2956	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=24271	92.43181519333332	3	2108.0932	2108.0782	M	K	2	23
PSM	ADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQ	2957	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=21835	83.1042475952	5	4972.3972	4972.3632	M	R	2	58
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINAS	2958	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=14640	58.222325107466666	4	5747.4932	5747.4542	M	K	2	64
PSM	MVDMMDLPRS	2959	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=10518	43.21769585093333	2	1283.523754	1283.519596	-	R	1	11
PSM	APAMQPAEIQFAQ	2960	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	4-UNIMOD:35	ms_run[1]:scan=13786	55.2055156064	2	1416.6790	1416.6702	M	R	2	15
PSM	AFLASGPYLTHQQ	2961	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=14836	58.941601057599996	2	1432.7252	1431.7142	M	K	2	15
PSM	MNDTVTIRT	2962	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10201	41.97450687813333	2	1107.528938	1107.523024	-	R	1	10
PSM	MDEQSQGMQGPPVPQFQPQKAL	2963	sp|Q8TDX7|NEK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=20081	76.81667615066667	3	2515.167564	2514.151911	-	R	1	23
PSM	MTTDEGAKNNEESPTATVAEQGEDITS	2964	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14244	56.8399558256	3	2882.242761	2882.224737	-	K	1	28
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQ	2965	sp|Q9H2V7|SPNS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=26433	101.28326155946667	4	4714.1582	4714.1312	M	R	2	49
PSM	MNSNVENLPPHII	2966	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1	ms_run[1]:scan=23255	88.357473828	2	1519.763033	1518.750064	-	R	1	14
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2967	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17590	68.58149601946667	3	3230.421602	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	2968	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19607	75.18790246986667	3	3230.4202	3230.4022	Q	R	630	663
PSM	KMPDEPEEPVVAVSSPAVPPPT	2969	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	2-UNIMOD:35	ms_run[1]:scan=14872	59.06430649466667	3	2288.138619	2288.124616	A	K	456	478
PSM	ATATPVPPRMGS	2970	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=11835	47.93948875626666	2	1226.6232	1225.6122	M	R	2	14
PSM	MQNSHSGVNQLGGVFVNG	2971	sp|P26367|PAX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=18570	71.78551230346667	2	1901.877899	1901.869010	-	R	1	19
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	2972	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19929	76.26248627893332	3	2822.216217	2822.201105	-	K	1	25
PSM	MEMTEMTGVSLK	2973	sp|Q96PZ0|PUS7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=13115	52.73802924613334	2	1429.623359	1429.613890	-	R	1	13
PSM	PGVTVKDVNQQEFV	2974	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=13794	55.23264686	2	1558.8077	1558.7986	M	R	2	16
PSM	MEGHDPKEPEQL	2975	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8305	34.63054961386667	2	1467.629349	1466.634760	-	R	1	13
PSM	AASEVAGVVANAPSPPESSSLCAS	2976	sp|Q8ND24|RN214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,22-UNIMOD:4	ms_run[1]:scan=24368	92.80800205866667	3	2299.0762	2299.0632	M	K	2	26
PSM	AKPQVVVAPVLMS	2977	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=17467	68.19209241253333	2	1395.7852	1395.7790	M	K	2	15
PSM	AEGTAEAPLENGGGGDSGAGALE	2978	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=18175	70.47352805866667	2	2071.8952	2070.8972	M	R	2	25
PSM	SSSGLNSEKVAALIQ	2979	sp|Q13867|BLMH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=21429	81.59555202266667	2	1545.7982	1544.8042	M	K	2	17
PSM	MVGEEKMSL	2980	sp|P35610|SOAT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1	ms_run[1]:scan=18141	70.35138518666666	2	1064.502342	1064.488218	-	R	1	10
PSM	ATFSGPAGPILSLNPQEDVEFQ	2981	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=32769	125.36796672506667	2	2359.1532	2358.1372	M	K	2	24
PSM	ADSELQLVEQ	2982	sp|P07741|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=22820	86.70717753813332	2	1173.5472	1172.5552	M	R	2	12
PSM	MENFQKVE	2983	sp|P24941|CDK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9431	39.07790932186666	2	1081.482025	1081.475012	-	K	1	9
PSM	AEEGIAAGGVMDVNTALQEVL	2984	sp|P25398|RS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=33746	128.34707239413333	2	2129.0432	2128.0352	M	K	2	23
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	2985	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,7-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=27990	107.58445578266667	3	2929.3212	2929.3042	M	R	2	33
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	2986	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,24-UNIMOD:4	ms_run[1]:scan=30393	116.62755499306667	3	2913.3282	2913.3092	M	R	2	33
PSM	MDCCTENACSKPDDDILDIPLDDPGANAAAA	2987	sp|Q92686|NEUG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=26417	101.21106205253334	3	3392.398156	3392.378889	-	K	1	32
PSM	SGVRPPIMNGPLHP	2988	sp|Q13363-2|CTBP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,8-UNIMOD:35	ms_run[1]:scan=13505	54.1964936672	2	1528.7912	1528.7812	M	R	2	16
PSM	PDPSKSAPAP	2989	sp|Q8N257|H2B3B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19		ms_run[1]:scan=4562	19.399371216000002	2	965.4880	965.4813	M	K	2	12
PSM	AQETNQTPGPMLCSTGCGFYGNP	2990	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,11-UNIMOD:35,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=21534	81.97675359786668	3	2544.0492	2544.0352	M	R	2	25
PSM	MEMEKEFEQID	2991	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[1]:scan=14329	57.1506683968	2	1501.603248	1501.595263	-	K	1	12
PSM	MNHDFQALALES	2992	sp|Q8TB72|PUM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19569	75.07513045093333	2	1434.638023	1432.629280	-	R	1	13
PSM	MMCGAPSATQPATAETQHIADQV	2993	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=16923	66.37348718613333	2	2456.074803	2456.077031	-	R	1	24
PSM	RALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEET	2994	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=21497	81.85273558746667	3	3848.917626	3845.884710	E	R	354	390
PSM	AAAAAAGAGPEMV	2995	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=13618	54.614	2	1143.523	1143.5230	M	R	2	15
PSM	AAARPEAQS	2996	sp|Q8NCA9|ZN784_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4369	18.59	2	941.45666	941.4567	M	R	2	11
PSM	AAGAGTAGPASGPGVVRDPAASQP	2997	sp|Q15554-4|TERF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13117	52.746	3	2103.0345	2103.0345	M	R	2	26
PSM	AAGCCGVK	2998	sp|Q9Y4X0-2|AMMR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4561	19.397	2	863.36296	863.3630	M	K	2	10
PSM	AALGSPSHTF	2999	sp|Q96HJ9|FMC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14429	57.479	1	1028.4927	1028.4927	M	R	2	12
PSM	AAPCAEDPSLE	3000	sp|Q8NBT0-2|POC1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=13871	55.509	2	1200.4969	1200.4969	M	R	2	13
PSM	AAPEEHDSPTEASQPIVEEEET	3001	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14355	57.244	3	2436.0452	2436.0452	M	K	2	24
PSM	AAPEEHDSPTEASQPIVEEEET	3002	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14498	57.726	3	2436.0452	2436.0452	M	K	2	24
PSM	AAPPEPGEPEE	3003	sp|Q5RI15|COX20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10750	44.124	2	1163.4982	1163.4982	M	R	2	13
PSM	AAQGEPQVQF	3004	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19173	73.866	2	1115.5247	1115.5247	M	K	2	12
PSM	ADKMDMSLDDII	3005	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,4-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=21326	81.229	2	1439.616	1439.6160	M	K	2	14
PSM	ADKPDMGEIASFD	3006	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20070	76.774	2	1436.613	1436.6130	M	K	2	15
PSM	ADPEVCCFIT	3007	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=24701	94.178	2	1252.5104	1252.5104	M	K	2	12
PSM	ADSELQLVEQ	3008	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=21131	80.511	2	1172.5561	1172.5561	M	R	2	12
PSM	ADTQYILPNDIGVSSLDC	3009	sp|Q9NY33-2|DPP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,18-UNIMOD:4	ms_run[2]:scan=30008	115.17	2	2021.9252	2021.9252	M	R	2	20
PSM	ADTQYILPNDIGVSSLDC	3010	sp|Q9NY33-2|DPP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,18-UNIMOD:4	ms_run[2]:scan=30015	115.2	2	2021.9252	2021.9252	M	R	2	20
PSM	AEAEGESLESWLN	3011	sp|Q9NZ52-2|GGA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=30359	116.49	2	1475.6416	1475.6416	M	K	2	15
PSM	AEGEDVGWW	3012	sp|Q9NW68-9|BSDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29737	114.12	2	1089.4403	1089.4403	M	R	2	11
PSM	AEGEDVPPLPTSSGDGWE	3013	sp|Q9NUY8-2|TBC23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=25323	96.727	2	1883.8061	1883.8061	M	K	2	20
PSM	AELDQLPDESSSA	3014	sp|Q5TKA1-3|LIN9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20056	76.716	2	1402.61	1402.6100	M	K	2	15
PSM	AENPSLENH	3015	sp|O00505|IMA4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6932	29.076	2	1051.4571	1051.4571	M	R	2	11
PSM	AEPDPSHPLETQAG	3016	sp|Q8IXJ6-4|SIR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=11474	46.681	2	1489.6685	1489.6685	M	K	2	16
PSM	AERGELDLTGA	3017	sp|P13984|T2FB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=15151	60.097	2	1172.5673	1172.5673	M	K	2	13
PSM	AESSDKLY	3018	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=9665	39.989	2	953.43419	953.4342	M	R	2	10
PSM	AETVADTR	3019	sp|O60493-3|SNX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=6435	27.02	2	903.42977	903.4298	M	R	2	10
PSM	AEVEETLK	3020	sp|Q9NP97-2|DLRB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12042	48.727	2	959.48114	959.4811	M	R	2	10
PSM	AEVEETLK	3021	sp|Q9NP97-2|DLRB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12174	49.214	2	959.48114	959.4811	M	R	2	10
PSM	AGAAAESGRELWTFAGS	3022	sp|Q96EN8|MOCOS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=25577	97.729	2	1721.8009	1721.8009	M	R	2	19
PSM	AGGEDRGDGEPVSVVTV	3023	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16041	63.277	2	1684.7904	1684.7904	M	R	2	19
PSM	AGLGHPAAFG	3024	sp|O94760|DDAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14108	56.307	2	938.46102	938.4610	M	R	2	12
PSM	AGPESDAQYQFTGI	3025	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=19098	73.6	2	1482.6627	1482.6627	M	K	2	16
PSM	AKPQVVVAPVLMS	3026	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=21076	80.312	2	1379.7847	1379.7847	M	K	2	15
PSM	AKWGEGDP	3027	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=9829	40.54	2	900.39775	900.3977	M	R	2	10
PSM	ALFPAFAGLSEAPDGGSS	3028	sp|Q9H7Z3|NRDE2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=33761	128.38	2	1734.8101	1734.8101	M	R	2	20
PSM	ALKDYALE	3029	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16462	64.763	2	963.49131	963.4913	M	K	2	10
PSM	ALNVAPVRDT	3030	sp|Q5VZF2-3|MBNL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13329	53.544	2	1096.5877	1096.5877	M	K	2	12
PSM	ALNVAPVRDT	3031	sp|Q5VZF2-3|MBNL2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13369	53.693	2	1096.5877	1096.5877	M	K	2	12
PSM	ALPAGPAEAACALCQ	3032	sp|Q5TA31|RN187_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=24055	91.531	2	1540.7014	1540.7014	M	R	2	17
PSM	ANQVNGNAVQL	3033	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16493	64.86	2	1168.5836	1168.5837	M	K	2	13
PSM	ANQVNGNAVQL	3034	sp|O43390-3|HNRPR_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16624	65.315	2	1168.5836	1168.5837	M	K	2	13
PSM	APPSVFAEVPQAQPVLVF	3035	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=30019	115.21	2	1895.0193	1895.0193	M	K	2	20
PSM	AQEVSEYLSQNP	3036	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=25715	98.309	2	1405.6361	1405.6361	M	R	2	14
PSM	AQVAMSTLPVEDEESSES	3037	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=18247	70.73	2	1965.8361	1965.8361	M	R	2	20
PSM	AQVAMSTLPVEDEESSES	3038	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=18389	71.189	2	1965.8361	1965.8361	M	R	2	20
PSM	AQVAMSTLPVEDEESSES	3039	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=23574	89.588	2	1949.8412	1949.8412	M	R	2	20
PSM	AQWNQLQQLDT	3040	sp|P40763-3|STAT3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=25211	96.308	2	1385.6575	1385.6575	M	R	2	13
PSM	ASALEQFVNSV	3041	sp|Q9UNS2|CSN3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=33676	128.18	2	1205.5928	1205.5928	M	R	2	13
PSM	ASIWVGH	3042	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=17049	66.783	1	810.40244	810.4024	M	R	2	9
PSM	ASLLAKDAYLQSLA	3043	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=26881	103.15	2	1504.8137	1504.8137	M	K	2	16
PSM	ASNNTASIAQA	3044	sp|P59768|GBG2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=9338	38.686	2	1088.5098	1088.5098	M	R	2	13
PSM	ASPSLERPE	3045	sp|Q13601-2|KRR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8844	36.787	2	1026.4982	1026.4982	M	K	2	11
PSM	ASSSGNDDDLTIP	3046	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19991	76.492	2	1332.5681	1332.5681	M	R	2	15
PSM	ASSSGNDDDLTIP	3047	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20264	77.45	2	1332.5681	1332.5681	M	R	2	15
PSM	ASVTLSEAE	3048	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14865	59.04	2	947.44476	947.4448	M	K	2	11
PSM	ATATIALGTDSIKMENGQSTAA	3049	sp|Q9UHX1-6|PUF60_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,14-UNIMOD:35	ms_run[2]:scan=18880	72.849	3	2208.058	2208.0580	M	K	2	24
PSM	ATHGQTCA	3050	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=3929	16.583	2	886.36032	886.3603	M	R	2	10
PSM	ATKAVCVL	3051	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=13420	53.887	2	902.48954	902.4895	M	K	2	10
PSM	ATKTAGVG	3052	sp|Q6NUQ4-2|TM214_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4542	19.312	1	745.39702	745.3970	M	R	2	10
PSM	ATLEKLM	3053	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20606	78.615	2	846.45209	846.4521	M	K	2	9
PSM	ATSLGSNTYN	3054	sp|Q9NW64-2|RBM22_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=11875	48.114	2	1068.4724	1068.4724	M	R	2	12
PSM	ATVEPETTPTPNPPTTEEE	3055	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14581	58.017	2	2080.9324	2080.9324	M	K	2	21
PSM	AVSTGVKVP	3056	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13220	53.132	2	898.51238	898.5124	M	R	2	11
PSM	AVTLDKDAYY	3057	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=17772	69.14	2	1199.571	1199.5710	M	R	2	12
PSM	CDFTEDQTAEF	3058	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=23097	87.753	2	1403.5187	1403.5187	M	K	2	13
PSM	DDDIAALVVDNGSGMC	3059	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=32534	124.58	2	1708.692	1708.6920	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3060	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=26477	101.48	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3061	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=32414	124.18	2	1692.6971	1692.6971	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3062	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=32309	123.82	2	1692.6971	1692.6971	M	K	2	18
PSM	EEEIAALVIDNGSGMC	3063	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	16-UNIMOD:4	ms_run[2]:scan=24697	94.161	2	1706.7491	1706.7491	M	K	2	18
PSM	GEHGLELASMIPAL	3064	sp|Q13535-2|ATR_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=25999	99.493	2	1494.7388	1494.7388	M	R	2	16
PSM	GEKSENCGVPEDLLNGL	3065	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25611	97.87	2	1871.8571	1871.8571	M	K	2	19
PSM	GTRDDEYDYLF	3066	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=24232	92.27	2	1434.5939	1434.5939	M	K	2	13
PSM	GTRDDEYDYLF	3067	sp|P62491-2|RB11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=24767	94.453	2	1434.5939	1434.5939	M	K	2	13
PSM	GVEIETISPGDG	3068	sp|P68106-2|FKB1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=13615	54.601	2	1172.5561	1172.5561	M	R	2	14
PSM	KEGPYDVVVLPGGNLGAQNLSESAAV	3069	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=23099	87.757	3	2583.318	2583.3180	K	K	63	89
PSM	KILATPPQEDAPSVDIANI	3070	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=19888	76.116	2	1991.0575	1991.0575	K	R	283	302
PSM	KLQVEPAVDTSGVQCYGPGIEGQGVF	3071	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	15-UNIMOD:4	ms_run[2]:scan=22138	84.2	3	2734.3272	2734.3272	S	R	1246	1272
PSM	KSLGPAAPIIDSPYGDPIDPEDAPESIT	3072	sp|Q9H0L4|CSTFT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=23803	90.479	3	2864.3968	2864.3967	L	R	102	130
PSM	MAPEVLPKP	3073	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=10600	43.536	2	980.53649	980.5365	-	R	1	10
PSM	MDAAEVEFLAE	3074	sp|Q9Y248|PSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26110	99.967	2	1281.5435	1281.5435	-	K	1	12
PSM	MDAAEVEFLAE	3075	sp|Q9Y248|PSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26228	100.43	2	1281.5435	1281.5435	-	K	1	12
PSM	MDAATLTYDTL	3076	sp|Q9Y4P1-6|ATG4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24443	93.108	2	1271.5591	1271.5591	-	R	1	12
PSM	MDAATLTYDTL	3077	sp|Q9Y4P1-6|ATG4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29688	113.94	2	1255.5642	1255.5642	-	R	1	12
PSM	MDAATLTYDTL	3078	sp|Q9Y4P1-6|ATG4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29805	114.38	2	1255.5642	1255.5642	-	R	1	12
PSM	MDCEVNNGSSL	3079	sp|P55957-3|BID_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=11263	45.991	2	1282.4806	1282.4806	-	R	1	12
PSM	MDDKELIEYF	3080	sp|Q14232-2|EI2BA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26083	99.85	2	1359.5904	1359.5904	-	K	1	11
PSM	MDDREDLVYQA	3081	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16971	66.531	2	1395.5976	1395.5976	-	K	1	12
PSM	MDDREDLVYQA	3082	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=17610	68.647	2	1395.5976	1395.5976	-	K	1	12
PSM	MDEQSQGMQGPPVPQFQPQ	3083	sp|Q8TDX7-2|NEK7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=18996	73.261	2	2201.9358	2201.9358	-	K	1	20
PSM	MDETSPLVSPE	3084	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15302	60.651	2	1261.5384	1261.5384	-	R	1	12
PSM	MDFLLGNPFSSPVGQ	3085	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=34115	129.3	2	1649.7759	1649.7759	-	R	1	16
