MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000100-2 -- main-final
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\130804miao_11_Bacillus_HAM_1_1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\130804miao_11_Bacillus_HAM_1_1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M),Phospho (H),Phospho (D),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=50
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_bacsu_20200403
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Phospho (D),Phospho (H),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=25
MTD	software[2]-setting	TOL(+)=25
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=100
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M),Phospho (D),Phospho (H),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=25
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	H
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	D
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	S
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	T
MTD	variable_mod[6]-position	Anywhere
MTD	variable_mod[7]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[7]-site	Y
MTD	variable_mod[7]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49786|BCCP_BACSU	Biotin carboxyl carrier protein of acetyl-CoA carboxylase OS=Bacillus subtilis (strain 168) OX=224308 GN=accB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	44-UNIMOD:35	0.31	54.0	32	4	1
PRT	sp|P16263|ODO2_BACSU	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) OX=224308 GN=odhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	102-UNIMOD:28	0.18	51.0	6	4	2
PRT	sp|P80698|TIG_BACSU	Trigger factor OS=Bacillus subtilis (strain 168) OX=224308 GN=tig PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null		0.31	47.0	9	7	6
PRT	sp|P0CI78|RL24_BACSU	50S ribosomal protein L24 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	69-UNIMOD:35,40-UNIMOD:35	0.44	42.0	4	3	2
PRT	sp|O34425|G3P2_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0	null	132-UNIMOD:35,22-UNIMOD:35,152-UNIMOD:4,156-UNIMOD:4	0.19	41.0	5	3	1
PRT	sp|P02968|FLA_BACSU	Flagellin OS=Bacillus subtilis (strain 168) OX=224308 GN=hag PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.35	41.0	6	5	4
PRT	sp|P37455|SSBA_BACSU	Single-stranded DNA-binding protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=ssbA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.23	40.0	134	1	0
PRT	sp|O34824|GLMM_BACSU	Phosphoglucosamine mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=glmM PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	89-UNIMOD:35,96-UNIMOD:35,100-UNIMOD:21,98-UNIMOD:21	0.09	39.0	9	2	0
PRT	sp|P54542|YQJE_BACSU	Uncharacterized protein YqjE OS=Bacillus subtilis (strain 168) OX=224308 GN=yqjE PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|P08164|NADE_BACSU	NH(3)-dependent NAD(+) synthetase OS=Bacillus subtilis (strain 168) OX=224308 GN=nadE PE=1 SV=5	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.17	39.0	2	2	2
PRT	sp|P14577|RL16_BACSU	50S ribosomal protein L16 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.27	38.0	2	2	2
PRT	sp|P09124|G3P1_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	152-UNIMOD:4,156-UNIMOD:4,174-UNIMOD:35,210-UNIMOD:21,84-UNIMOD:21,306-UNIMOD:35	0.49	38.0	12	8	4
PRT	sp|P39773|GPMI_BACSU	2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=gpmI PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	424-UNIMOD:4	0.04	37.0	2	1	0
PRT	sp|P46899|RL18_BACSU	50S ribosomal protein L18 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplR PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.20	37.0	1	1	1
PRT	sp|P42409|RSBRA_BACSU	RsbT co-antagonist protein RsbRA OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	163-UNIMOD:35,171-UNIMOD:21,168-UNIMOD:21	0.12	37.0	8	2	0
PRT	sp|P33166|EFTU_BACSU	Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	93-UNIMOD:35,100-UNIMOD:35,114-UNIMOD:35,139-UNIMOD:4,139-UNIMOD:385,141-UNIMOD:35,153-UNIMOD:35,27-UNIMOD:21,269-UNIMOD:21,63-UNIMOD:21,213-UNIMOD:35,214-UNIMOD:35,223-UNIMOD:21	0.40	36.0	37	10	4
PRT	sp|P18159|PGCA_BACSU	Phosphoglucomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgcA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	146-UNIMOD:21,134-UNIMOD:28,144-UNIMOD:21,152-UNIMOD:21	0.04	36.0	15	1	0
PRT	sp|P37571|CLPC_BACSU	Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) OX=224308 GN=clpC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	738-UNIMOD:21	0.05	36.0	2	2	2
PRT	sp|P10727|SP2AA_BACSU	Anti-sigma F factor antagonist OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIIAA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null	59-UNIMOD:21	0.21	35.0	1	1	1
PRT	sp|C0SP85|YUKE_BACSU	Protein YukE OS=Bacillus subtilis (strain 168) OX=224308 GN=yukE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:35	0.34	35.0	3	2	1
PRT	sp|P21880|DLDH1_BACSU	Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	74-UNIMOD:35,291-UNIMOD:35	0.15	35.0	7	4	2
PRT	sp|P37869|ENO_BACSU	Enolase OS=Bacillus subtilis (strain 168) OX=224308 GN=eno PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	241-UNIMOD:35	0.30	35.0	9	7	6
PRT	sp|P50848|CBP1_BACSU	Carboxypeptidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ypwA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|P80868|EFG_BACSU	Elongation factor G OS=Bacillus subtilis (strain 168) OX=224308 GN=fusA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	219-UNIMOD:4,226-UNIMOD:35	0.08	34.0	8	3	2
PRT	sp|P13714|LDH_BACSU	L-lactate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ldh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	78-UNIMOD:4,80-UNIMOD:4,208-UNIMOD:28	0.12	33.0	5	3	2
PRT	sp|P17903|RSBV_BACSU	Anti-sigma-B factor antagonist OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbV PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	56-UNIMOD:21,54-UNIMOD:35,55-UNIMOD:21,57-UNIMOD:21,53-UNIMOD:21	0.17	33.0	26	1	0
PRT	sp|P28598|CH60_BACSU	60 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=groL PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	null	68-UNIMOD:35,286-UNIMOD:35	0.22	33.0	8	7	6
PRT	sp|P51777|CSPD_BACSU	Cold shock protein CspD OS=Bacillus subtilis (strain 168) OX=224308 GN=cspD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.27	33.0	9	1	0
PRT	sp|P32081|CSPB_BACSU	Cold shock protein CspB OS=Bacillus subtilis (strain 168) OX=224308 GN=cspB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.27	33.0	18	1	0
PRT	sp|P37871|RPOC_BACSU	DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	4	4	4
PRT	sp|P46353|DEOB_BACSU	Phosphopentomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=drm PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	78-UNIMOD:35,87-UNIMOD:21,88-UNIMOD:35,86-UNIMOD:21,82-UNIMOD:21,89-UNIMOD:21,95-UNIMOD:35,91-UNIMOD:21,318-UNIMOD:35	0.13	32.0	45	2	0
PRT	sp|P80860|G6PI_BACSU	Glucose-6-phosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgi PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null	242-UNIMOD:21,247-UNIMOD:21,145-UNIMOD:21	0.10	31.0	5	3	2
PRT	sp|P21468|RS6_BACSU	30S ribosomal protein S6 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsF PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.23	31.0	4	1	0
PRT	sp|P08838|PT1_BACSU	Phosphoenolpyruvate-protein phosphotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O31645|PTN3B_BACSU	PTS system mannose-specific EIIBCA component OS=Bacillus subtilis (strain 168) OX=224308 GN=manP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	468-UNIMOD:21,541-UNIMOD:21,470-UNIMOD:21	0.06	31.0	4	2	0
PRT	sp|P08874|ABRB_BACSU	Transition state regulatory protein AbrB OS=Bacillus subtilis (strain 168) OX=224308 GN=abrB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null	86-UNIMOD:21,56-UNIMOD:4	0.53	31.0	5	3	2
PRT	sp|P37487|PPAC_BACSU	Manganese-dependent inorganic pyrophosphatase OS=Bacillus subtilis (strain 168) OX=224308 GN=ppaC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	3	3	3
PRT	sp|Q45477|SYI_BACSU	Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=ileS PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	3	2	1
PRT	sp|Q04747|SRFAB_BACSU	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	3342-UNIMOD:4,994-UNIMOD:35,999-UNIMOD:21	0.02	30.0	4	4	3
PRT	sp|P54419|METK_BACSU	S-adenosylmethionine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=metK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P54531|DHLE_BACSU	Leucine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiT PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|P39126|IDH_BACSU	Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) OX=224308 GN=icd PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	104-UNIMOD:21	0.10	30.0	5	3	2
PRT	sp|O34860|RSBRB_BACSU	RsbT co-antagonist protein RsbRB OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	186-UNIMOD:21	0.06	30.0	32	2	0
PRT	sp|O34943|YTPR_BACSU	Putative tRNA-binding protein YtpR OS=Bacillus subtilis (strain 168) OX=224308 GN=ytpR PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:4	0.11	30.0	1	1	1
PRT	sp|P17820|DNAK_BACSU	Chaperone protein DnaK OS=Bacillus subtilis (strain 168) OX=224308 GN=dnaK PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	292-UNIMOD:28	0.06	29.0	3	3	3
PRT	sp|O34925|DEOD_BACSU	Purine nucleoside phosphorylase DeoD-type OS=Bacillus subtilis (strain 168) OX=224308 GN=deoD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	2	1	0
PRT	sp|P94431|YCNI_BACSU	Uncharacterized protein YcnI OS=Bacillus subtilis (strain 168) OX=224308 GN=ycnI PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	1	1	1