PSM	MDFQQLADVAE	3086	sp|Q8N3F0-4|MTURN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25691	98.213	2	1323.5653	1323.5653	-	K	1	12
PSM	MDGASAEQDGLQED	3087	sp|Q08378-4|GOGA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14903	59.175	2	1506.578	1506.5780	-	R	1	15
PSM	MDGIVPDIAVGT	3088	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25145	96.047	2	1244.5959	1244.5959	-	K	1	13
PSM	MDGIVPDIAVGT	3089	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=30745	117.91	2	1228.6009	1228.6009	-	K	1	13
PSM	MDKNELVQ	3090	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6931	29.074	2	1033.475	1033.4750	-	K	1	9
PSM	MDKNELVQ	3091	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10963	44.94	2	1017.4801	1017.4801	-	K	1	9
PSM	MDKSELVQ	3092	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6781	28.451	2	1006.4641	1006.4641	-	K	1	9
PSM	MDKSELVQ	3093	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10964	44.943	2	990.4692	990.4692	-	K	1	9
PSM	MDKYDDLGLEAS	3094	sp|Q9UGP4|LIMD1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20599	78.594	2	1397.6021	1397.6021	-	K	1	13
PSM	MDLFGDLPEPERSP	3095	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29235	112.26	2	1643.7501	1643.7501	-	R	1	15
PSM	MDNLSSEEIQQ	3096	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12885	51.847	2	1350.5609	1350.5609	-	R	1	12
PSM	MDNLSSEEIQQ	3097	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=18421	71.287	2	1334.566	1334.5660	-	R	1	12
PSM	MDQVMQFVEPS	3098	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=19328	74.382	2	1383.5687	1383.5687	-	R	1	12
PSM	MDQVMQFVEPS	3099	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=25610	97.867	2	1367.5737	1367.5737	-	R	1	12
PSM	MDRGEQGLL	3100	sp|P55327-2|TPD52_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16330	64.29	2	1059.5019	1059.5019	-	R	1	10
PSM	MDSLEEPQK	3101	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12087	48.897	2	1117.4961	1117.4961	-	K	1	10
PSM	MDSNHQSNY	3102	sp|Q96BT7-3|ALKB8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4697	19.95	2	1152.4142	1152.4142	-	K	1	10
PSM	MDTLDRVV	3103	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15590	61.665	2	1005.4801	1005.4801	-	K	1	9
PSM	MDTLDRVV	3104	sp|Q9H7B2|RPF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15754	62.258	2	1005.4801	1005.4801	-	K	1	9
PSM	MDVLVSECSA	3105	sp|P54136|SYRC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=25171	96.141	2	1151.4839	1151.4839	-	R	1	11
PSM	MEDCLHTSSENLS	3106	sp|Q8N8K9|K1958_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4	ms_run[2]:scan=10615	43.596	2	1579.613	1579.6130	-	K	1	14
PSM	MEDEVVRFA	3107	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17211	67.354	2	1152.5121	1152.5121	-	K	1	10
PSM	MEDFEDDPRALGA	3108	sp|Q9H1Z4-2|WDR13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17790	69.196	2	1522.6246	1522.6246	-	R	1	14
PSM	MEDMNEYSNIEEFAEGS	3109	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26351	100.93	2	2067.7561	2067.7561	-	K	1	18
PSM	MEDMNEYSNIEEFAEGS	3110	sp|O14979-3|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28260	108.6	2	2051.7612	2051.7612	-	K	1	18
PSM	MEELDGEPTVTLIPGVNS	3111	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28379	109.07	2	1957.919	1957.9190	-	K	1	19
PSM	MEELDGEPTVTLIPGVNS	3112	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28488	109.51	2	1957.919	1957.9190	-	K	1	19
PSM	MEELDGEPTVTLIPGVNS	3113	sp|Q9BW27|NUP85_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=32137	123.17	2	1941.9241	1941.9241	-	K	1	19
PSM	MEESVNQMQPLNE	3114	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=11807	47.829	2	1621.66	1621.6600	-	K	1	14
PSM	MEETQPPPQP	3115	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8923	37.091	2	1210.5176	1210.5176	-	K	1	11
PSM	MEGCVSNLMVCNLAYSG	3116	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=23619	89.771	2	1977.7941	1977.7941	-	K	1	18
PSM	MEGCVSNLMVCNLAYSG	3117	sp|O75832-2|PSD10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=27344	105.02	2	1961.7991	1961.7991	-	K	1	18
PSM	MEGQSVEELLA	3118	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25124	95.957	2	1262.57	1262.5700	-	K	1	12
PSM	MEGQSVEELLA	3119	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25244	96.428	2	1262.57	1262.5700	-	K	1	12
PSM	MEGQSVEELLA	3120	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29137	111.89	2	1246.5751	1246.5751	-	K	1	12
PSM	MEKTELIQ	3121	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9184	38.072	2	1048.5111	1048.5111	-	K	1	9
PSM	MEKTELIQ	3122	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13748	55.071	2	1032.5161	1032.5161	-	K	1	9
PSM	MELPSGPGPE	3123	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20583	78.538	2	1054.4641	1054.4641	-	R	1	11
PSM	MELPSGPGPE	3124	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20596	78.588	2	1054.4641	1054.4641	-	R	1	11
PSM	MENGAVYSPTTEEDPGPA	3125	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19027	73.37	2	1905.7938	1905.7938	-	R	1	19
PSM	MEPDGTYEPGFVGI	3126	sp|P36954|RPB9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26927	103.34	2	1568.6705	1568.6705	-	R	1	15
PSM	MEQANPLRPDGES	3127	sp|Q9BU64|CENPO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9992	41.152	2	1500.6515	1500.6515	-	K	1	14
PSM	MESALTARD	3128	sp|O00159-2|MYO1C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7858	32.763	2	1050.4652	1050.4652	-	R	1	10
PSM	MESEQLFH	3129	sp|P51790-4|CLCN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13805	55.275	2	1077.4437	1077.4437	-	R	1	9
PSM	MESPASSQPASMPQS	3130	sp|P46734|MP2K3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10451	42.987	2	1591.6494	1591.6494	-	K	1	16
PSM	MESQEPTESSQNG	3131	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5015	21.246	2	1480.5624	1480.5624	-	K	1	14
PSM	METEQPEETFPNTETNGEFG	3132	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21316	81.188	2	2343.9325	2343.9325	-	K	1	21
PSM	METILEQQ	3133	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=24851	94.818	2	1032.4798	1032.4798	-	R	1	9
PSM	MEVEQEQR	3134	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5100	21.588	2	1105.471	1105.4710	-	R	1	9
PSM	MEVKPPPG	3135	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6358	26.698	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	3136	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10525	43.244	2	895.44734	895.4473	-	R	1	9
PSM	MFCVTPPELET	3137	sp|O60256-3|KPRB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=25977	99.398	2	1380.5941	1380.5941	-	K	1	12
PSM	MFEEKASSPSG	3138	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8187	34.168	2	1226.5125	1226.5125	-	K	1	12
PSM	MFEEKASSPSG	3139	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8193	34.193	2	1226.5125	1226.5125	-	K	1	12
PSM	MFEEKASSPSG	3140	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8310	34.653	2	1226.5125	1226.5125	-	K	1	12
PSM	MFLQYYLNEQGD	3141	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:35	ms_run[2]:scan=22634	86.045	2	1535.6602	1535.6602	-	R	1	13
PSM	MFQVPDSEGG	3142	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17434	68.085	2	1123.4492	1123.4492	-	R	1	11
PSM	MFQVPDSEGGRAGS	3143	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13757	55.105	2	1494.6409	1494.6409	-	R	1	15
PSM	MFQVPDSEGGRAGS	3144	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13904	55.624	2	1494.6409	1494.6409	-	R	1	15
PSM	MHFSIPETES	3145	sp|Q15036-2|SNX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15208	60.298	2	1234.5176	1234.5176	-	R	1	11
PSM	MKASSGDQGSPPCFL	3146	sp|O75147-2|OBSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=16160	63.694	2	1638.7018	1638.7018	-	R	1	16
PSM	MKETIMNQE	3147	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=5236	22.175	2	1196.5053	1196.5053	-	K	1	10
PSM	MKETIMNQE	3148	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=8630	35.934	2	1180.5104	1180.5104	-	K	1	10
PSM	MLEAPGPSDGCELSNPSAS	3149	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=18060	70.083	2	1975.8139	1975.8139	-	R	1	20
PSM	MLEELECGAPGA	3150	sp|Q13111-2|CAF1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=21663	82.459	2	1333.553	1333.5530	-	R	1	13
PSM	MLGAVEGPRW	3151	sp|Q14012|KCC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19994	76.502	2	1172.5648	1172.5648	-	K	1	11
PSM	MLQNVTPHN	3152	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14636	58.208	2	1094.5179	1094.5179	-	K	1	10
PSM	MLSLQYPDVY	3153	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27493	105.63	2	1285.59	1285.5900	-	R	1	11
PSM	MMEGLDDGPDFLSEED	3154	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28640	110.08	2	1856.6968	1856.6968	-	R	1	17
PSM	MNDTVTIRT	3155	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9631	39.865	2	1107.523	1107.5230	-	R	1	10
PSM	MNDTVTIRT	3156	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9763	40.314	2	1107.523	1107.5230	-	R	1	10
PSM	MNDTVTIRT	3157	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13858	55.478	2	1091.5281	1091.5281	-	R	1	10
PSM	MNHDFQALALES	3158	sp|Q8TB72-2|PUM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19561	75.048	2	1432.6293	1432.6293	-	R	1	13
PSM	MNPVYSPGSSGVPYANA	3159	sp|A1KXE4-2|F168B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19859	76.037	2	1767.7774	1767.7774	-	K	1	18
PSM	MNYQQQLANSAAI	3160	sp|Q9UPQ3-3|AGAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=20845	79.485	2	1508.6929	1508.6929	-	R	1	14
PSM	MPMFIVNTNVP	3161	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:35	ms_run[2]:scan=21309	81.161	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	3162	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:35	ms_run[2]:scan=21437	81.621	2	1277.6148	1277.6148	-	R	1	12
PSM	MQGGEPVSTM	3163	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=6172	25.929	2	1109.4369	1109.4369	-	K	1	11
PSM	MQHVSSSQSSQ	3164	sp|Q6ZTU2-4|E400N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=5677	24.024	2	1246.5248	1246.5248	-	R	1	12
PSM	MQNPQILAALQE	3165	sp|P55209-3|NP1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=28848	110.85	2	1396.7021	1396.7021	M	R	2	14
PSM	MQPPPPGPLGDCL	3166	sp|Q9BXJ8-2|TACAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=22497	85.546	2	1435.6476	1435.6476	-	R	1	14
PSM	MSTGTFVVSQPLNY	3167	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21452	81.673	2	1542.7388	1542.7388	-	R	1	15
PSM	MTMDKSELVQ	3168	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10718	43.996	2	1238.5523	1238.5523	-	K	1	11
PSM	MTQQGAALQNYNNELV	3169	sp|O43805|SSNA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=21055	80.235	2	1850.8469	1850.8469	-	K	1	17
PSM	MVDMMDLPRS	3170	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19541	74.984	2	1251.5298	1251.5298	-	R	1	11
PSM	MVDMMDLPRS	3171	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=24588	93.691	2	1235.5349	1235.5349	-	R	1	11
PSM	MVEEENIRVV	3172	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15641	61.851	2	1274.6177	1274.6177	-	R	1	11
PSM	MWGDSRPAN	3173	sp|P78332-3|RBM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8407	35.029	2	1090.4502	1090.4502	-	R	1	10
PSM	NDTVTIRT	3174	sp|P62847-2|RS24_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=9378	38.872	2	960.48762	960.4876	M	R	2	10
PSM	PAVSLPPKENALF	3175	sp|Q9BXJ9-4|NAA15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=19414	74.639	2	1381.7606	1381.7606	M	K	2	15
PSM	PDQALQQMLD	3176	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:35	ms_run[2]:scan=9501	39.354	2	1173.5336	1173.5336	M	R	2	12
PSM	PDQALQQMLD	3177	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:35	ms_run[2]:scan=9617	39.81	2	1173.5336	1173.5336	M	R	2	12
PSM	PDQALQQMLD	3178	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=16670	65.485	2	1157.5387	1157.5387	M	R	2	12
PSM	PLPEPSEQEGESV	3179	sp|Q96CP2|FWCH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=11710	47.467	2	1396.6358	1396.6358	M	K	2	15
PSM	PMFIVNTNVP	3180	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=17968	69.791	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3181	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18114	70.258	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3182	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18245	70.726	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3183	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18388	71.187	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3184	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18529	71.653	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3185	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18671	72.133	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3186	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=18803	72.601	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3187	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=19077	73.544	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3188	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=19219	74.007	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3189	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=20650	78.769	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3190	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=20774	79.202	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3191	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=20894	79.666	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3192	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=21111	80.438	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3193	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=21240	80.909	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3194	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=21500	81.861	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3195	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=21569	82.106	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3196	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:35	ms_run[2]:scan=21635	82.354	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3197	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21249	80.943	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3198	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21379	81.421	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3199	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21510	81.902	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3200	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21640	82.374	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3201	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21761	82.847	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3202	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=21893	83.306	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3203	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=22037	83.811	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3204	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=22157	84.278	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3205	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=22277	84.743	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3206	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=22413	85.239	2	1130.5794	1130.5794	M	R	2	12
PSM	PMFIVNTNVP	3207	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=22548	85.733	2	1130.5794	1130.5794	M	R	2	12
PSM	PVQETQAPESPGENSEQALQTLSP	3208	sp|Q7Z434-4|MAVS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=18214	70.639	3	2536.1929	2536.1929	M	R	2	26
PSM	PYQYPALTPEQ	3209	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=15323	60.724	2	1305.6241	1305.6241	M	K	2	13
PSM	RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA	3210	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=13061	52.524	4	3327.6789	3327.6789	N	R	214	245
PSM	REPPPAYEPPAPAPLPPPSAPSLQPS	3211	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=17824	69.294	3	2659.3646	2659.3646	T	R	47	73
PSM	RVMTIPYQPMPASSPVICAGGQD	3212	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=17292	67.619	3	2490.1705	2490.1705	G	R	177	200
PSM	RVMTIPYQPMPASSPVICAGGQD	3213	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=17300	67.644	3	2490.1705	2490.1705	G	R	177	200
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	3214	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=20390	77.868	3	2849.4244	2849.4244	P	R	634	661
PSM	SAADEVDGLGVARPHYGSVLDNE	3215	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=20414	77.942	3	2412.1193	2412.1193	M	R	2	25
PSM	SAFSEAALE	3216	sp|Q96P16|RPR1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=21261	80.99	2	965.43419	965.4342	M	K	2	11
PSM	SAFSEAALEK	3217	sp|Q96P16|RPR1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=15471	61.242	2	1093.5292	1093.5292	M	K	2	12
PSM	SAQGDCEFLVQRA	3218	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=17075	66.879	2	1521.6882	1521.6882	M	R	2	15
PSM	SCGRPPPDVDGMITL	3219	sp|Q9BRL6-2|SRSF8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=18238	70.705	2	1671.7596	1671.7596	M	K	2	17
PSM	SDHGDVSLPPED	3220	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12092	48.913	2	1308.547	1308.5470	M	R	2	14
PSM	SDKPDMAEIE	3221	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=7195	30.175	2	1191.4965	1191.4965	M	K	2	12
PSM	SDRLGQIT	3222	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10982	45.016	2	930.47706	930.4771	M	K	2	10
PSM	SDRSGPTA	3223	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4112	17.432	2	831.37226	831.3723	M	K	2	10
PSM	SDSEKLNLDSIIG	3224	sp|P62136-3|PP1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=24568	93.61	2	1431.7093	1431.7093	M	R	2	15
PSM	SEKENNFPPLP	3225	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=18475	71.475	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	3226	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=18902	72.937	2	1312.6299	1312.6299	M	K	2	13
PSM	SEKENNFPPLP	3227	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19510	74.892	2	1312.6299	1312.6299	M	K	2	13
PSM	SETAPAAPAAPAPAEKTPV	3228	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=9465	39.222	2	1774.9101	1774.9101	M	K	2	21
PSM	SGALDVLQM	3229	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29007	111.42	2	974.47428	974.4743	M	K	2	11
PSM	SGALDVLQM	3230	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=29126	111.85	2	974.47428	974.4743	M	K	2	11
PSM	SGEDEQQEQTIAEDLVVT	3231	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=26312	100.76	2	2031.912	2031.9120	M	K	2	20
PSM	SGEDEQQEQTIAEDLVVT	3232	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=26426	101.25	2	2031.912	2031.9120	M	K	2	20
PSM	SGGEVVCSGWL	3233	sp|Q13480|GAB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=26449	101.35	2	1191.523	1191.5230	M	R	2	13
PSM	SGPDVETPSAIQIC	3234	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,14-UNIMOD:4	ms_run[2]:scan=21484	81.802	2	1514.6923	1514.6923	M	R	2	16
PSM	SGPRPVVLSGPSGAG	3235	sp|Q16774|KGUA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12912	51.952	2	1378.7205	1378.7205	M	K	2	17
PSM	SGTSSPEAVK	3236	sp|Q7Z3U7-2|MON2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4755	20.178	2	1003.4822	1003.4822	M	K	2	12
PSM	SKNTVSSA	3237	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=4078	17.273	2	834.40831	834.4083	M	R	2	10
PSM	SKSFQQSSLS	3238	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=8812	36.666	2	1139.5459	1139.5459	M	R	2	12
PSM	SLDIQSLDIQCEELSDA	3239	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=30924	118.54	2	1976.8885	1976.8885	M	R	2	19
PSM	SNIYIQEPPTNG	3240	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=17547	68.458	2	1373.6463	1373.6463	M	K	2	14
PSM	SQAPGAQPSPPTVYHE	3241	sp|Q8TAC2-2|JOS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=12084	48.885	2	1706.79	1706.7900	M	R	2	18
PSM	STPAVPQDLQLPPSQ	3242	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=22074	83.951	2	1618.8203	1618.8203	M	R	2	17
PSM	STPAVPQDLQLPPSQ	3243	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=22580	85.855	2	1618.8203	1618.8203	M	R	2	17
PSM	STVHEILC	3244	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=14197	56.652	2	999.46953	999.4695	M	K	2	10
PSM	SVGCACPGCSS	3245	sp|Q86U70|LDB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,4-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7352	30.809	2	1182.4104	1182.4104	M	K	2	13
PSM	SYNYVVTAQ	3246	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16927	66.385	2	1085.5029	1085.5029	M	K	2	11
PSM	SYNYVVTAQ	3247	sp|Q16531-2|DDB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=17067	66.853	2	1085.5029	1085.5029	M	K	2	11
PSM	TAVHAGNINF	3248	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16470	64.784	2	1084.5302	1084.5302	M	K	2	12
PSM	TAVHAGNINF	3249	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=16604	65.253	2	1084.5302	1084.5302	M	K	2	12
PSM	TELQSALLL	3250	sp|P62253|UB2G1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=31779	121.85	2	1028.5754	1028.5754	M	R	2	11
PSM	TEWETAAPAVAETPDI	3251	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=27298	104.85	2	1741.8047	1741.8047	M	K	2	18
PSM	TGAEIEPSAQAKPE	3252	sp|Q96D09|GASP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18		ms_run[2]:scan=6181	25.968	2	1426.694	1426.6940	M	K	2	16
PSM	TSALTQGLE	3253	sp|Q0VGL1|LTOR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19721	75.58	2	960.47639	960.4764	M	R	2	11
PSM	TSIHFVVHPLPGTEDQLND	3254	sp|O95071-2|UBR5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=22147	84.238	3	2160.0487	2160.0487	M	R	2	21
PSM	TTLDDKLLGE	3255	sp|Q13371|PHLP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=19592	75.145	2	1145.5816	1145.5816	M	K	2	12
PSM	TTSGALFPSLVPGS	3256	sp|Q16186|ADRM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=30819	118.17	2	1374.7031	1374.7031	M	R	2	16
PSM	VDMMDLPRS	3257	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=10776	44.229	2	1136.4842	1136.4842	M	R	2	11
PSM	VDMMDLPRS	3258	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=10896	44.689	2	1136.4842	1136.4842	M	R	2	11
PSM	VDMMDLPRS	3259	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=15709	62.08	2	1120.4893	1120.4893	M	R	2	11
PSM	VDMMDLPRS	3260	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=21229	80.87	2	1104.4944	1104.4944	M	R	2	11
PSM	VDREQLVQ	3261	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=10863	44.569	2	1027.5298	1027.5298	M	K	2	10
PSM	VEAAPPGPGPLR	3262	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=13970	55.82	2	1201.6455	1201.6455	M	R	2	14
PSM	VEAAPPGPGPLR	3263	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=14110	56.314	2	1201.6455	1201.6455	M	R	2	14
PSM	VEQGDAAPLL	3264	sp|A4D1U4|DEN11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1	ms_run[2]:scan=23466	89.17	1	1053.5342	1053.5342	M	R	2	12
PSM	VICCAAVNCSN	3265	sp|Q8WY91|THAP4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:4,4-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7145	29.982	2	1266.5155	1266.5155	M	R	2	13
PSM	VSVINTVDTSHEDMIHDAQMDYYGT	3266	sp|P55735|SEC13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:1,14-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=22098	84.048	3	2914.2273	2914.2273	M	R	2	27
PSM	DDDIAALVVDNGSGMC	3267	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30123	115.608464296	2	1693.6912	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3268	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=27929	107.35886765226665	2	1692.6772	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3269	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30579	117.31264362186667	2	1694.6962	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3270	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30784	118.03965290213334	2	1692.6982	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3271	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=30795	118.07888618426666	2	1694.7022	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3272	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=29612	113.67907416133333	2	1692.6920	1692.6966	M	K	2	18
PSM	AMESTATAAVAAELVSADKIEDVPAPSTSAD	3273	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,2-UNIMOD:35	ms_run[1]:scan=28845	110.83721336026666	3	3075.4642	3075.4432	M	K	2	33
PSM	MMLGTEGGEGFVVKV	3274	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[1]:scan=21710	82.64956118746666	2	1626.772068	1626.763332	-	R	1	16
PSM	AGPVQAVPPPPPVPTEPKQPTEEEASS	3275	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=14339	57.185578356533334	3	2735.3842	2735.3652	P	K	3	30
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGP	3276	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=25336	96.78489845466667	3	2451.2382	2451.2232	M	R	2	32
PSM	AAAVLSGPSAGSAAGVPGGTGGLSAVSSGP	3277	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=25331	96.76550876426667	3	2451.2382	2451.2232	M	R	2	32
PSM	AETLSGLGDSGAAGAAALSSASSETGT	3278	sp|Q15424|SAFB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=26243	100.48569648346667	3	2380.1022	2380.0872	M	R	2	29
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	3279	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	9-UNIMOD:35	ms_run[1]:scan=18933	73.04862829973334	3	3489.602969	3489.581685	T	-	609	647
PSM	SETAPAAPAAAPPAE	3280	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=8577	35.71983771066667	2	1391.6662	1391.6562	M	K	2	17
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGI	3281	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=18611	71.9249613728	5	5340.4572	5340.4222	M	R	2	70
PSM	AAAAGGGGPGTAVGATGSGIAAAAAGLAVY	3282	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=31060	119.06514353786666	3	2399.2222	2399.2072	M	R	2	32
PSM	PPYTVVYFPVRG	3283	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=20206	77.2528376632	2	1393.7452	1393.7389	M	R	2	14
PSM	AAPAQQTTQPGGGK	3284	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=5200	22.028367062666668	2	1353.6602	1352.6682	M	R	2	16
PSM	MEGLDDGPDFLSEED	3285	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25849	98.86226455333333	2	1725.6662	1725.6562	M	R	2	17
PSM	MDLFGDLPEPERSP	3286	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=29224	112.21993253706667	2	1643.761243	1643.750124	-	R	1	15
PSM	SEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQINAS	3287	sp|Q99729-2|ROAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=15179	60.20165869626667	4	5748.4592	5747.4542	M	K	2	64
PSM	RVELPGTAVPSVPEDAAPAS	3288	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=16176	63.75564339653333	2	1964.025550	1962.005821	A	R	31	51
PSM	AAQVAPAAASSLGNPPPPPPSEL	3289	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=24040	91.46763058719999	3	2180.1252	2180.1112	M	K	2	25
PSM	AAQVAPAAASSLGNPPPPPPSELK	3290	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=18580	71.83030162933332	3	2308.2212	2308.2062	M	K	2	26
PSM	AAQVAPAAASSLGNPPPPPPSEL	3291	sp|O14497|ARI1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=23525	89.39032682053333	3	2180.1252	2180.1112	M	K	2	25
PSM	MLSTEGREGFVV	3292	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19166	73.84409538773333	2	1382.6642	1381.6542	M	K	2	14
PSM	MNSVGEACTDMK	3293	sp|O43715|TRIA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=5639	23.860695589600002	2	1415.548802	1415.536703	-	R	1	13
PSM	SDAAVDTSSEITTKDL	3294	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=35436	134.12839349306668	2	1694.8022	1693.7892	M	K	2	18
PSM	MYQVKPYHGGGAPL	3295	sp|Q13155|AIMP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12826	51.62526638986667	2	1574.7652	1574.7542	P	R	3	17
PSM	AAAMVPGRSESWE	3296	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,4-UNIMOD:35	ms_run[1]:scan=13763	55.117547501333334	2	1447.6481	1447.6397	M	R	2	15
PSM	MDQVMQFVEPSRQFV	3297	sp|P60059|SC61G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=23176	88.04079923573333	2	1914.884639	1913.865171	-	K	1	16
PSM	MDEQSQGMQGPPVPQFQPQKAL	3298	sp|Q8TDX7|NEK7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=20090	76.84461372666667	3	2515.167564	2514.151911	-	R	1	23
PSM	GVQVETISPGDGRTFP	3299	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=16502	64.89469534853333	2	1658.8382	1658.8262	M	K	2	18
PSM	MNSNVENLPPHII	3300	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=23188	88.0937675336	2	1519.748051	1518.750064	-	R	1	14
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	3301	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	4-UNIMOD:35	ms_run[1]:scan=22908	87.02463775813334	3	3466.715107	3466.693484	N	R	398	434
PSM	KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEE	3302	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=14376	57.3229211624	3	2774.441855	2773.424637	G	K	61	94
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3303	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19530	74.95031661466666	3	3216.4312	3214.4072	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3304	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18458	71.40804421386666	3	3231.425693	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3305	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20008	76.54565091946667	3	3214.426802	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3306	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=20850	79.4970170952	3	3214.428548	3214.407944	Q	R	630	663
PSM	ADGKGDAAAVAGAGAEAPAVAGAGDGVETESMV	3307	sp|Q13129|RLF_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=20689	78.902829756	3	2915.3492	2913.3292	M	R	2	35
PSM	PGGLLLGDVAPNFEANTTVG	3308	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18		ms_run[1]:scan=27311	104.90398123626666	2	1941.9802	1940.9842	M	R	2	22
PSM	MNYMPGTASLIEDIDK	3309	sp|O15116|LSM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26917	103.30725526986666	2	1854.849417	1854.837953	-	K	1	17
PSM	SGNGNAAATAEENSPKM	3310	sp|P08397|HEM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,17-UNIMOD:35	ms_run[1]:scan=7577	31.7032517856	2	1707.7252	1705.7212	M	R	2	19
PSM	SDNGELEDKPPAPPV	3311	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=15648	61.86983617253334	2	1606.7502	1605.7522	M	R	2	17
PSM	MEKPSPLLVG	3312	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=18224	70.66753319040001	2	1111.6010	1111.5942	V	R	3	13
PSM	AEAMDLGKDPNGPTHSSTLFV	3313	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=21802	82.9903274136	2	2230.0572	2228.0412	M	R	2	23
PSM	MHGGGPPSGDSACPL	3314	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,13-UNIMOD:4	ms_run[1]:scan=12887	51.85492098053333	2	1480.618378	1480.607499	-	R	1	16
PSM	MNQTDKNQQEIPSYLNDEPPEGSM	3315	sp|Q8WUH6|TM263_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=21342	81.28920832853333	3	2807.226820	2806.206190	-	K	1	25
PSM	MDEAGSSASGGGFRPGVDSLDEPPNS	3316	sp|Q8IUH3|RBM45_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17155	67.16370612133333	3	2593.110013	2593.087455	-	R	1	27
PSM	MNHLPEDMENALTGSQSSHASL	3317	sp|O95772|STR3N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=14594	58.07089283653333	3	2443.067465	2442.042754	-	R	1	23
PSM	SLICSISNEVPEHPCVSPVSNHVYE	3318	sp|Q9UMS4|PRP19_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,4-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=24435	93.06747935359999	3	2894.3382	2894.3212	M	R	2	27
PSM	KTITLEVEPSDTIENV	3319	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=17906	69.585090716	2	1786.932298	1786.920025	G	K	11	27
PSM	AQETNHSQVPMLCSTGCGFYGNP	3320	sp|Q6FIF0|ZFAN6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=21624	82.30989684800001	3	2596.0922	2596.0772	M	R	2	25
PSM	MEDSASASLSSAAATGTSTSTPAAPTA	3321	sp|O76021|RL1D1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=20321	77.64567635306666	3	2482.115351	2482.101708	-	R	1	28
PSM	AAAGPAAGPTGPEPMPSYAQLVQ	3322	sp|P27544|CERS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,15-UNIMOD:35	ms_run[1]:scan=22726	86.35575924106666	3	2238.0762	2238.0622	M	R	2	25
PSM	AAAGPAAGPTGPEPMPSYAQLVQ	3323	sp|P27544|CERS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,15-UNIMOD:35	ms_run[1]:scan=22856	86.85145169653333	2	2239.0902	2238.0622	M	R	2	25
PSM	MLQNVTPHN	3324	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9585	39.6911858864	2	1110.491530	1110.512794	-	K	1	10
PSM	STPAVPQDLQLPPSQ	3325	sp|Q8WWK9|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=22990	87.3291292792	2	1618.8312	1618.8202	M	R	2	17
PSM	STPAVPQDLQLPPSQ	3326	sp|Q8WWK9|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=23213	88.19104184826666	2	1618.8332	1618.8202	M	R	2	17
PSM	STPAVPQDLQLPPSQ	3327	sp|Q8WWK9|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=22851	86.82677684186666	2	1618.8312	1618.8202	M	R	2	17
PSM	MELEDGVVYQEEPGGSGAVMSE	3328	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,20-UNIMOD:35	ms_run[1]:scan=25162	96.110317664	3	2370.004715	2369.987924	-	R	1	23
PSM	MELEDGVVYQEEPGGSGAVMSE	3329	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=23937	91.01969211733334	3	2370.004395	2369.987924	-	R	1	23
PSM	MDELAGGGGGGPGMAAPP	3330	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,14-UNIMOD:35	ms_run[1]:scan=20280	77.50255878186667	2	1598.679165	1598.670493	-	R	1	19
PSM	AAAAAAAVGGQQPSQPELPAPGLALD	3331	sp|Q6ZT12|UBR3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=28320	108.83184460533333	3	2412.2462	2412.2282	M	K	2	28
PSM	AEMDPVAEFPQPPGAA	3332	sp|Q9HAB8|PPCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=26900	103.23579123626668	2	1667.7622	1667.7492	M	R	2	18
PSM	KMLFSPEEMDLSQEQPLDAQQGPPEPAQESLSGSES	3333	sp|Q32P28|P3H1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=20304	77.58694135866668	3	3947.775442	3947.756475	V	K	695	731
PSM	SEETVPEAASPPPPQGQPYFD	3334	sp|P35612|ADDB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=22167	84.31799897306668	3	2284.0282	2284.0162	M	R	2	23
PSM	MESRDPAQPMSPGEATQSGA	3335	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=7742	32.3410284032	3	2120.897437	2119.878649	-	R	1	21
PSM	MTRDEDDDEEEEEEGGSWG	3336	sp|O00165-3|HAX1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12685	51.1181827088	2	2271.801609	2271.786976	-	R	1	20
PSM	MDDYSLDEFR	3337	sp|Q8N3Y1|FBXW8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19386	74.56924652480001	2	1347.536198	1347.528898	-	R	1	11
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	3338	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,24-UNIMOD:35	ms_run[1]:scan=24093	91.68402266213334	3	3363.2922	3362.2662	M	K	2	31
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	3339	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,20-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=27875	107.15328164133332	3	2929.3212	2929.3042	M	R	2	33
PSM	AADGQCSLPASW	3340	sp|Q86YN1|DOPP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=22882	86.93225093146665	2	1303.5580	1303.5498	M	R	2	14
PSM	ADDVDQQQTTNTVEEPLDLI	3341	sp|P62310|LSM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=31644	121.3089981176	3	2285.0692	2285.0542	M	R	2	22
PSM	AMVVSSWRDPQDDVAGGNPGGPNPAAQAA	3342	sp|P10589|COT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,2-UNIMOD:35	ms_run[1]:scan=21024	80.13801043413334	3	2892.3252	2892.3092	M	R	2	31
PSM	PMFIVNTNVP	3343	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=20661	78.80420547066666	2	1146.5804	1146.5738	M	R	2	12
PSM	PMFIVNTNVP	3344	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	2-UNIMOD:35	ms_run[1]:scan=20672	78.83638443306667	2	1146.5804	1146.5738	M	R	2	12
PSM	AAAEEEPKP	3345	sp|P55263|ADK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=6852	28.7255502648	2	982.4657	982.4602	M	K	2	11
PSM	AAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGA	3346	sp|Q86X55|CARM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,25-UNIMOD:4	ms_run[1]:scan=26989	103.61948010293332	3	2792.3722	2792.3542	M	R	2	36
PSM	SNIYIQEPPTNG	3347	sp|Q6UX04|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=18116	70.26206931546668	2	1373.6555	1373.6458	M	K	2	14
PSM	TAELQQDDAAGAADGHGSSCQMLLNQL	3348	sp|Q96RU2|UBP28_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	20-UNIMOD:4,22-UNIMOD:35	ms_run[1]:scan=18373	71.1330649664	3	2816.2462	2816.2332	M	R	2	29