PRT	sp|P46318|PTJB_BACSU	Lichenan-specific phosphotransferase enzyme IIB component OS=Bacillus subtilis (strain 168) OX=224308 GN=licB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.19	29.0	1	1	1
PRT	sp|P11998|RISB_BACSU	6,7-dimethyl-8-ribityllumazine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=ribH PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.19	29.0	1	1	1
PRT	sp|P80859|6PGD_BACSU	6-phosphogluconate dehydrogenase, NADP(+)-dependent, decarboxylating OS=Bacillus subtilis (strain 168) OX=224308 GN=gndA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	4	3	2
PRT	sp|P38494|RS1H_BACSU	30S ribosomal protein S1 homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=ypfD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null	364-UNIMOD:21	0.16	29.0	4	4	4
PRT	sp|P17921|SYFA_BACSU	Phenylalanine--tRNA ligase alpha subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=pheS PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null	211-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|P49814|MDH_BACSU	Malate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	3	1	0
PRT	sp|P80700|EFTS_BACSU	Elongation factor Ts OS=Bacillus subtilis (strain 168) OX=224308 GN=tsf PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null	115-UNIMOD:35,288-UNIMOD:35,158-UNIMOD:35	0.23	28.0	8	4	2
PRT	sp|P42921|RL4_BACSU	50S ribosomal protein L4 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|P94425|YCNE_BACSU	Putative monooxygenase YcnE OS=Bacillus subtilis (strain 168) OX=224308 GN=ycnE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null	24-UNIMOD:21	0.18	28.0	2	1	0
PRT	sp|P21883|ODP2_BACSU	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.17	28.0	6	5	4
PRT	sp|P08821|DBH1_BACSU	DNA-binding protein HU 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=hupA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:35,4-UNIMOD:21	0.37	28.0	4	3	2
PRT	sp|P42175|NARG_BACSU	Nitrate reductase alpha chain OS=Bacillus subtilis (strain 168) OX=224308 GN=narG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1130-UNIMOD:4,988-UNIMOD:4	0.03	27.0	6	3	1
PRT	sp|P23966|MENB_BACSU	1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=menB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	3	1	0
PRT	sp|P80239|AHPC_BACSU	Alkyl hydroperoxide reductase C OS=Bacillus subtilis (strain 168) OX=224308 GN=ahpC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.26	27.0	7	3	1
PRT	sp|P36947|RBSA_BACSU	Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsA PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null	357-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P39794|PTTBC_BACSU	PTS system trehalose-specific EIIBC component OS=Bacillus subtilis (strain 168) OX=224308 GN=treP PE=2 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	27-UNIMOD:4,10-UNIMOD:28	0.05	27.0	2	1	0
PRT	sp|P21882|ODPB_BACSU	Pyruvate dehydrogenase E1 component subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.22	27.0	6	5	4
PRT	sp|P46347|YBEY_BACSU	Endoribonuclease YbeY OS=Bacillus subtilis (strain 168) OX=224308 GN=ybeY PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|P39579|DLTC_BACSU	D-alanyl carrier protein OS=Bacillus subtilis (strain 168) OX=224308 GN=dltC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	27.0	null	5-UNIMOD:28,15-UNIMOD:4	0.23	27.0	1	1	1
PRT	sp|P94428|GABD_BACSU	Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Bacillus subtilis (strain 168) OX=224308 GN=gabD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P12877|RL5_BACSU	50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null	152-UNIMOD:35	0.27	26.0	3	3	3
PRT	sp|O07636|YLAL_BACSU	Uncharacterized protein YlaL OS=Bacillus subtilis (strain 168) OX=224308 GN=ylaL PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.14	26.0	1	1	1
PRT	sp|P28368|HPF_BACSU	Ribosome hibernation promotion factor OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null	73-UNIMOD:35	0.10	26.0	2	1	0
PRT	sp|P08877|PTHP_BACSU	Phosphocarrier protein HPr OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsH PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	46-UNIMOD:21,48-UNIMOD:35,51-UNIMOD:35,12-UNIMOD:21,81-UNIMOD:35,52-UNIMOD:21	0.82	26.0	10	4	2
PRT	sp|P37477|SYK_BACSU	Lysine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=lysS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	3	3	3
PRT	sp|P80861|YJLD_BACSU	NADH dehydrogenase-like protein YjlD OS=Bacillus subtilis (strain 168) OX=224308 GN=yjlD PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q08787|SRFAC_BACSU	Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	3	2	1