PSM	TAGINADGHLINTGQAMDSSDNSE	3349	sp|Q02447-3|SP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	17-UNIMOD:35	ms_run[1]:scan=11945	48.357753068	3	2433.0502	2433.0342	M	R	2	26
PSM	ASKEMFEDTVEE	3350	sp|Q16576|RBBP7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,5-UNIMOD:35	ms_run[1]:scan=12816	51.58883533706667	2	1471.6107	1471.6019	M	R	2	14
PSM	AAGGAEGGSGPGAAMGDCAEI	3351	sp|Q09019|DMWD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,15-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=14064	56.1447610224	2	1862.7602	1862.7402	M	K	2	23
PSM	AEAPQVVEIDPDFEPLP	3352	sp|Q12778|FOXO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=32025	122.76431256880001	2	1906.9332	1906.9192	M	R	2	19
PSM	AATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQ	3353	sp|P27540|ARNT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,9-UNIMOD:35	ms_run[1]:scan=25669	98.12759060026666	3	3450.6772	3450.6572	M	R	2	39
PSM	MEADGAGEQM	3354	sp|Q9Y6M7-6|S4A7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=4584	19.498930909333335	2	1111.385816	1111.379791	-	R	1	11
PSM	MEADGAGEQM	3355	sp|Q9Y6M7-6|S4A7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=4594	19.542217949866664	2	1111.385816	1111.379791	-	R	1	11
PSM	MEDGGLTAFEEDQ	3356	sp|Q96RG2|PASK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=26023	99.59753619066667	2	1482.590712	1482.582055	-	R	1	14
PSM	MEQPGQDPTSDDVMDSFLE	3357	sp|O95801|TTC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30491	116.98537933253333	2	2197.880377	2197.866746	-	K	1	20
PSM	CSTNPGKWVTFDDDPAVQSSQ	3358	sp|Q9Y6Q2|STON1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,1-UNIMOD:4	ms_run[1]:scan=22576	85.84175881600001	3	2382.0462	2380.0272	M	K	2	23
PSM	MDYLTTFTEKSG	3359	sp|Q8N573-2|OXR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22136	84.19305003013332	2	1449.641476	1449.633363	-	R	1	13
PSM	MVGQLSEGAIAAIMQ	3360	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	14-UNIMOD:35	ms_run[1]:scan=20638	78.72201859786666	2	1533.757087	1533.753101	-	K	1	16
PSM	MESMFSSPAEAALQ	3361	sp|Q9BQC3|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=20324	77.65377000213333	2	1571.657427	1571.648361	-	R	1	15
PSM	MNGEADCPTDLEMAAP	3362	sp|P17480|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=16638	65.36846514	2	1794.682012	1794.674653	-	K	1	17
PSM	MEQPGQDPTSDDVMDSFLE	3363	sp|O95801|TTC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=23510	89.33793570746667	2	2213.875184	2213.861661	-	K	1	20
PSM	METEQPEETFPNTETNGEFGK	3364	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1	ms_run[1]:scan=20484	78.18782885573334	3	2457.031367	2456.032566	-	R	1	22
PSM	MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFD	3365	sp|Q9UL40|ZN346_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26691	102.38876193146666	3	3842.743796	3839.710845	-	R	1	38
PSM	MEGSEPVAAHQGEEASCSSWGTGSTN	3366	sp|A0AVT1|UBA6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:1,17-UNIMOD:4	ms_run[1]:scan=15510	61.37491482106667	3	2707.090971	2707.076239	-	K	1	27
PSM	AAAAAAGAGPEMV	3367	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=13777	55.18	2	1143.523	1143.5230	M	R	2	15
PSM	AAAAAMAEQESA	3368	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=16535	65.006	2	1161.4972	1161.4972	M	R	2	14
PSM	AAAITDMADLEELS	3369	sp|Q6ZN18-2|AEBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=26069	99.794	2	1506.676	1506.6760	M	R	2	16
PSM	AAARPEAQS	3370	sp|Q8NCA9|ZN784_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4376	18.616	2	941.45666	941.4567	M	R	2	11
PSM	AAATGPSFWLGNETL	3371	sp|P12955-3|PEPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=32453	124.31	2	1575.7569	1575.7569	M	K	2	17
PSM	AAAVAMETDDAGN	3372	sp|Q9Y3C7|MED31_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=16040	63.274	2	1276.5241	1276.5241	M	R	2	15
PSM	AADGQCSLPASW	3373	sp|Q86YN1-2|DOPP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=22761	86.49	2	1303.5503	1303.5503	M	R	2	14
PSM	AADSDDGAVSAPAASDGGVS	3374	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=12114	48.997	2	1760.7337	1760.7337	M	K	2	22
PSM	AAEALAAEAVAS	3375	sp|A2RTX5-2|SYTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24684	94.108	2	1114.5506	1114.5506	M	R	2	14
PSM	AAEALAAEAVAS	3376	sp|A2RTX5-2|SYTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24807	94.614	2	1114.5506	1114.5506	M	R	2	14
PSM	AAEDELQLP	3377	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23994	91.255	2	1026.487	1026.4870	M	R	2	11
PSM	AAEDELQLP	3378	sp|P78318|IGBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24211	92.186	2	1026.487	1026.4870	M	R	2	11
PSM	AAEEPQQQ	3379	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4968	21.044	2	941.40904	941.4090	M	K	2	10
PSM	AAGTLYTYPENW	3380	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=28345	108.93	2	1426.6405	1426.6405	M	R	2	14
PSM	AANVFPFRDA	3381	sp|Q9H9F9|ARP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=22743	86.414	2	1148.5615	1148.5615	M	R	2	12
PSM	AANVFPFRDA	3382	sp|Q9H9F9|ARP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=22860	86.863	2	1148.5615	1148.5615	M	R	2	12
PSM	AAPRPPPA	3383	sp|Q9UBB4-2|ATX10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=6576	27.605	2	817.44464	817.4446	M	R	2	10
PSM	AAQGEPQVQF	3384	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=19032	73.389	2	1115.5247	1115.5247	M	K	2	12
PSM	AASGLDHL	3385	sp|Q03188-2|CENPC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=14165	56.53	1	824.40283	824.4028	M	K	2	10
PSM	AATAAAVVAEEDTEL	3386	sp|O95684-2|CEP43_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=27913	107.31	2	1501.7148	1501.7148	M	R	2	17
PSM	AATAAEAVASGSGEP	3387	sp|Q9NWT6|HIF1N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18013	69.925	2	1329.6048	1329.6048	M	R	2	17
PSM	AATAAEAVASGSGEP	3388	sp|Q9NWT6|HIF1N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18158	70.408	2	1329.6048	1329.6048	M	R	2	17
PSM	AAVKDSCG	3389	sp|P61758|PFD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=4451	18.925	2	848.36982	848.3698	M	K	2	10
PSM	AAVPELLQQQEED	3390	sp|Q9Y5X3-2|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=25552	97.618	2	1510.7151	1510.7151	M	R	2	15
PSM	AAVQMDPELAK	3391	sp|Q9Y312|AAR2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=9755	40.287	2	1229.5962	1229.5962	M	R	2	13
PSM	ACGLVASNLNL	3392	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=26969	103.53	2	1172.586	1172.5860	M	K	2	13
PSM	ADAEVIILP	3393	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=29127	111.86	2	981.53826	981.5383	M	K	2	11
PSM	ADAEVIILP	3394	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=29242	112.28	2	981.53826	981.5383	M	K	2	11
PSM	ADAEVIILP	3395	sp|O60832-2|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=29356	112.71	2	981.53826	981.5383	M	K	2	11
PSM	ADDKDSLP	3396	sp|L0R6Q1|S35U4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8745	36.382	2	901.40289	901.4029	M	K	2	10
PSM	ADKEAAFDDAVEE	3397	sp|Q09028-3|RBBP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=12814	51.583	2	1450.61	1450.6100	M	R	2	15
PSM	ADLEEQLSDEE	3398	sp|P47755-2|CAZA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=22495	85.54	2	1318.5412	1318.5412	M	K	2	13
PSM	AELQMLLEEEIPSGK	3399	sp|Q8IZP0-11|ABI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=31729	121.64	2	1743.8601	1743.8601	M	R	2	17
PSM	AERPEDLNLPNAVIT	3400	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=21904	83.334	2	1692.8683	1692.8683	M	R	2	17
PSM	AETAAGVG	3401	sp|Q12788|TBL3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7339	30.753	1	716.33408	716.3341	M	R	2	10
PSM	AETSEEVAVLVQ	3402	sp|Q7Z6K3|PTAR1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24108	91.755	2	1315.6507	1315.6507	M	R	2	14
PSM	AEVQVLVLDG	3403	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=29022	111.47	2	1083.5812	1083.5812	M	R	2	12
PSM	AGDTHCPAEPLA	3404	sp|Q8N371-2|KDM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=10032	41.312	2	1279.5503	1279.5503	M	R	2	14
PSM	AGGEAGVTLGQPHLS	3405	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=11411	46.466	3	1392.6997	1392.6997	M	R	2	17
PSM	AGKQAVSASG	3406	sp|P14927|QCR7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4395	18.697	2	916.46141	916.4614	M	K	2	12
PSM	AGSSEEAPDYG	3407	sp|Q9NRG1-3|PRDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=9557	39.58	2	1123.4306	1123.4306	M	R	2	13
PSM	AKPQVVVAPVLMS	3408	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=17420	68.034	2	1395.7796	1395.7796	M	K	2	15
PSM	ALCEAAGCGSALLWP	3409	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=32684	125.09	2	1616.7327	1616.7327	M	R	2	17
PSM	ALDGPEQMELEEG	3410	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,8-UNIMOD:35	ms_run[2]:scan=19151	73.798	2	1474.6134	1474.6134	M	K	2	15
PSM	ALDPADQHL	3411	sp|Q7Z7K0|COXM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=15195	60.261	2	1020.4876	1020.4876	M	R	2	11
PSM	ALNGAEVDDFSWEPPTEAET	3412	sp|O60232|ZNRD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=30621	117.46	2	2218.9542	2218.9542	M	K	2	22
PSM	AMDQVNALCEQLV	3413	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,2-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=25496	97.391	2	1547.696	1547.6960	M	K	2	15
PSM	ANEVIKC	3414	sp|P11766|ADHX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=8845	36.791	2	874.42185	874.4219	M	K	2	9
PSM	ANVPWAEVCE	3415	sp|Q96EK5|KBP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,9-UNIMOD:4	ms_run[2]:scan=25397	97.013	2	1215.523	1215.5230	M	K	2	12
PSM	APPSVFAEVPQAQPVLVF	3416	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=29921	114.83	2	1895.0193	1895.0193	M	K	2	20
PSM	AQALSEEEFQ	3417	sp|Q4V328-2|GRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=20428	77.985	2	1192.5248	1192.5248	M	R	2	12
PSM	AQGLIEVE	3418	sp|Q9BU02-2|THTPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=21436	81.618	2	899.46001	899.4600	M	R	2	10
PSM	ARGSVSDEEMMEL	3419	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,10-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=11056	45.278	2	1526.6229	1526.6229	M	R	2	15
PSM	ASGVAVSDGVI	3420	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=19266	74.168	2	1015.5186	1015.5186	M	K	2	13
PSM	ASGVQVADEVC	3421	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=15313	60.69	2	1175.5129	1175.5129	M	R	2	13
PSM	ASSSGNDDDLTIP	3422	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=20408	77.924	2	1332.5681	1332.5681	M	R	2	15
PSM	ASSTVPVSAAGSANETPEIPDNVGDWL	3423	sp|Q96B49|TOM6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=32276	123.7	2	2725.2719	2725.2719	M	R	2	29
PSM	ATATPVPPRMGS	3424	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=7351	30.804	2	1241.6074	1241.6074	M	R	2	14
PSM	ATAVSRPCAG	3425	sp|Q9BTX1-4|NDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=6569	27.578	2	1030.4866	1030.4866	M	R	2	12
PSM	ATNIEQIF	3426	sp|P18583-3|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=28502	109.57	2	976.48656	976.4866	M	R	2	10
PSM	ATRVEEAA	3427	sp|Q9NUQ3-2|TXLNG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7375	30.916	2	887.43486	887.4349	M	R	2	10
PSM	ATVEPETTPTPNPPTTEEE	3428	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=14623	58.161	2	2080.9324	2080.9324	M	K	2	21
PSM	AVSESQLK	3429	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=7681	32.117	2	902.47091	902.4709	M	K	2	10
PSM	AYSQGGGK	3430	sp|Q92769|HDAC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4230	17.979	2	808.37153	808.3715	M	K	2	10
PSM	DDDIAALVVDNGSGMC	3431	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=24366	92.797	2	1708.692	1708.6920	M	K	2	18
PSM	GGLASGGDVEPGLPVEV	3432	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=21621	82.296	2	1551.7781	1551.7781	M	R	2	19
PSM	GVQGFQDYIE	3433	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=18691	72.2	2	1154.5244	1154.5244	M	K	2	12
PSM	GVQVETISPGDG	3434	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=10410	42.799	2	1157.5564	1157.5564	M	R	2	14
PSM	GVQVETISPGDG	3435	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=10643	43.706	2	1157.5564	1157.5564	M	R	2	14
PSM	KFQSCLSPEEPAPESPQVPEAPGGSAV	3436	sp|Q99576-4|T22D3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	5-UNIMOD:4	ms_run[2]:scan=16594	65.216	3	2794.312	2794.3120	E	-	96	123
PSM	KIVFVPGCSIPLTIV	3437	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	8-UNIMOD:4	ms_run[2]:scan=25454	97.231	2	1641.9528	1641.9528	R	K	362	377
PSM	KLAMQEFMILPVGAANF	3438	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	4-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=24139	91.885	3	1910.9634	1910.9634	N	R	69	86
PSM	KTPEPVVPTAPELQPSTSTDQPVTSEPTYQAT	3439	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=17542	68.444	3	3395.662	3395.6620	V	R	974	1006
PSM	MAPDSDPFPEGPLL	3440	sp|Q9BVQ7-3|SPA5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=31493	120.7	2	1542.6912	1542.6912	-	K	1	15
PSM	MDDIFTQC	3441	sp|Q13418-2|ILK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=19860	76.038	2	1086.3998	1086.3998	-	R	1	9
PSM	MDDTLFQL	3442	sp|Q9HD42|CHM1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30355	116.48	2	1039.4532	1039.4532	-	K	1	9
PSM	MDEDVLTTL	3443	sp|Q9NP72-3|RAB18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25174	96.153	2	1093.4849	1093.4849	-	K	1	10
PSM	MDEDVLTTL	3444	sp|Q9NP72-3|RAB18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25200	96.261	2	1093.4849	1093.4849	-	K	1	10
PSM	MDEQALLGLNPNADSDF	3445	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29757	114.19	2	1906.8255	1906.8255	-	R	1	18
PSM	MDETVAEFIK	3446	sp|Q96H22-2|CENPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=26307	100.74	2	1223.5744	1223.5744	-	R	1	11
PSM	MDGIVPDIAVGT	3447	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25266	96.517	2	1244.5959	1244.5959	-	K	1	13
PSM	MDGSFVQHSV	3448	sp|P10074|TZAP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=12377	49.986	2	1163.4917	1163.4917	-	R	1	11
PSM	MDMGNQHPSIS	3449	sp|Q9UL15|BAG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=6209	26.085	2	1289.5016	1289.5016	-	R	1	12
PSM	MDNYADLSDTELTTLL	3450	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=32904	125.8	2	1871.8346	1871.8346	-	R	1	17
PSM	MDPIRSFCG	3451	sp|Q8IX90-2|SKA3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=15694	62.04	2	1139.474	1139.4740	-	K	1	10
PSM	MDPNTIIEAL	3452	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29360	112.72	2	1173.5587	1173.5587	-	R	1	11
PSM	MDRGEQGLL	3453	sp|P55327-2|TPD52_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=11937	48.334	2	1075.4968	1075.4968	-	R	1	10
PSM	MDSTLTASEI	3454	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23350	88.731	2	1108.4958	1108.4958	-	R	1	11
PSM	MEAERGPE	3455	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4715	20.012	2	975.39676	975.3968	-	R	1	9
PSM	MEDCLHTSSENLS	3456	sp|Q8N8K9|K1958_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:4	ms_run[2]:scan=15049	59.708	2	1563.6181	1563.6181	-	K	1	14
PSM	MEDEVVRFA	3457	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=22725	86.352	2	1136.5172	1136.5172	-	K	1	10
PSM	MEDSEALGFEHMGLDP	3458	sp|Q9NY93-2|DDX56_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25051	95.636	2	1834.739	1834.7390	-	R	1	17
PSM	MEDSMDMDMSPL	3459	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=25926	99.198	2	1458.5023	1458.5023	-	R	1	13
PSM	MEEIGILVE	3460	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26223	100.41	2	1089.5264	1089.5264	-	K	1	10
PSM	MEEIGILVE	3461	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26239	100.47	2	1089.5264	1089.5264	-	K	1	10
PSM	MEESGYESVLCV	3462	sp|Q9NVZ3-3|NECP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=24949	95.201	2	1459.5847	1459.5847	-	K	1	13
PSM	MEESGYESVLCV	3463	sp|Q9NVZ3-3|NECP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=25005	95.442	2	1459.5847	1459.5847	-	K	1	13
PSM	MEESVNQMQPLNE	3464	sp|P10155-2|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=11661	47.3	2	1621.66	1621.6600	-	K	1	14
PSM	MEETQPPPQP	3465	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8783	36.538	2	1210.5176	1210.5176	-	K	1	11
PSM	MEFAELIKTP	3466	sp|Q96QG7|MTMR9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25567	97.682	2	1235.6108	1235.6108	-	R	1	11
PSM	MEGLTLSDAEQ	3467	sp|Q96D71-2|REPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17146	67.123	2	1250.5336	1250.5336	-	K	1	12
PSM	MEIPGSLCK	3468	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=12043	48.729	2	1091.4991	1091.4991	-	K	1	10
PSM	MEKDGLC	3469	sp|Q00534|CDK6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=5598	23.682	2	909.3572	909.3572	-	R	1	8
PSM	MELGELLYN	3470	sp|Q9BTE1-3|DCTN5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28491	109.52	2	1138.5216	1138.5216	-	K	1	10
PSM	MELGELLYN	3471	sp|Q9BTE1-3|DCTN5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=33128	126.5	2	1122.5267	1122.5267	-	K	1	10
PSM	MENGAVYSPTTEEDPGPA	3472	sp|Q9NX76|CKLF6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=19016	73.329	2	1905.7938	1905.7938	-	R	1	19
PSM	MEQANPLRPDGES	3473	sp|Q9BU64|CENPO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=14379	57.336	2	1484.6566	1484.6566	-	K	1	14
PSM	MESALAVP	3474	sp|Q96EM0|T3HPD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23923	90.955	1	858.4157	858.4157	-	R	1	9
PSM	MESEMETQSA	3475	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=4987	21.123	2	1215.4271	1215.4271	-	R	1	11
PSM	MESEQLFH	3476	sp|P51790-4|CLCN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18738	72.362	2	1061.4488	1061.4488	-	R	1	9
PSM	MESIFHE	3477	sp|P54252-3|ATX3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14409	57.423	1	949.38513	949.3851	-	K	1	8
PSM	MESMFSSPAEAALQ	3478	sp|Q9BQC3-2|DPH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=30482	116.95	2	1539.6585	1539.6585	-	R	1	15
PSM	MESNKDEAE	3479	sp|Q9NXW2|DJB12_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=3851	16.214	2	1109.4183	1109.4183	-	R	1	10
PSM	MESPASSQPASMPQS	3480	sp|P46734|MP2K3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6536	27.439	2	1607.6443	1607.6443	-	K	1	16
PSM	MESQEPTESSQNG	3481	sp|Q9UKK9|NUDT5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5126	21.699	2	1480.5624	1480.5624	-	K	1	14
PSM	METILEQQ	3482	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15194	60.26	2	1048.4747	1048.4747	-	R	1	9
PSM	METQKDEAAQA	3483	sp|Q5JTC6-2|AMER1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4544	19.321	2	1278.5398	1278.5398	-	K	1	12
PSM	MEVKPPPG	3484	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6247	26.237	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	3485	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6478	27.196	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	3486	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6583	27.635	2	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	3487	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=6601	27.701	1	911.44225	911.4423	-	R	1	9
PSM	MEVKPPPG	3488	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=10409	42.797	2	895.44734	895.4473	-	R	1	9
PSM	MEVLAAETTSQQE	3489	sp|O75781-2|PALM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=25776	98.566	2	1477.6606	1477.6606	-	R	1	14
PSM	MEYMAESTD	3490	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=21087	80.355	2	1117.3944	1117.3944	-	R	1	10
PSM	MFQIPEFEPSEQEDSSSAE	3491	sp|Q92934|BAD_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28770	110.56	2	2243.9052	2243.9052	-	R	1	20
PSM	MFQLPVNNLGSLR	3492	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25795	98.646	2	1545.7973	1545.7973	-	K	1	14
PSM	MFSEQAAQ	3493	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=16501	64.892	2	952.39603	952.3960	-	R	1	9
PSM	MKLNISFPATGCQ	3494	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=19917	76.216	2	1523.7112	1523.7112	-	K	1	14
PSM	MLAAGVGGQGE	3495	sp|O00422-2|SAP18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18344	71.033	2	1030.4753	1030.4753	-	R	1	12
PSM	MLEAPGPSDGCELSNPSAS	3496	sp|Q9UNI6|DUS12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=22309	84.863	2	1959.819	1959.8190	-	R	1	20
PSM	MLEELECGAPGA	3497	sp|Q13111-2|CAF1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=21928	83.405	2	1333.553	1333.5530	-	R	1	13
PSM	MLGAVEGPRW	3498	sp|Q14012|KCC1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24839	94.763	2	1156.5699	1156.5699	-	K	1	11
PSM	MLGGSGSHG	3499	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4704	19.973	2	859.34942	859.3494	-	R	1	10
PSM	MLGNSAPGPAT	3500	sp|P20248|CCNA2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=15732	62.164	2	1056.491	1056.4910	-	R	1	12
PSM	MLQQVNGHNPGSDGQA	3501	sp|Q96H55-2|MYO19_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=13497	54.166	2	1693.7478	1693.7478	-	R	1	17
PSM	MMLGTEGGEGFVV	3502	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24336	92.689	2	1399.6	1399.6000	-	K	1	14
PSM	MMLGTEGGEGFVV	3503	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24682	94.098	2	1399.6	1399.6000	-	K	1	14
PSM	MMQNPQILAALQE	3504	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=24846	94.799	2	1559.7324	1559.7324	-	R	1	14
PSM	MNDTVTIRT	3505	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9888	40.763	2	1107.523	1107.5230	-	R	1	10
PSM	MNGEADCPTDLEMAAP	3506	sp|P17480-2|UBF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=23694	90.058	2	1762.6848	1762.6848	-	K	1	17
PSM	MNGSNMANTSPSV	3507	sp|Q9ULR5|PAI2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=7628	31.901	2	1382.5442	1382.5442	-	K	1	14
PSM	MNIMDFNVK	3508	sp|Q9Y371|SHLB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=25522	97.499	2	1152.5308	1152.5308	-	K	1	10
PSM	MNLFNLDRF	3509	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27625	106.17	2	1226.5754	1226.5754	-	R	1	10
PSM	MNNSGADEIG	3510	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7530	31.521	2	1064.4081	1064.4081	-	K	1	11
PSM	MNPEYDYLF	3511	sp|Q9H0U4|RAB1B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29139	111.9	2	1248.5009	1248.5009	-	K	1	10
PSM	MNPVYSPGSSGVPYANA	3512	sp|A1KXE4-2|F168B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23104	87.78	2	1751.7825	1751.7825	-	K	1	18
PSM	MNQEKLA	3513	sp|Q96K17-3|BT3L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8638	35.96	2	874.42185	874.4219	-	K	1	8
PSM	MNSNVENLPPHII	3514	sp|Q16763|UBE2S_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23117	87.831	2	1518.7501	1518.7501	-	R	1	14
PSM	MPFLELDTNLPAN	3515	sp|P30046-2|DOPD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=23397	88.919	2	1489.7123	1489.7123	-	R	1	14
PSM	MPMFIVNTNVP	3516	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=18314	70.938	2	1293.6097	1293.6097	-	R	1	12
PSM	MPMFIVNTNVP	3517	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=18597	71.871	2	1293.6097	1293.6097	-	R	1	12
PSM	MQAHELF	3518	sp|P33121-2|ACSL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14283	56.988	2	932.4062	932.4062	-	R	1	8
PSM	MQNDAGEFVDLYVP	3519	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=28481	109.48	2	1654.7185	1654.7185	-	R	1	15
PSM	MQNDAGEFVDLYVP	3520	sp|P63220|RS21_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30966	118.7	2	1654.7185	1654.7185	-	R	1	15
PSM	MRGAMELEPELLLQEA	3521	sp|Q8IUI8|CRLF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=26279	100.63	2	1902.9067	1902.9067	-	R	1	17
PSM	MRPEPGGCCC	3522	sp|O15270|SPTC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,8-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=7592	31.76	2	1264.4457	1264.4457	-	R	1	11
PSM	MSTGTFVVSQPLNY	3523	sp|P49189|AL9A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=19628	75.263	2	1558.7337	1558.7337	-	R	1	15
PSM	MTENSTSAPAA	3524	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=4199	17.828	2	1094.455	1094.4550	-	K	1	12
PSM	MTMDKSELVQ	3525	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=7456	31.214	2	1254.5472	1254.5472	-	K	1	11
PSM	MVGQLSEGAIAAIMQ	3526	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:35	ms_run[2]:scan=24499	93.337	2	1533.7531	1533.7531	-	K	1	16
PSM	MYNGIGLPTP	3527	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24376	92.842	1	1119.527	1119.5270	-	R	1	11
PSM	PFPVTTQGSQQTQPPQ	3528	sp|P51003-2|PAPOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=11257	45.97	3	1739.8479	1739.8479	M	K	2	18
PSM	PLPEPSEQEGESV	3529	sp|Q96CP2|FWCH2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=11700	47.43	2	1396.6358	1396.6358	M	K	2	15
PSM	PMFIVNTNVP	3530	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35	ms_run[2]:scan=21371	81.39	2	1146.5743	1146.5743	M	R	2	12
PSM	PMFIVNTNVP	3531	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	2-UNIMOD:35	ms_run[2]:scan=21768	82.869	2	1146.5743	1146.5743	M	R	2	12
PSM	PSALAIFTC	3532	sp|Q14BN4-2|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	9-UNIMOD:4	ms_run[2]:scan=22423	85.28	1	978.48445	978.4845	M	R	2	11
PSM	PYQYPALTPEQK	3533	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=13000	52.292	2	1433.7191	1433.7191	M	K	2	14
PSM	RDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLASAPEEA	3534	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=23791	90.435	4	4428.2085	4428.2085	A	K	29	77
PSM	SAATHSPMMQVASGNGD	3535	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=13248	53.244	2	1701.7087	1701.7087	M	R	2	19
PSM	SADAAAGAPLP	3536	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=15414	61.039	2	981.47673	981.4767	M	R	2	13
PSM	SANEDQEMELEAL	3537	sp|Q6NW29|RWDD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=24744	94.358	2	1519.6348	1519.6348	M	R	2	15
PSM	SASSLLEQ	3538	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17046	66.778	2	875.42363	875.4236	M	R	2	10
PSM	SDHGDVSLPPED	3539	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=12602	50.797	2	1308.547	1308.5470	M	R	2	14
PSM	SDQAPKVPEEMF	3540	sp|Q6ZW49|PAXI1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=20148	77.046	2	1418.6388	1418.6388	M	R	2	14
PSM	SDQDHSMDEMTAVV	3541	sp|P08047-3|SP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=8449	35.204	2	1637.6185	1637.6185	M	K	2	16
PSM	SDTLTADVIG	3542	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=22079	83.973	2	1032.4975	1032.4975	M	R	2	12
PSM	SEHVEPAAPGPGPNGGGGGPAPA	3543	sp|Q4ZIN3-2|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=10547	43.326	3	2020.9239	2020.9239	M	R	2	25
PSM	SEKENNFPPLP	3544	sp|Q969E2-3|SCAM4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18256	70.759	2	1312.6299	1312.6299	M	K	2	13
PSM	SGALDVLQM	3545	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=22892	86.969	2	990.4692	990.4692	M	K	2	11
PSM	SGDEMIFDPTMS	3546	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=20109	76.916	2	1402.5268	1402.5268	M	K	2	14
PSM	SGESGQPEAGPSHAGLDWPNPE	3547	sp|Q6NSI4-2|RADX_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=18865	72.812	2	2259.9669	2259.9669	M	R	2	24
PSM	SGPTWLPPKQPEPA	3548	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17142	67.113	2	1545.7827	1545.7827	M	R	2	16
PSM	SGPTWLPPKQPEPA	3549	sp|Q15654|TRIP6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17173	67.222	2	1545.7827	1545.7827	M	R	2	16
PSM	SGPVPSRA	3550	sp|Q8NEV1|CSK23_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5989	25.202	2	811.41882	811.4188	M	R	2	10
PSM	SGSMATAEASGSDG	3551	sp|O43169|CYB5B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=5080	21.497	2	1284.4776	1284.4776	M	K	2	16
PSM	SGYSSDRD	3552	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4494	19.11	2	927.357	927.3570	M	R	2	10
PSM	SHLPMKLL	3553	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=12927	52.015	2	995.54739	995.5474	M	R	2	10
PSM	SHTILLVQPT	3554	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17382	67.912	2	1149.6394	1149.6394	M	K	2	12
PSM	SIMSYNGGAVMAM	3555	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=18029	69.976	2	1404.5724	1404.5724	M	K	2	15
PSM	SISSDEVNFLVY	3556	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=32017	122.73	2	1413.6664	1413.6664	M	R	2	14
PSM	SKSFQQSSLS	3557	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8929	37.114	2	1139.5459	1139.5459	M	R	2	12
PSM	SLYDDLGVETSDS	3558	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=25300	96.647	2	1441.6096	1441.6096	M	K	2	15
PSM	SPTPPLFSLPEA	3559	sp|Q96FV9-2|THOC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=24558	93.575	2	1254.6496	1254.6496	M	R	2	14
PSM	SPTPPLFSLPEA	3560	sp|Q96FV9-2|THOC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=24670	94.051	2	1254.6496	1254.6496	M	R	2	14
PSM	SQWYELQQLDS	3561	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=28291	108.72	2	1437.6412	1437.6412	M	K	2	13
PSM	SRGPEEVN	3562	sp|Q9UHR4|BI2L1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=4758	20.186	2	928.42502	928.4250	M	R	2	10
PSM	SRQSTLYSFFP	3563	sp|P52701-2|MSH6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=26173	100.22	2	1373.6616	1373.6616	M	K	2	13
PSM	SSGNYQQSEALS	3564	sp|A2RU49-2|HYKK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=10352	42.585	2	1311.5579	1311.5579	M	K	2	14
PSM	SSMNPEYDYLF	3565	sp|P62820-3|RAB1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=28246	108.55	2	1422.5649	1422.5649	M	K	2	13
PSM	SSSPVNVK	3566	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5995	25.222	2	858.4447	858.4447	M	K	2	10
PSM	SSVQQQPPPP	3567	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=8215	34.281	2	1105.5404	1105.5404	M	R	2	12
PSM	SSVQQQPPPPR	3568	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5860	24.749	2	1261.6415	1261.6415	M	R	2	13
PSM	SSVQQQPPPPR	3569	sp|O00401|WASL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=5514	23.336	2	1261.6415	1261.6415	M	R	2	13
PSM	STADALDDENTF	3570	sp|P49959-2|MRE11_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=20473	78.156	2	1339.5416	1339.5416	M	K	2	14
PSM	STDTGVSLPSYEEDQGS	3571	sp|Q9Y241|HIG1A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=19195	73.929	2	1812.7537	1812.7537	M	K	2	19
PSM	TASVLLHP	3572	sp|P31271|HXA13_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17268	67.545	2	878.48617	878.4862	M	R	2	10
PSM	TGAEIEPSAQA	3573	sp|Q96D09|GASP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=6920	29.024	2	1072.5037	1072.5037	M	K	2	13
PSM	TSALTQGLE	3574	sp|Q0VGL1|LTOR4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=19580	75.112	2	960.47639	960.4764	M	R	2	11
PSM	TSLAQQLQ	3575	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=17696	68.915	2	929.48181	929.4818	M	R	2	10
PSM	TSVTRSEIIDE	3576	sp|Q9H410|DSN1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=13316	53.492	2	1290.6303	1290.6303	M	K	2	13
PSM	VDMMDLPRS	3577	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=11020	45.148	2	1136.4842	1136.4842	M	R	2	11
PSM	VDMMDLPRS	3578	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=15582	61.638	2	1120.4893	1120.4893	M	R	2	11
PSM	VEQGDAAPLL	3579	sp|A4D1U4|DEN11_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:1	ms_run[2]:scan=23530	89.411	2	1053.5342	1053.5342	M	R	2	12
PSM	VGQLSEGAIAAIMQ	3580	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	17		ms_run[2]:scan=23858	90.704	2	1386.7177	1386.7177	M	K	2	16
PSM	DDDIAALVVDNGSGMC	3581	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=28476	109.4602774264	2	1693.6902	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3582	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=32781	125.40663507253333	2	1708.7092	1708.6912	M	K	2	18
PSM	KFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP	3583	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:35	ms_run[1]:scan=23582	89.62159814479999	3	3093.556016	3093.532868	T	-	804	836
PSM	KTPEPVVPTAPELQPSTSTDQPVTSEPTSQVT	3584	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=16920	66.36071203653333	3	3348.686826	3347.662027	V	R	1156	1188
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	3585	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=20306	77.59765797786666	3	2849.444012	2849.424444	P	R	634	661
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	3586	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=20469	78.14188962506667	3	2849.441456	2849.424444	P	R	634	661
PSM	PYQYPALTPEQK	3587	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=13340	53.584656508533335	2	1434.7192	1433.7182	M	K	2	14
PSM	YQYPALTPEQK	3588	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=11459	46.629477470400005	2	1336.6741	1336.6658	P	K	3	14
PSM	SETAPAAPAAAPPAE	3589	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=12202	49.3160559424	2	1391.6635	1391.6564	M	K	2	17
PSM	SDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGD	3590	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=16618	65.29312405386666	4	3089.3932	3089.3742	M	R	2	40
PSM	SNGYEDHMAEDCRGDIG	3591	sp|Q15717|ELAV1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,8-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=8733	36.342495413866665	2	1983.7422	1982.7362	M	R	2	19
PSM	AAAAGGGGPGTAVGATGSGIAAAAAGLAVY	3592	sp|Q92922|SMRC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=31174	119.4841487984	3	2399.2222	2399.2072	M	R	2	32
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPP	3593	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=28922	111.10189701546666	3	3296.4222	3296.4002	M	K	2	31
PSM	SASYHISNLLE	3594	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=21318	81.19788839040001	2	1274.6242	1274.6142	A	K	3	14
PSM	MDGETAEEQGGPVPPPVAPGGPGLGGAPGGR	3595	sp|Q16644|MAPK3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:35	ms_run[1]:scan=17908	69.59431773013333	3	2869.3042	2868.3342	-	R	1	32
PSM	ADDLDFETGDAGASATFPMQCSAL	3596	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=28634	110.05404184106666	3	2547.0562	2547.0412	M	R	2	26
PSM	SSAAEPPPPPPPESAPS	3597	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=11783	47.737698745866666	2	1655.7802	1655.7672	M	K	2	19
PSM	AAAAAAGPSPGSGPGDSPEGPEGEAPE	3598	sp|Q9UID3|VPS51_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=14411	57.427791164000006	3	2374.0302	2374.0192	M	R	2	29
PSM	METEQPEETFPNTETNGEFGK	3599	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=20615	78.63802327333333	3	2457.031367	2456.032566	-	R	1	22
PSM	VDMMDLPRS	3600	sp|P35244|RFA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,3-UNIMOD:35,4-UNIMOD:35	ms_run[1]:scan=11012	45.117861260800005	2	1136.4898	1136.4837	M	R	2	11
PSM	SSEPPPPPQPPTHQASVGLLDTPRS	3601	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=16294	64.17622362586667	2	2635.3322	2633.3082	M	R	2	27
PSM	AAGGSDPRAGDVEEDASQLIFP	3602	sp|O15514|RPB4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=27622	106.15870973306667	3	2243.0472	2243.0332	M	K	2	24
PSM	MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAA	3603	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,22-UNIMOD:35	ms_run[1]:scan=25027	95.53307196133332	3	3389.580501	3389.560281	-	R	1	34
PSM	MEQEPQNGEPAEIKII	3604	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20533	78.35685032426666	2	1883.894468	1882.898245	-	R	1	17
PSM	SDAAVDTSSEITTKDL	3605	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=22855	86.84609946426667	2	1694.8082	1693.7892	M	K	2	18
PSM	RLASEPQDPAAVSLPTSSVPET	3606	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=15934	62.89690587733333	3	2252.149300	2251.133206	Q	R	84	106
PSM	MEVDAPGVDGRDGL	3607	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=15219	60.339893076533336	2	1487.668281	1487.656224	-	R	1	15
PSM	GITTIEAVK	3608	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=15888	62.72482793573333	2	930.5448	930.5381	A	R	3	12
PSM	AQGLIEVER	3609	sp|Q9BU02|THTPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=15885	62.71648449253333	2	1055.5659	1055.5606	M	K	2	11
PSM	AQGEPQVQF	3610	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=19079	73.54968920533334	2	1002.4819	1002.4765	A	K	3	12
PSM	TTDEGAKNNEESPTATVAEQGEDITS	3611	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=14339	57.185578356533334	3	2735.2072	2735.1892	M	K	2	28
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3612	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17831	69.31718224640001	3	3230.422859	3230.402859	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3613	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19740	75.63662414693334	3	3215.426186	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3614	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=18569	71.78240429733334	3	3216.431717	3214.407944	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3615	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19574	75.09253663386667	3	3230.4202	3230.4022	Q	R	630	663