PRT	sp|O34788|BDHA_BACSU	(R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=bdhA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	252-UNIMOD:28,304-UNIMOD:35	0.22	25.0	9	6	5
PRT	sp|P45694|TKT_BACSU	Transketolase OS=Bacillus subtilis (strain 168) OX=224308 GN=tkt PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	5	4	3
PRT	sp|P39779|CODY_BACSU	GTP-sensing transcriptional pleiotropic repressor CodY OS=Bacillus subtilis (strain 168) OX=224308 GN=codY PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P32727|NUSA_BACSU	Transcription termination/antitermination protein NusA OS=Bacillus subtilis (strain 168) OX=224308 GN=nusA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P37877|ACKA_BACSU	Acetate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=ackA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	318-UNIMOD:35	0.15	25.0	4	4	4
PRT	sp|O07020|LUTA_BACSU	Lactate utilization protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=lutA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|P13243|ALF_BACSU	Probable fructose-bisphosphate aldolase OS=Bacillus subtilis (strain 168) OX=224308 GN=fbaA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	89-UNIMOD:21,93-UNIMOD:4,50-UNIMOD:21	0.22	25.0	3	3	3
PRT	sp|P27206|SRFAA_BACSU	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|P24141|OPPA_BACSU	Oligopeptide-binding protein OppA OS=Bacillus subtilis (strain 168) OX=224308 GN=oppA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	6	2	0
PRT	sp|P0CI73|GLMS_BACSU	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) OX=224308 GN=glmS PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.11	24.0	3	3	3
PRT	sp|P12045|PURK_BACSU	N5-carboxyaminoimidazole ribonucleotide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=purK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P70974|RL13_BACSU	50S ribosomal protein L13 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplM PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.13	24.0	2	2	2
PRT	sp|P42920|RL3_BACSU	50S ribosomal protein L3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	164-UNIMOD:35	0.16	24.0	4	2	1
PRT	sp|O05519|YDIF_BACSU	Putative ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) OX=224308 GN=ydiF PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P42060|RL22_BACSU	50S ribosomal protein L22 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplV PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|P42919|RL2_BACSU	50S ribosomal protein L2 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	16-UNIMOD:35	0.12	24.0	4	3	2
PRT	sp|O34334|YJOA_BACSU	Uncharacterized protein YjoA OS=Bacillus subtilis (strain 168) OX=224308 GN=yjoA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:4	0.20	24.0	2	2	2
PRT	sp|P36945|RBSK_BACSU	Ribokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	5-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:35	0.12	24.0	2	2	2
PRT	sp|P38021|OAT_BACSU	Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	48-UNIMOD:35,46-UNIMOD:35,140-UNIMOD:4	0.14	23.0	4	3	2
PRT	sp|Q796Y8|BCP_BACSU	Peroxiredoxin Bcp OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaF PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.15	23.0	1	1	1
PRT	sp|Q04797|DHAS_BACSU	Aspartate-semialdehyde dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=asd PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	98-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P19946|RL15_BACSU	50S ribosomal protein L15 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplO PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	55-UNIMOD:35	0.14	23.0	2	1	0
PRT	sp|P39808|YVYG_BACSU	Uncharacterized protein YvyG OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyG PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	49-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O34591|ACOB_BACSU	Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=acoB PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	279-UNIMOD:385,279-UNIMOD:4	0.08	23.0	2	2	2
PRT	sp|P80875|G16U_BACSU	General stress protein 16U OS=Bacillus subtilis (strain 168) OX=224308 GN=yceD PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	55-UNIMOD:4,97-UNIMOD:21	0.38	23.0	3	3	3
PRT	sp|O06476|YFMR_BACSU	Uncharacterized ABC transporter ATP-binding protein YfmR OS=Bacillus subtilis (strain 168) OX=224308 GN=yfmR PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	null	591-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P09339|ACNA_BACSU	Aconitate/2-methylaconitate hydratase OS=Bacillus subtilis (strain 168) OX=224308 GN=citB PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	351-UNIMOD:4	0.07	22.0	7	4	3