PSM	KPLESPGGTMAPQQPEGAKPQAQAALAAP	3616	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=15263	60.50852106586667	3	2841.412955	2840.449078	M	K	355	384
PSM	MEIPGSLCK	3617	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=17734	69.02474488186667	2	1075.510941	1075.504203	-	K	1	10
PSM	MVNFTVDQI	3618	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25824	98.76071110106666	2	1123.528392	1123.521962	-	R	1	10
PSM	MQPPPPGPLGDCL	3619	sp|Q9BXJ8|TACAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=22464	85.43651800373333	2	1435.656399	1435.647573	-	R	1	14
PSM	AHSPVQSGLPGMQNL	3620	sp|Q9Y6E0-2|STK24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=15480	61.272382192533335	2	1592.7710	1592.7612	M	K	2	17
PSM	ADKPDMGEIASFD	3621	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=14858	59.014927731200004	2	1452.6150	1452.6074	M	K	2	15
PSM	PSSTSPDQGDDLENCIL	3622	sp|Q5T7W7|TSTD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	15-UNIMOD:4	ms_run[1]:scan=19214	73.9950567888	2	1846.8062	1846.7882	M	R	2	19
PSM	AAAGPAAGPTGPEPMPSYAQLVQ	3623	sp|P27544|CERS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=26023	99.59753619066667	3	2222.0812	2222.0672	M	R	2	25
PSM	MEDMNEYSNIEEFAEGS	3624	sp|O14979-2|HNRDL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=31460	120.56651820053334	2	2035.778758	2035.766304	-	K	1	18
PSM	AASEVAGVVANAPSPPESSSLCAS	3625	sp|Q8ND24|RN214_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,22-UNIMOD:4	ms_run[1]:scan=24373	92.82756654426666	3	2299.0762	2299.0632	M	K	2	26
PSM	AELDQLPDESSSA	3626	sp|Q5TKA1|LIN9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=19920	76.22941990853333	2	1402.6187	1402.6095	M	K	2	15
PSM	MLQNVTPHN	3627	sp|P25440|BRD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9572	39.64423831466667	2	1110.491530	1110.512794	-	K	1	10
PSM	MEVKPPPG	3628	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=6234	26.18436649226667	1	911.448465	911.442255	-	R	1	9
PSM	SYGRPPPDVEGMTSL	3629	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=16303	64.199338088	2	1662.7662	1662.7552	M	K	2	17
PSM	SYGRPPPDVEGMTSL	3630	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,12-UNIMOD:35	ms_run[1]:scan=16323	64.26832725013334	2	1662.7662	1662.7552	M	K	2	17
PSM	GEAGAGAGASGGPEASPEAEVV	3631	sp|Q9BTY7|HGH1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=16061	63.346725575466664	2	1910.8602	1910.8492	M	K	2	24
PSM	MRGAMELEPELLLQEA	3632	sp|Q8IUI8|CRLF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=26259	100.54964809200001	2	1903.918610	1902.906701	-	R	1	17
PSM	MLQQVPENINFPAEEE	3633	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25467	97.27630510133334	3	1944.888426	1944.877509	-	K	1	17
PSM	KLAMQEFMILPVGAANF	3634	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=24136	91.86914029946666	2	1910.976633	1910.963428	N	R	162	179
PSM	SDHGDVSLPPED	3635	sp|O95630|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=11950	48.37749604613334	2	1308.5322	1308.5462	M	R	2	14
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	3636	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=25192	96.223096144	3	3348.3002	3346.2712	M	K	2	31
PSM	SYPADDYESEAAYDPYAYPSDYDMHTGDP	3637	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=25128	95.97099365546666	3	3347.2932	3346.2712	M	K	2	31
PSM	AATAAEAVASGSGEP	3638	sp|Q9NWT6|HIF1N_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=18272	70.80267590746666	2	1329.6133	1329.6043	M	R	2	17
PSM	AAAAAGLGGGGAGPGPEAGDFLA	3639	sp|P23610|HAP40_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=27319	104.92772923493334	3	1895.9122	1895.9012	M	R	2	25
PSM	AAPPEPGEPEE	3640	sp|Q5RI15|COX20_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=10701	43.922128364799995	1	1163.5112	1163.4982	M	R	2	13
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	3641	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,7-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=28005	107.6423301832	3	2930.3292	2929.3042	M	R	2	33
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	3642	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,24-UNIMOD:4	ms_run[1]:scan=30478	116.93449007093334	3	2913.3282	2913.3092	M	R	2	33
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPS	3643	sp|Q96J01|THOC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,7-UNIMOD:35,24-UNIMOD:4	ms_run[1]:scan=27654	106.2819754736	3	2929.3232	2929.3042	M	R	2	33
PSM	MESMAVATDGGERPGVPAGSGLSASQ	3644	sp|P49069|CAMLG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=20621	78.65545650426667	3	2503.146093	2503.131903	-	R	1	27
PSM	AAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGA	3645	sp|Q86X55|CARM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,25-UNIMOD:4	ms_run[1]:scan=27106	104.08702471973334	3	2792.3722	2792.3542	M	R	2	36
PSM	AAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGA	3646	sp|Q86X55|CARM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,25-UNIMOD:4	ms_run[1]:scan=26996	103.6474444424	3	2792.3722	2792.3542	M	R	2	36
PSM	MDELQDVQLTEI	3647	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=31966	122.54637271413334	2	1474.695862	1474.686126	-	K	1	13
PSM	MEPAAGSSMEPSADWLATAAA	3648	sp|P42771|CDN2A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=31206	119.59866467413333	2	2104.921491	2104.908157	-	R	1	22
PSM	TTTVATDYDNIEIQQQYSDVNN	3649	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=23655	89.91298554133333	2	2574.1602	2573.1402	M	R	2	24
PSM	ADVFPGNDSTASQDVAN	3650	sp|P17252|KPCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=18816	72.63069790746667	2	1748.7521	1748.7484	M	R	2	19
PSM	MFGAGDEDDTDFLSPSGGA	3651	sp|Q5T1M5|FKB15_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26316	100.77836320506667	2	1945.764662	1945.752368	-	R	1	20
PSM	MKLNISFPATGCQ	3652	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=19818	75.9041346912	2	1524.728804	1523.711236	-	K	1	14
PSM	ADEIDFTTGDAGASSTYPMQCSAL	3653	sp|Q9GZV4|IF5A2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,19-UNIMOD:35,21-UNIMOD:4	ms_run[1]:scan=26277	100.62226640186667	3	2565.0692	2565.0522	M	R	2	26
PSM	AESGESGGPPGSQDSAAGAEGAGAPAAAASAEP	3654	sp|Q9UMX0|UBQL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=14554	57.91627939786667	3	2823.2252	2823.2062	M	K	2	35
PSM	MDLPVGPGAAGPSNVPAFLT	3655	sp|Q00613|HSF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30517	117.07647275706667	2	1967.978994	1967.966265	-	K	1	21
PSM	ADTTPNGPQGAGAVQFMMTN	3656	sp|P57088|TMM33_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,17-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=16094	63.465022527466665	3	2080.8952	2080.8822	M	K	2	22
PSM	TSVSSDHC	3657	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=4363	18.56560467066667	2	933.3551	933.3493	M	R	3	11
PSM	MDEDGLPLMGSGIDLT	3658	sp|Q9Y3C0|WASC3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=26799	102.8108985216	2	1736.757309	1736.748469	-	K	1	17
PSM	AAAAAQGGGGGEP	3659	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=7429	31.11664352613333	2	1054.4751	1054.4674	M	R	2	15
PSM	MLNVPSQSFPAP	3660	sp|Q7L1T6|NB5R4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=23758	90.31136598533334	2	1344.643207	1344.638389	-	R	1	13
PSM	SQAVQTNGTQPLS	3661	sp|Q99496|RING2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=11804	47.81270855733333	2	1372.6552	1371.6622	M	K	2	15
PSM	VSVINTVDTSHEDMIHDAQMDYYGT	3662	sp|P55735|SEC13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,20-UNIMOD:35	ms_run[1]:scan=25283	96.58860590959999	3	2898.2482	2898.2322	M	R	2	27
PSM	MAPDSDPFPEGPLL	3663	sp|Q9BVQ7|SPA5L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=31384	120.27447224533333	2	1542.702121	1542.691212	-	K	1	15
PSM	MEPLAAYPL	3664	sp|Q8TED1|GPX8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25644	98.01396236453334	2	1061.515005	1061.510334	-	K	1	10
PSM	PSALAIFTC	3665	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	17	9-UNIMOD:4	ms_run[1]:scan=22404	85.20417604906667	1	978.4900	978.4839	M	R	2	11
PSM	MDGIVPDIAVGTK	3666	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20564	78.46644773626667	2	1372.695770	1372.690818	-	R	1	14
PSM	MEVGSEEEKWE	3667	sp|Q8N8E3|CE112_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=13772	55.1554098872	2	1409.570549	1409.565677	-	K	1	12
PSM	MEDSMDMDMSPL	3668	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:35,7-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=13142	52.82937643653334	2	1506.494738	1506.487035	-	R	1	13
PSM	MKETIMNQEKLA	3669	sp|P20290-2|BTF3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:35	ms_run[1]:scan=7763	32.40013223706667	2	1508.731134	1508.721467	-	K	1	13
PSM	MENALTGSQSSHASL	3670	sp|O95772-2|STR3N_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=12568	50.66292119493333	2	1591.687139	1589.699151	-	R	1	16
PSM	KPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPV	3671	sp|Q2M2I8|AAK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	4-UNIMOD:35	ms_run[1]:scan=13468	54.05634465706667	4	3201.643620	3201.624083	Q	R	566	598
PSM	METEQPEETFPNTETNGEFGK	3672	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=20207	77.25698766373333	3	2457.034549	2456.032566	-	R	1	22
PSM	KLMDLDVEQLGIPEQEYSCVV	3673	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:35,19-UNIMOD:4	ms_run[1]:scan=25043	95.60504442666667	3	2483.203089	2480.181479	M	K	117	138
PSM	KTEELSFTSAFCLQIQ	3674	sp|Q9NR22|ANM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	12-UNIMOD:4	ms_run[1]:scan=12993	52.25996618453333	2	1900.957678	1900.924065	V	R	284	300
PSM	KTVTNAVVTVPAYFNDSQ	3675	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=18633	71.99590687439999	2	1953.981484	1952.984357	G	R	137	155
PSM	METEQPEETFPNTETNGEFGK	3676	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:1	ms_run[1]:scan=20748	79.11401581733334	3	2457.031367	2456.032566	-	R	1	22
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	3677	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	17	9-UNIMOD:35	ms_run[1]:scan=19241	74.0836082512	3	3489.602969	3489.581685	T	-	609	647
PSM	AAAAAGTATSQ	3678	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6762	28.376	2	960.45124	960.4512	M	R	2	13
PSM	AAAAAMAEQESA	3679	sp|Q7L5D6|GET4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=11679	47.36	2	1177.4921	1177.4921	M	R	2	14
PSM	AAAAEGVLAT	3680	sp|Q6QNY1|BL1S2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18551	71.718	2	914.47091	914.4709	M	R	2	12
PSM	AAAAEGVLAT	3681	sp|Q6QNY1|BL1S2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18683	72.175	2	914.47091	914.4709	M	R	2	12
PSM	AAAAELSLLE	3682	sp|O43324-2|MCA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=29966	115.01	2	1028.539	1028.5390	M	K	2	12
PSM	AAAAMAAAAGGGAGAA	3683	sp|Q9NX46|ADPRS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20358	77.768	2	1200.5557	1200.5557	M	R	2	18
PSM	AAAAVSESWPELELAE	3684	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=32206	123.44	2	1713.8097	1713.8097	M	R	2	18
PSM	AAADGALPEAAALEQPAELPASV	3685	sp|P23025|XPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=29276	112.4	2	2203.1008	2203.1008	M	R	2	25
PSM	AAAITDMADLEELS	3686	sp|Q6ZN18-2|AEBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:35	ms_run[2]:scan=25810	98.71	2	1506.676	1506.6760	M	R	2	16
PSM	AAAPQAPGRGSL	3687	sp|P78345|RPP38_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10233	42.101	2	1136.5938	1136.5938	M	R	2	14
PSM	AAGGSGVGGK	3688	sp|Q9NZM5|NOP53_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4045	17.129	2	801.39808	801.3981	M	R	2	12
PSM	AAGVEAAAEVAATEI	3689	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=32438	124.26	2	1413.6987	1413.6987	M	K	2	17
PSM	AALAPLPPLPAQF	3690	sp|Q9NP79|VTA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=26497	101.56	2	1304.7493	1304.7493	M	K	2	15
PSM	AAPPGEYFSVGSQVSC	3691	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=24088	91.664	2	1696.7403	1696.7403	M	R	2	18
PSM	AAPRPPPA	3692	sp|Q9UBB4-2|ATX10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6406	26.899	2	817.44464	817.4446	M	R	2	10
PSM	AAPRPPPA	3693	sp|Q9UBB4-2|ATX10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6468	27.153	2	817.44464	817.4446	M	R	2	10
PSM	AAPSDGFKP	3694	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10740	44.083	2	930.4447	930.4447	M	R	2	11
PSM	AAPSDGFKP	3695	sp|Q92979|NEP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10864	44.572	2	930.4447	930.4447	M	R	2	11
PSM	AAPVVAPPGVVVS	3696	sp|Q13144|EI2BE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=21965	83.539	2	1203.6863	1203.6863	M	R	2	15
PSM	AAQGEPQVQF	3697	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18900	72.933	2	1115.5247	1115.5247	M	K	2	12
PSM	AASMHGQPSPSLEDA	3698	sp|Q8IUX1-3|T126B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=10255	42.194	2	1554.662	1554.6620	M	K	2	17
PSM	AAVPELLQQQEED	3699	sp|Q9Y5X3-2|SNX5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=25437	97.162	2	1510.7151	1510.7151	M	R	2	15
PSM	AAVTMSVPGR	3700	sp|Q7Z406-5|MYH14_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=9144	37.91	2	1045.5226	1045.5226	M	K	2	12
PSM	ADEELEAL	3701	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23067	87.629	1	930.41821	930.4182	M	R	2	10
PSM	ADEELEAL	3702	sp|O14737|PDCD5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23130	87.871	2	930.41821	930.4182	M	R	2	10
PSM	ADFDTYDD	3703	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=17341	67.784	2	1002.3454	1002.3454	M	R	2	10
PSM	ADKPDMGEIASFD	3704	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=16149	63.65	2	1452.6079	1452.6079	M	K	2	15
PSM	ADLAECNI	3705	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=18946	73.082	2	946.4066	946.4066	M	K	2	10
PSM	ADMQNLVE	3706	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=11544	46.906	2	976.41716	976.4172	M	R	2	10
PSM	ADMQNLVE	3707	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,3-UNIMOD:35	ms_run[2]:scan=11678	47.358	2	976.41716	976.4172	M	R	2	10
PSM	ADMQNLVE	3708	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20015	76.57	2	960.42225	960.4222	M	R	2	10
PSM	ADMQNLVE	3709	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20144	77.035	2	960.42225	960.4222	M	R	2	10
PSM	ADPKYADLPGIA	3710	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=19935	76.289	2	1271.6398	1271.6398	M	R	2	14
PSM	ADQIPLYPVRSAAAAAAN	3711	sp|O43861-2|ATP9B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=22219	84.527	2	1839.9479	1839.9479	M	R	2	20
PSM	ADSGLDK	3712	sp|Q9BYT3-2|STK33_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5004	21.198	1	746.34465	746.3446	M	K	2	9
PSM	ADVFPGNDSTASQDVAN	3713	sp|P17252|KPCA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18836	72.704	2	1748.7489	1748.7489	M	R	2	19
PSM	AEMDPVAEFPQPPGAA	3714	sp|Q9HAB8|PPCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=26808	102.85	2	1667.7501	1667.7501	M	R	2	18
PSM	AENVVEPGPPSA	3715	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=14516	57.783	2	1207.5721	1207.5721	M	K	2	14
PSM	AETLEFNDVYQEVKGSMNDG	3716	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=30065	115.39	3	2286.9951	2286.9951	M	R	2	22
PSM	AGAAPTTAFGQAVIGPPGSG	3717	sp|Q9H9Y4|GPN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=24535	93.482	2	1767.8792	1767.8792	M	K	2	22
PSM	AGPESDAQYQFTGI	3718	sp|Q96IX5|ATPMD_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=19107	73.635	2	1482.6627	1482.6627	M	K	2	16
PSM	AGPGPGAVLESP	3719	sp|Q5T447|HECD3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18595	71.867	2	1092.5451	1092.5451	M	R	2	14
PSM	AGTVVLDDVEL	3720	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=30516	117.07	2	1171.5972	1171.5972	M	R	2	13
PSM	AGTVVLDDVEL	3721	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=30632	117.5	2	1171.5972	1171.5972	M	R	2	13
PSM	AKPQVVVAPVLMS	3722	sp|Q9H074-3|PAIP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20938	79.822	2	1379.7847	1379.7847	M	K	2	15
PSM	ALDGPEQMELEEG	3723	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=22993	87.34	2	1458.6184	1458.6184	M	K	2	15
PSM	ALEGMSK	3724	sp|P42696-2|RBM34_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=5075	21.484	2	792.36875	792.3688	M	R	2	9
PSM	ALHVPKAPGFAQML	3725	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23379	88.849	2	1520.8174	1520.8174	M	K	2	16
PSM	ALSMPLNGL	3726	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,4-UNIMOD:35	ms_run[2]:scan=24753	94.396	2	972.49502	972.4950	M	K	2	11
PSM	AMSSGGSGGGVPEQEDSVLF	3727	sp|Q16637-4|SMN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=26354	100.95	2	1951.8469	1951.8469	M	R	2	22
PSM	APAAASPPEVI	3728	sp|O60683|PEX10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=12317	49.777	2	1021.5444	1021.5444	M	R	2	13
PSM	APGQLALFSVSD	3729	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=23134	87.882	2	1203.6136	1203.6136	M	K	2	14
PSM	APTIQTQAQ	3730	sp|Q8N7H5-3|PAF1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=5540	23.435	2	956.49271	956.4927	M	R	2	11
PSM	AQALSEEEFQ	3731	sp|Q4V328-2|GRAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20284	77.521	2	1192.5248	1192.5248	M	R	2	12
PSM	AQPGPASQPDVSLQQ	3732	sp|Q15276-2|RABE1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=14843	58.966	2	1563.7529	1563.7529	M	R	2	17
PSM	ARDLIGPALPPGF	3733	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=27000	103.66	2	1364.7452	1364.7452	M	K	2	15
PSM	ARPLVPSSQ	3734	sp|P49427|UB2R1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8960	37.23	1	995.53999	995.5400	M	K	2	11
PSM	ASASTQPAALSAEQA	3735	sp|Q99622|C10_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=13120	52.756	2	1443.6842	1443.6842	M	K	2	17
PSM	ASFVTEVLAHSG	3736	sp|O43264-2|ZW10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31344	120.12	2	1258.6194	1258.6194	M	R	2	14
PSM	ASGVAVSDGVI	3737	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20319	77.64	2	1015.5186	1015.5186	M	K	2	13
PSM	ASGVTVNDEVI	3738	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20373	77.818	2	1144.5612	1144.5612	M	K	2	13
PSM	ASPSLERPE	3739	sp|Q13601-2|KRR1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8966	37.252	2	1026.4982	1026.4982	M	K	2	11
PSM	ATATPVPPRMGS	3740	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,10-UNIMOD:35	ms_run[2]:scan=7468	31.26	2	1241.6074	1241.6074	M	R	2	14
PSM	ATATPVPPRMGS	3741	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=11412	46.471	2	1225.6125	1225.6125	M	R	2	14
PSM	ATATPVPPRMGS	3742	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=11423	46.512	2	1225.6125	1225.6125	M	R	2	14
PSM	ATATPVPPRMGS	3743	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=11708	47.457	2	1225.6125	1225.6125	M	R	2	14
PSM	ATATPVPPRMGS	3744	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=11877	48.123	2	1225.6125	1225.6125	M	R	2	14
PSM	ATATPVPPRMGS	3745	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=12019	48.645	2	1225.6125	1225.6125	M	R	2	14
PSM	ATGANATPLDFPS	3746	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=22964	87.23	2	1302.6092	1302.6092	M	K	2	15
PSM	ATNFLAHE	3747	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=16158	63.69	2	943.43995	943.4399	M	K	2	10
PSM	ATNIEQIF	3748	sp|P18583-3|SON_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=28387	109.11	2	976.48656	976.4866	M	R	2	10
PSM	ATNWGSLLQD	3749	sp|P48637-2|GSHB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=28788	110.63	2	1145.5353	1145.5353	M	K	2	12
PSM	ATYLEFIQQNEE	3750	sp|Q15437|SC23B_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31759	121.77	2	1525.6937	1525.6937	M	R	2	14
PSM	AVFADLDL	3751	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=24024	91.398	1	862.44363	862.4436	M	R	2	10
PSM	CDFTEDQTAEF	3752	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:4	ms_run[2]:scan=22982	87.299	2	1403.5187	1403.5187	M	K	2	13
PSM	CDKEFMWAL	3753	sp|P58546|MTPN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=25671	98.134	2	1256.5206	1256.5206	M	K	2	11
PSM	DDDIAALVVDNGSGMC	3754	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=28884	110.98	2	1692.6971	1692.6971	M	K	2	18
PSM	ETILEQQR	3755	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=6483	27.213	2	1015.5298	1015.5298	M	R	2	10
PSM	GDAPSPEE	3756	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6093	25.614	2	842.32939	842.3294	M	K	2	10
PSM	GDVKNFLYAWCG	3757	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,11-UNIMOD:4	ms_run[2]:scan=29749	114.16	2	1470.6602	1470.6602	M	K	2	14
PSM	GEKSENCGVPEDLLNGL	3758	sp|Q99614|TTC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=25832	98.793	2	1871.8571	1871.8571	M	K	2	19
PSM	GNRGMEELIPLVN	3759	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=20716	78.999	2	1498.745	1498.7450	M	K	2	15
PSM	GPAPAGEQL	3760	sp|Q9H6R4-3|NOL6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=7497	31.386	2	838.41848	838.4185	M	R	2	11
PSM	GSEAAQLLEAADFAA	3761	sp|Q8N4P3-2|MESH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=32716	125.19	2	1504.7046	1504.7046	M	R	2	17
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAP	3762	sp|P09012|SNRPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=14215	56.724	2	2730.3833	2730.3833	K	R	123	152
PSM	KINETDTFGPGDDDEIQFDDIGDDDEDIDDI	3763	sp|P47813|IF1AX_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=26725	102.53	3	3485.4278	3485.4278	A	-	114	145
PSM	KLPTAPFGCAPGTSFLQVTPPTSQNTTA	3764	sp|Q8ND82|Z280C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	9-UNIMOD:4	ms_run[2]:scan=23470	89.186	3	2888.4378	2888.4378	S	R	522	550
PSM	KPFLLPVEAVYSVPG	3765	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=24348	92.738	2	1614.9021	1614.9021	E	R	256	271
PSM	KPLEPVSTVQVEPAV	3766	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=14092	56.245	2	1591.8821	1591.8821	E	K	862	877
PSM	KTPETVVPTAPELQPSTSTDQPVTPEPTSQAT	3767	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=16335	64.307	3	3333.6464	3333.6464	V	R	1179	1211
PSM	MDAATLTYDTL	3768	sp|Q9Y4P1-6|ATG4B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24557	93.573	2	1271.5591	1271.5591	-	R	1	12
PSM	MDDIFTQC	3769	sp|Q13418-2|ILK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=27113	104.12	2	1070.4049	1070.4049	-	R	1	9
PSM	MDDREDLVYQA	3770	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13913	55.653	2	1411.5926	1411.5926	-	K	1	12
PSM	MDDREDLVYQA	3771	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14057	56.123	2	1411.5926	1411.5926	-	K	1	12
PSM	MDDREDLVYQA	3772	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14187	56.619	2	1411.5926	1411.5926	-	K	1	12
PSM	MDDREDLVYQA	3773	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=14317	57.116	2	1411.5926	1411.5926	-	K	1	12
PSM	MDDTLFQL	3774	sp|Q9HD42|CHM1A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=30242	116.05	2	1039.4532	1039.4532	-	K	1	9
PSM	MDEESLESALQTY	3775	sp|Q8N5A5-3|ZGPAT_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31684	121.45	2	1556.6552	1556.6552	-	R	1	14
PSM	MDFQQLADVAE	3776	sp|Q8N3F0-4|MTURN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31614	121.19	2	1307.5704	1307.5704	-	K	1	12
PSM	MDGIVPDIAVGT	3777	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=25038	95.583	2	1244.5959	1244.5959	-	K	1	13
PSM	MDMGNQHPSIS	3778	sp|Q9UL15|BAG5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=8953	37.199	2	1273.5067	1273.5067	-	R	1	12
PSM	MDNLSSEEIQQ	3779	sp|O00161-2|SNP23_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=13003	52.301	2	1350.5609	1350.5609	-	R	1	12
PSM	MDSTLTASEI	3780	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17555	68.486	2	1124.4907	1124.4907	-	R	1	11
PSM	MDSTLTASEI	3781	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23462	89.158	2	1108.4958	1108.4958	-	R	1	11
PSM	MDVHDLF	3782	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=19429	74.674	2	933.39022	933.3902	-	R	1	8
PSM	MEALIPVIN	3783	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26055	99.732	2	1056.5525	1056.5525	-	K	1	10
PSM	MEALIPVIN	3784	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=26162	100.19	2	1056.5525	1056.5525	-	K	1	10
PSM	MEALIPVIN	3785	sp|O00429-4|DNM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=32907	125.81	2	1040.5576	1040.5576	-	K	1	10
PSM	MEDLGENTMVLSTL	3786	sp|Q9Y6D9|MD1L1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=29640	113.78	2	1609.7215	1609.7215	-	R	1	15
PSM	MEDLVQDGVASPATPGTG	3787	sp|Q8IWJ2-3|GCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=25345	96.821	2	1785.8091	1785.8091	-	K	1	19
PSM	MEDLVQDGVASPATPGTG	3788	sp|Q8IWJ2-3|GCC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=25480	97.329	2	1785.8091	1785.8091	-	K	1	19
PSM	MEEDQELE	3789	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9657	39.958	2	1079.3965	1079.3965	-	R	1	9
PSM	MEEDQELE	3790	sp|P0DPB5|RPC22_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=9798	40.431	2	1079.3965	1079.3965	-	R	1	9
PSM	MEEEAETEEQQ	3791	sp|Q8N2Z9-3|CENPS_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=7078	29.687	2	1409.514	1409.5140	-	R	1	12
PSM	MEETQPPPQP	3792	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=13053	52.491	2	1194.5227	1194.5227	-	K	1	11
PSM	MEGPLSVFGD	3793	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=32736	125.26	2	1092.4798	1092.4798	-	R	1	11
PSM	MEGVEEK	3794	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4373	18.606	2	878.36915	878.3691	-	K	1	8
PSM	MEIPGSLCK	3795	sp|O43252|PAPS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,8-UNIMOD:4	ms_run[2]:scan=17882	69.487	2	1075.5042	1075.5042	-	K	1	10
PSM	MELEPELLLQEA	3796	sp|Q8IUI8-2|CRLF3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=32151	123.23	2	1471.7116	1471.7116	-	R	1	13
PSM	MELITILE	3797	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=32722	125.21	2	1018.5256	1018.5257	-	K	1	9
PSM	MELITILE	3798	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=32852	125.64	2	1018.5256	1018.5257	-	K	1	9
PSM	MELSAEYL	3799	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=23754	90.3	2	1012.4423	1012.4423	-	R	1	9
PSM	MENMAEEELLPLE	3800	sp|Q7Z2T5|TRM1L_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=26922	103.33	2	1620.6899	1620.6899	-	K	1	14
PSM	MENSQLC	3801	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=11947	48.366	1	922.35245	922.3525	-	K	1	8
PSM	MENTENSVDS	3802	sp|P42574|CASP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=9540	39.512	2	1166.4397	1166.4397	-	K	1	11
PSM	MESAGLEQLL	3803	sp|Q8TEX9|IPO4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31939	122.45	2	1131.5482	1131.5482	-	R	1	11
PSM	MESAIAEGGAS	3804	sp|P78344-2|IF4G2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=15873	62.67	2	1063.4492	1063.4492	-	R	1	12
PSM	METEQPEETFPNTETNGEFG	3805	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=24210	92.184	2	2327.9376	2327.9376	-	K	1	21
PSM	METILEQQ	3806	sp|Q12874|SF3A3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15258	60.493	2	1048.4747	1048.4747	-	R	1	9
PSM	MEVKPPPG	3807	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10171	41.861	2	895.44734	895.4473	-	R	1	9
PSM	MEVKPPPG	3808	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10292	42.335	2	895.44734	895.4473	-	R	1	9
PSM	MEVKPPPG	3809	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=10653	43.74	2	895.44734	895.4473	-	R	1	9
PSM	MFLQYYLNEQGD	3810	sp|Q9NPE3|NOP10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=25506	97.433	2	1519.6653	1519.6653	-	R	1	13
PSM	MFPAAPSP	3811	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17357	67.831	1	874.38949	874.3895	-	R	1	9
PSM	MFSEQAAQ	3812	sp|P49005|DPOD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10016	41.245	2	968.39095	968.3909	-	R	1	9
PSM	MFSWLGTDDR	3813	sp|Q9NZN3-2|EHD3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=30408	116.69	2	1268.5496	1268.5496	-	R	1	11
PSM	MHFSIPETES	3814	sp|Q15036-2|SNX17_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=21053	80.228	2	1218.5227	1218.5227	-	R	1	11
PSM	MKDCSNGCSAECTGEGGS	3815	sp|P54687|BCAT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=4491	19.098	2	1963.6652	1963.6652	-	K	1	19
PSM	MLDLEVVPE	3816	sp|Q9BSU1|CP070_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35	ms_run[2]:scan=19309	74.323	2	1059.5158	1059.5158	-	R	1	10
PSM	MLLLPSAADG	3817	sp|Q99543-2|DNJC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35	ms_run[2]:scan=15579	61.631	2	1002.5056	1002.5056	-	R	1	11
PSM	MLLLPSAADG	3818	sp|Q99543-2|DNJC2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24548	93.534	2	1044.5161	1044.5161	-	R	1	11
PSM	MLSLQYPDVY	3819	sp|P48147|PPCE_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=27384	105.18	2	1285.59	1285.5900	-	R	1	11
PSM	MMQICDTYNQ	3820	sp|Q9NPA3|M1IP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:35,5-UNIMOD:4	ms_run[2]:scan=11946	48.361	2	1376.5047	1376.5047	-	K	1	11
PSM	MNAEPER	3821	sp|P53004|BIEA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4153	17.625	2	903.37563	903.3756	-	K	1	8
PSM	MNDTVTIRT	3822	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=10053	41.391	2	1107.523	1107.5230	-	R	1	10
PSM	MNGDQNSDVYAQE	3823	sp|P14324-2|FPPS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=13194	53.029	2	1511.5835	1511.5835	-	K	1	14
PSM	MNINDLKLTLS	3824	sp|Q16222-2|UAP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=27376	105.14	2	1302.6853	1302.6853	-	K	1	12
PSM	MNQEKLA	3825	sp|Q96K17-3|BT3L4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5410	22.883	2	890.41677	890.4168	-	K	1	8
PSM	MNSSTSTMSEEPDALSVVNQL	3826	sp|Q9NVT9|ARMC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=27212	104.49	2	2312.9988	2312.9988	-	R	1	22
PSM	MPMFIVNTNVP	3827	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=18454	71.397	2	1293.6097	1293.6097	-	R	1	12
PSM	MPMFIVNTNVP	3828	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35	ms_run[2]:scan=21299	81.133	2	1277.6148	1277.6148	-	R	1	12
PSM	MPMFIVNTNVP	3829	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:35	ms_run[2]:scan=22137	84.197	2	1277.6148	1277.6148	-	R	1	12
PSM	MQSPAVLVTS	3830	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=15937	62.906	2	1089.5376	1089.5376	-	R	1	11
PSM	MRPGTGAE	3831	sp|O75400-3|PR40A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=4244	18.039	2	875.38072	875.3807	-	R	1	9
PSM	MSLIINTFYSN	3832	sp|Q58FF6|H90B4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=25534	97.544	2	1301.6326	1301.6326	-	K	1	12
PSM	MVADPPRDS	3833	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5751	24.342	2	1044.4546	1044.4546	-	K	1	10
PSM	MVADPPRDS	3834	sp|Q15758|AAAT_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=5873	24.814	2	1044.4546	1044.4546	-	K	1	10
PSM	MVDYYEVLGVQ	3835	sp|O75190-2|DNJB6_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=24222	92.228	2	1314.6166	1314.6166	-	R	1	12
PSM	MVEDELALFD	3836	sp|Q9HBM1|SPC25_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=31916	122.36	2	1238.5377	1238.5377	-	K	1	11
PSM	MVEDELALFD	3837	sp|Q9HBM1|SPC25_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=32030	122.78	2	1238.5377	1238.5377	-	K	1	11
PSM	MYNGIGLPTP	3838	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=24364	92.789	2	1119.527	1119.5270	-	R	1	11
PSM	PAMPSSGPGDTSSSAAE	3839	sp|Q9Y6K1|DNM3A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	3-UNIMOD:35	ms_run[2]:scan=4773	20.257	2	1563.6359	1563.6359	M	R	2	19
PSM	PMFIVNTNVP	3840	sp|P14174|MIF_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=22646	86.091	2	1130.5794	1130.5794	M	R	2	12
PSM	PPPQGDVTALFLGPPGLG	3841	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=28990	111.37	2	1731.9196	1731.9196	M	K	2	20
PSM	PPPQGDVTALFLGPPGLG	3842	sp|Q8WZA9|IRGQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=28631	110.04	2	1731.9196	1731.9196	M	K	2	20
PSM	PSKGPLQSVQVFG	3843	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=15962	62.988	2	1342.7245	1342.7245	M	R	2	15
PSM	RAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA	3844	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=12857	51.74	4	3327.6789	3327.6789	N	R	214	245
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	3845	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=20150	77.053	3	2849.4244	2849.4244	P	R	634	661
PSM	RVPPLQPMGPTCPTPAPVPPPEAPSPF	3846	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=20457	78.095	3	2849.4244	2849.4244	P	R	634	661
PSM	SAIQAAWPSGTECIA	3847	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=26100	99.926	2	1602.7348	1602.7348	M	K	2	17
PSM	SAIQAAWPSGTECIA	3848	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,13-UNIMOD:4	ms_run[2]:scan=26210	100.36	2	1602.7348	1602.7348	M	K	2	17
PSM	SCGNEFVETL	3849	sp|Q68CZ6-2|HAUS3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=23985	91.218	2	1196.502	1196.5020	M	K	2	12
PSM	SCINLPTVLPGSPS	3850	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=26970	103.53	2	1482.7388	1482.7388	M	K	2	16
PSM	SCINLPTVLPGSPS	3851	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,2-UNIMOD:4	ms_run[2]:scan=27072	103.95	2	1482.7388	1482.7388	M	K	2	16
PSM	SDGLDNEEKPPAPPL	3852	sp|O75914-2|PAK3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=16834	66.077	2	1619.7679	1619.7679	M	R	2	17
PSM	SDHGDVSLPPED	3853	sp|O95630-2|STABP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=11823	47.902	2	1308.547	1308.5470	M	R	2	14
PSM	SDTSESGAGLT	3854	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8262	34.466	2	1065.4462	1065.4462	M	R	2	13
PSM	SDVAIVKEGWLH	3855	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=20476	78.164	2	1394.7194	1394.7194	M	K	2	14
PSM	SGALDVLQM	3856	sp|P08865|RSSA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,9-UNIMOD:35	ms_run[2]:scan=23310	88.572	2	990.4692	990.4692	M	K	2	11
PSM	SGASSSEQNNNSYET	3857	sp|O60825-2|F262_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=6437	27.026	2	1615.6234	1615.6234	M	K	2	17
PSM	SHLPMKLL	3858	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,5-UNIMOD:35	ms_run[2]:scan=13046	52.474	2	995.54739	995.5474	M	R	2	10
PSM	SLPLTEEQR	3859	sp|Q9NZC9|SMAL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=13156	52.888	2	1113.5666	1113.5666	M	K	2	11
PSM	SLQVLNDKNVSNE	3860	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=16116	63.545	2	1500.742	1500.7420	M	K	2	15
PSM	SLSPAWPGHPDQPLP	3861	sp|Q6ZVH7-3|ESPNL_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23076	87.665	2	1639.7995	1639.7995	M	R	2	17
PSM	SMPDAMPLPGVGEEL	3862	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[2]:scan=26908	103.27	2	1599.716	1599.7160	M	K	2	17
PSM	SNIYIQEPPTNG	3863	sp|Q6UX04-2|CWC27_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=17850	69.382	2	1373.6463	1373.6463	M	K	2	14
PSM	SQAPGAQPSPPTVYHE	3864	sp|Q8TAC2-2|JOS2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=12204	49.323	2	1706.79	1706.7900	M	R	2	18
PSM	SQPPLLPASAET	3865	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=18948	73.085	2	1251.6347	1251.6347	M	R	2	14
PSM	SRFVQDLS	3866	sp|Q16851|UGPA_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=16980	66.565	2	992.49271	992.4927	M	K	2	10
PSM	SRGSSAGFD	3867	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5921	24.975	2	924.39372	924.3937	M	R	2	11
PSM	SSILPFTPPVVK	3868	sp|Q15796-2|SMAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=25800	98.669	2	1325.7595	1325.7595	M	R	2	14
PSM	SSILPFTPPVVK	3869	sp|Q15796-2|SMAD2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=25910	99.13	2	1325.7595	1325.7595	M	R	2	14
PSM	SSPPEGKLET	3870	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=7981	33.282	2	1085.5241	1085.5241	M	K	2	12
PSM	SSSHFAS	3871	sp|Q15398-3|DLGP5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5234	22.17	2	763.31368	763.3137	M	R	2	9
PSM	STGPTAATGSN	3872	sp|Q15836|VAMP3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=4705	19.975	2	1004.4411	1004.4411	M	R	2	13
PSM	STKQITC	3873	sp|Q9H000-2|MKRN2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=5170	21.899	2	878.41677	878.4168	M	R	2	9
PSM	STNENANTPAA	3874	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=5528	23.387	2	1130.484	1130.4840	M	R	2	13
PSM	STPAVPQDLQLPPSQ	3875	sp|Q8WWK9-4|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23621	89.782	2	1618.8203	1618.8203	M	R	2	17
PSM	SVELEEALPVTTAEGMA	3876	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=30536	117.15	2	1787.8499	1787.8499	M	K	2	19
PSM	SVQVVSAAAAA	3877	sp|Q96HN2-2|SAHH3_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=17286	67.597	2	1014.5346	1014.5346	M	K	2	13
PSM	SYGRPPPDVEGMTSL	3878	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1,12-UNIMOD:35	ms_run[2]:scan=16692	65.569	2	1662.7559	1662.7559	M	K	2	17
PSM	TNQYGILF	3879	sp|Q9GZS3|WDR61_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=29634	113.76	2	996.49165	996.4916	M	K	2	10
PSM	TSALENYIN	3880	sp|O95777|LSM8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=23846	90.658	2	1065.4979	1065.4979	M	R	2	11
PSM	TTDEGAKNNEESPTATVAEQGEDITS	3881	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=11702	47.441	3	2693.1788	2693.1788	M	K	2	28
PSM	TTPGKENF	3882	sp|P52294|IMA5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=8454	35.226	2	934.43961	934.4396	M	R	2	10
PSM	TTYLEFIQQNEE	3883	sp|Q15436|SC23A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:1	ms_run[2]:scan=31316	120.01	2	1555.7042	1555.7042	M	R	2	14
PSM	VGQLSEGAIAAIMQ	3884	sp|P27694|RFA1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16	13-UNIMOD:35	ms_run[2]:scan=17655	68.786	2	1402.7126	1402.7126	M	K	2	16
PSM	VYISNGQVLDS	3885	sp|Q9Y6D0|SELK_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001583, MaxQuant, ]	16		ms_run[2]:scan=13121	52.758	2	1193.5928	1193.5928	M	R	2	13
PSM	DDDIAALVVDNGSGMC	3886	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=28275	108.65882116693334	2	1693.7172	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3887	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=28377	109.06591363493334	2	1693.7172	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3888	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=26491	101.53062039493334	2	1694.7152	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMCKAGFAGDDAP	3889	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31377	120.24606627306666	3	2623.0942	2622.1212	M	R	2	28
PSM	DDDIAALVVDNGSGMC	3890	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=26689	102.37777448426667	2	1694.6822	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3891	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=28312	108.8012155592	2	1693.7172	1692.6962	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3892	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=29100	111.76355663999999	2	1692.6881	1692.6966	M	K	2	18
PSM	DDDIAALVVDNGSGMC	3893	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=33315	127.12663538133333	2	1709.7052	1708.6912	M	K	2	18
PSM	KSYELPDGQVITIGNE	3894	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=24185	92.07683031866667	2	1762.879676	1761.878495	E	R	240	256
PSM	EEEIAALVIDNGSGMC	3895	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=33325	127.16230600906667	2	1765.7942	1764.7542	M	K	2	18
PSM	EEEIAALVIDNGSGMC	3896	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=33607	128.02285802213333	2	1749.7542	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	3897	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=32488	124.4176757232	2	1749.7762	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	3898	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31584	121.06217103893333	2	1750.7472	1748.7592	M	K	2	18
PSM	EEEIAALVIDNGSGMC	3899	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=31254	119.77889875413332	2	1748.7322	1748.7592	M	K	2	18
PSM	MESTATAAVAAELVSADKIEDVPAPSTSAD	3900	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=28500	109.56641418346666	3	3004.4262	3004.4062	A	K	3	33
PSM	AAVLSGPSAGSAAGVPGGTGGLSAVSSGP	3901	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=24989	95.37096476400001	3	2380.2022	2380.1862	A	R	3	32
PSM	SETAPAAPAAPAPAE	3902	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=8841	36.77971938053334	2	1391.6658	1391.6564	M	K	2	17
PSM	MDGIVPDIAVGTK	3903	sp|P26599|PTBP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=22927	87.09044350773334	2	1372.688679	1372.690818	-	R	1	14
PSM	KLGLGIDEDD	3904	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=11720	47.4998190752	2	1073.5313	1073.5235	I	P	693	703
PSM	MDVGELLSYQPN	3905	sp|Q8WYA6|CTBL1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=26592	101.96508575786667	2	1422.641873	1422.633697	-	R	1	13
PSM	AAAEAANCIMEVSCGQAESSEKPNAEDMTS	3906	sp|Q99873-3|ANM1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:35,14-UNIMOD:4	ms_run[1]:scan=22390	85.14730139173334	3	3215.3162	3215.2992	M	K	2	32
PSM	MEGPLSVFGD	3907	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=31532	120.86184088213334	2	1108.480592	1108.474677	-	R	1	11
PSM	MEGPLSVFGD	3908	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=29579	113.560233264	2	1108.480388	1108.474677	-	R	1	11
PSM	MEGPLSVFGD	3909	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30555	117.2177838712	2	1108.478925	1108.474677	-	R	1	11
PSM	MEGPLSVFGD	3910	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30084	115.4614507352	2	1109.484880	1108.474677	-	R	1	11
PSM	MEGPLSVFGD	3911	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30437	116.7864707848	2	1108.482317	1108.474677	-	R	1	11
PSM	MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAA	3912	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25830	98.78629207493333	3	3389.580273	3389.560281	-	R	1	34
PSM	MEQEPQNGEPAEIKII	3913	sp|Q8N0X7|SPART_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=19281	74.23314288213334	2	1883.911872	1882.898245	-	R	1	17
PSM	MNDTVTIRT	3914	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10112	41.627403577866666	2	1107.528938	1107.523024	-	R	1	10
PSM	MNDTVTIRT	3915	sp|P62847|RS24_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=10076	41.4878834632	2	1108.524550	1107.523024	-	R	1	10
PSM	ADAEVIILPK	3916	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=20511	78.2778800976	2	1109.6396	1109.6327	M	K	2	12
PSM	AAMVPGRSESWE	3917	sp|O43598|DNPH1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,3-UNIMOD:35	ms_run[1]:scan=13427	53.90784790586667	2	1376.6120	1376.6025	A	R	3	15
PSM	RGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTE	3918	sp|Q15233|NONO_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	4-UNIMOD:35	ms_run[1]:scan=22930	87.10499965386666	3	3466.715107	3466.693484	N	R	398	434
PSM	AETLEFNDVYQEVKGSMNDG	3919	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=30069	115.40884485706667	3	2287.0082	2286.9942	M	R	2	22
PSM	KNPSTNFQEPVQPLTQQQVAQMQL	3920	sp|P19623|SPEE_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	22-UNIMOD:35	ms_run[1]:scan=17108	66.99458029066666	3	2770.385754	2769.375579	S	K	253	277
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3921	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	24-UNIMOD:35,28-UNIMOD:35,29-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=17410	68.0042043968	3	3230.4212	3230.4022	Q	R	630	663
PSM	KFPPLGGGGGIGYEANPGVPPATMSGSMMGSDM	3922	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	24-UNIMOD:35,28-UNIMOD:35,33-UNIMOD:35	ms_run[1]:scan=19058	73.48380453306666	3	3214.420791	3214.407944	Q	R	630	663
PSM	KMPDEPEEPVVAVSSPAVPPPT	3923	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	2-UNIMOD:35	ms_run[1]:scan=14945	59.334477416800006	3	2288.138619	2288.124616	A	K	456	478
PSM	MDLLFGR	3924	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20836	79.44797784266666	2	908.447519	908.442589	-	R	1	8
PSM	MEKPSPLLVG	3925	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14272	56.94755332933333	2	1127.5956	1127.5891	V	R	3	13
PSM	MQPPPPGPLGDCL	3926	sp|Q9BXJ8|TACAN_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,12-UNIMOD:4	ms_run[1]:scan=25997	99.4828724008	2	1419.660659	1419.652658	-	R	1	14
PSM	SEHVEPAAPGPGPNGGGGGPAPA	3927	sp|Q4ZIN3|MBRL_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=10980	45.009397574400005	2	2021.9202	2020.9232	M	R	2	25
PSM	ADKPDMGEIASFD	3928	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=20115	76.93549811226667	2	1452.6172	1452.6072	M	K	2	15
PSM	ADKPDMGEIASFD	3929	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=17060	66.82293989173334	2	1453.6192	1452.6072	M	K	2	15
PSM	STPAVPQDLQLPPSQ	3930	sp|Q8WWK9|CKAP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=23116	87.82710692053334	2	1618.8312	1618.8202	M	R	2	17
PSM	KNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSD	3931	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=10310	42.40996006266666	3	3366.473857	3365.451593	Q	K	798	832
PSM	MELEDGVVYQEEPGGSGAVMSE	3932	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=21603	82.2341723728	2	2385.995457	2385.982839	-	R	1	23
PSM	MEFQAVVMAVGGGS	3933	sp|Q9NR50|EI2BG_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=30116	115.58189148666666	2	1455.647024	1455.637403	-	R	1	15
PSM	MEANGLGPQGFPEL	3934	sp|P06132|DCUP_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=28774	110.57728393893333	2	1517.680933	1516.686795	-	K	1	15
PSM	AEMDPVAEFPQPPGAA	3935	sp|Q9HAB8|PPCS_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=26906	103.26083289520001	2	1667.7622	1667.7492	M	R	2	18
PSM	MNPVYSPVQPGAPYGNP	3936	sp|Q92567|F168A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=20819	79.37426600853334	2	1844.850278	1844.840336	-	K	1	18
PSM	SYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPF	3937	sp|O75956|CDKA2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=23695	90.06249483813333	3	3943.9712	3943.9472	M	R	2	45
PSM	PTTQQSPQDEQE	3938	sp|Q96QK1|VPS35_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=4359	18.551533490133334	2	1387.5842	1386.5892	M	K	2	14
PSM	MEATGVLPFV	3939	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=30474	116.91832774986666	2	1121.558726	1120.547448	-	R	1	11
PSM	GTRDDEYDYLF	3940	sp|P62491|RB11A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=24647	93.9495229944	2	1434.6004	1434.5934	M	K	2	13
PSM	MDIRPNHTIYINNMND	3941	sp|P08579|RU2B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=12774	51.42890314	3	2033.911184	2033.893511	-	K	1	17
PSM	ADNEKLDNQ	3942	sp|O00629|IMA3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=5317	22.5094740584	2	1087.4841	1087.4777	M	R	2	11
PSM	AALGVAEAVAAPHPAEGAETAEAVELS	3943	sp|Q86Y56|DAAF5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=26739	102.57902725173334	3	2572.2822	2572.2652	M	R	2	29
PSM	MEGQSVEELLA	3944	sp|Q15050|RRS1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=25114	95.91704827626667	2	1262.576648	1262.570034	-	K	1	12
PSM	ALCNGDSKLENAGGDL	3945	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=18482	71.4970810864	2	1675.7512	1674.7512	M	K	2	18
PSM	MNSSTSTMSEEPDALSVVNQL	3946	sp|Q9NVT9|ARMC1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=27321	104.93555606186666	2	2313.011637	2312.998824	-	R	1	22
PSM	AAAPPSYCFVAFPPRA	3947	sp|Q12765|SCRN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=25071	95.72457881626666	2	1763.8492	1762.8492	M	K	2	18
PSM	AAAPPSYCFVAFPPRA	3948	sp|Q12765|SCRN1_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=26174	100.2196983816	2	1763.8672	1762.8492	M	K	2	18
PSM	MENGYTYEDY	3949	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=21039	80.1938372912	2	1325.483493	1325.475799	-	K	1	11
PSM	MDDREDLVYQA	3950	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14854	59.00364449173333	2	1411.594116	1411.592561	-	K	1	12
PSM	MDDREDLVYQA	3951	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=14721	58.54260612986666	2	1411.594116	1411.592561	-	K	1	12
PSM	AKFMTPVIQDNPSGWGPCAVPEQF	3952	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,18-UNIMOD:4	ms_run[1]:scan=29998	115.13264916506667	3	2717.2782	2717.2612	M	R	2	26
PSM	MEESVNQMQPLNE	3953	sp|P10155|RO60_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16661	65.45495607066667	2	1605.675198	1605.665074	-	K	1	14
PSM	AQSINITELNLPQLEML	3954	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,16-UNIMOD:35	ms_run[1]:scan=33395	127.39505636853333	2	1985.0282	1984.0182	M	K	2	19
PSM	MEPEQMLEGQTQVAENPHSEYGLTDNVE	3955	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=23291	88.4996500976	3	3232.401678	3232.381254	-	R	1	29
PSM	MEKTELIQ	3956	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9980	41.10695486186667	2	1049.503483	1048.511063	-	K	1	9
PSM	ASVAVDPQPSVVT	3957	sp|Q99541|PLIN2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=17513	68.35282468400001	2	1310.6812	1310.6713	M	R	2	15
PSM	AEVQVLVLDG	3958	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=28903	111.04550144213334	2	1083.5875	1083.5807	M	R	2	12
PSM	AEVQVLVLDG	3959	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=28915	111.0817657512	2	1083.5875	1083.5807	M	R	2	12
PSM	AEVQVLVLDG	3960	sp|P40429|RL13A_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=29084	111.70706956320001	2	1083.5875	1083.5807	M	R	2	12
PSM	AGAQPGVHALQLEPPTVVETL	3961	sp|Q01970|PLCB3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=26536	101.73307287493334	3	2168.1612	2168.1472	M	R	2	23
PSM	MDLSGVK	3962	sp|Q15287|RNPS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=7102	29.792547054133333	1	806.389171	806.384406	-	K	1	8
PSM	MQTIKCVVVGDGAVG	3963	sp|P60953|CDC42_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:4	ms_run[1]:scan=16792	65.9291693104	2	1590.784149	1590.774565	-	K	1	16
PSM	MDPEDEGVAGVMSVGPPAA	3964	sp|P17098|ZNF8_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=24698	94.16649431733335	2	1885.821751	1885.807381	-	R	1	20
PSM	AADLEKPMVE	3965	sp|Q68D20|PMS2L_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,8-UNIMOD:35	ms_run[1]:scan=11723	47.515664799999996	2	1159.5312	1159.5422	H	K	3	13
PSM	VSVINTVDTSHEDMIHDAQMDYYGT	3966	sp|P55735|SEC13_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,14-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=22414	85.24115927573332	3	2914.2452	2914.2272	M	R	2	27
PSM	MAPDPVAAETAAQGPTP	3967	sp|O60427|FADS1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=17600	68.61337896373334	2	1680.774182	1680.766502	-	R	1	18
PSM	MDLPALLPAPTA	3968	sp|Q2QGD7|ZXDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=28416	109.221008344	2	1266.661758	1266.652976	-	R	1	13
PSM	MDLPALLPAPTA	3969	sp|Q2QGD7|ZXDC_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=28432	109.28553498933334	2	1266.661758	1266.652976	-	R	1	13
PSM	AKPCGV	3970	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1,4-UNIMOD:4	ms_run[1]:scan=5258	22.269607215733334	2	672.3298	672.3260	M	R	2	8
PSM	AEPLQPDPGAAEDAAAQAVETPGW	3971	sp|Q9Y5Z4|HEBP2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=30410	116.69554184693334	3	2432.1282	2432.1122	M	K	2	26
PSM	ATSGANGPGSATASASNP	3972	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=7914	33.0036842704	2	1559.6992	1558.6852	M	R	2	20
PSM	AEVEQK	3973	sp|P62841|RS15_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=4301	18.30496227573333	1	744.3701	744.3649	M	K	2	8
PSM	AEEEGPPVEL	3974	sp|Q7Z388|D19L4_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=20884	79.63114328933334	2	1110.5149	1110.5076	M	R	2	12
PSM	KPPPPDADPGGTGVGGGDRD	3975	sp|Q96G74-2|OTUD5_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16		ms_run[1]:scan=18654	72.06824384986666	2	1861.8682	1860.8592	K	R	8	28
PSM	ATDDKTSPTLDSANDLP	3976	sp|Q9Y2I7|FYV1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=16140	63.615319428266666	2	1801.8372	1801.8212	M	R	2	19
PSM	MEEQPQMQDADEPADSGGEG	3977	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:35	ms_run[1]:scan=8338	34.76357146026667	2	2193.808813	2193.795038	-	R	1	21
PSM	MEKTELIQ	3978	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=9956	41.02051589093333	2	1049.503483	1048.511063	-	K	1	9
PSM	MTSLINSPIN	3979	sp|Q8WVX3-2|CD003_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=27049	103.86489093333333	2	1089.556659	1088.553596	-	R	1	11
PSM	MEGPLSVFGD	3980	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=29847	114.5320824824	2	1108.480541	1108.474677	-	R	1	11
PSM	MYNGIGLPTP	3981	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=24714	94.23023968693333	2	1120.516153	1119.527047	-	R	1	11
PSM	METGTAPLVAPP	3982	sp|Q4KMP7|TB10B_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=22729	86.36743005573334	2	1224.614082	1224.606025	-	R	1	13
PSM	MDALEDYVWP	3983	sp|Q9NNW5|WDR6_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=32018	122.7349753128	2	1295.546895	1295.538006	-	R	1	11
PSM	MENGYTYEDY	3984	sp|P00491|PNPH_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=21045	80.20425579093333	2	1325.483493	1325.475799	-	K	1	11
PSM	KMMVEADLEDIK	3985	sp|Q6Q759|SPG17_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:35	ms_run[1]:scan=25262	96.5009627824	2	1436.702257	1436.689103	K	K	761	773
PSM	RLDVTLGPVPEIGGSEAPAPQN	3986	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=20607	78.61801720933333	3	2216.156938	2216.143711	E	K	69	91
PSM	MEVDAPGVDGRDGL	3987	sp|Q8WVX3|CD003_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=15190	60.2456230752	2	1487.668281	1487.656224	-	R	1	15
PSM	MEDGGLTAFEEDQ	3988	sp|Q96RG2|PASK_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=21808	83.011206292	2	1498.585602	1498.576970	-	R	1	14
PSM	MNPIVVVHGGGAGPIS	3989	sp|Q7L266|ASGL1_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=22363	85.05987518319999	2	1545.810047	1545.797348	-	K	1	17
PSM	MDELAGGGGGGPGMAAPP	3990	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=14087	56.2291893744	2	1614.674078	1614.665408	-	R	1	19
PSM	MAELQMLLEEEIPGG	3991	sp|Q9NYB9|ABI2_HUMAN	1	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=20007	76.54341759013333	2	1716.793994	1716.795025	-	R	1	16
PSM	MEQPGQDPTSDDVMDSFLE	3992	sp|O95801|TTC4_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:1	ms_run[1]:scan=32242	123.57807768693333	2	2181.882306	2181.871831	-	K	1	20
PSM	KLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	3993	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20201019	userFasta.sprot_human_20201019	[MS, MS:1002251, Comet, ]	16	9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=17693	68.90808930453333	3	3506.600765	3505.576600	T	-	609	647