PRT	sp|P50621|RIR2_BACSU	Ribonucleoside-diphosphate reductase subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=nrdF PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O32053|TGT_BACSU	Queuine tRNA-ribosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tgt PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	308-UNIMOD:4,310-UNIMOD:4,313-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P46336|IOLS_BACSU	Aldo-keto reductase IolS OS=Bacillus subtilis (strain 168) OX=224308 GN=iolS PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O31567|YFIY_BACSU	Probable siderophore-binding lipoprotein YfiY OS=Bacillus subtilis (strain 168) OX=224308 GN=yfiY PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P21465|RS3_BACSU	30S ribosomal protein S3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.28	22.0	4	4	4
PRT	sp|P21470|RS9_BACSU	30S ribosomal protein S9 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|P37464|SYS_BACSU	Serine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=serS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P54518|YQHT_BACSU	Uncharacterized peptidase YqhT OS=Bacillus subtilis (strain 168) OX=224308 GN=yqhT PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P80886|SUCC_BACSU	Succinate--CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=sucC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	124-UNIMOD:35,220-UNIMOD:21	0.12	22.0	3	3	3
PRT	sp|P14192|GLMU_BACSU	Bifunctional protein GlmU OS=Bacillus subtilis (strain 168) OX=224308 GN=glmU PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P23129|ODO1_BACSU	2-oxoglutarate dehydrogenase E1 component OS=Bacillus subtilis (strain 168) OX=224308 GN=odhA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	2	2
PRT	sp|O05239|YUGJ_BACSU	Probable NADH-dependent butanol dehydrogenase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=yugJ PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P35137|PPIB_BACSU	Peptidyl-prolyl cis-trans isomerase B OS=Bacillus subtilis (strain 168) OX=224308 GN=ppiB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P80885|KPYK_BACSU	Pyruvate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=pyk PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	467-UNIMOD:35	0.10	22.0	4	3	2
PRT	sp|P46320|LICH_BACSU	Probable 6-phospho-beta-glucosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=licH PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	null	357-UNIMOD:4,359-UNIMOD:35	0.10	22.0	2	2	2
PRT	sp|P17865|FTSZ_BACSU	Cell division protein FtsZ OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsZ PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	30-UNIMOD:35,362-UNIMOD:21	0.15	22.0	4	3	2
PRT	sp|P80870|GS13_BACSU	General stress protein 13 OS=Bacillus subtilis (strain 168) OX=224308 GN=yugI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	121-UNIMOD:35	0.23	21.0	5	3	2
PRT	sp|P20277|RL17_BACSU	50S ribosomal protein L17 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplQ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	2	1	0
PRT	sp|Q03224|GLPX_BACSU	Fructose-1,6-bisphosphatase class 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=glpX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P54418|PCKA_BACSU	Phosphoenolpyruvate carboxykinase (ATP) OS=Bacillus subtilis (strain 168) OX=224308 GN=pckA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P21881|ODPA_BACSU	Pyruvate dehydrogenase E1 component subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:35	0.12	21.0	2	2	2
PRT	sp|O32248|YVBK_BACSU	Uncharacterized N-acetyltransferase YvbK OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbK PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	145-UNIMOD:4	0.10	21.0	1	1	1
PRT	sp|P38493|KCY_BACSU	Cytidylate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=cmk PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|P0CI74|GPSB_BACSU	Cell cycle protein GpsB OS=Bacillus subtilis (strain 168) OX=224308 GN=gpsB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	73-UNIMOD:21,76-UNIMOD:21	0.16	21.0	2	1	0
PRT	sp|Q08352|DHA_BACSU	Alanine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ald PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|P37810|ATPG_BACSU	ATP synthase gamma chain OS=Bacillus subtilis (strain 168) OX=224308 GN=atpG PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	2	1	0
PRT	sp|P28367|RF2_BACSU	Peptide chain release factor 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=prfB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P54534|YQIW_BACSU	UPF0403 protein YqiW OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiW PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|O32163|SUFU_BACSU	Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) OX=224308 GN=sufU PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:21	0.08	21.0	2	1	0
PRT	sp|Q07833|WAPA_BACSU	tRNA nuclease WapA OS=Bacillus subtilis (strain 168) OX=224308 GN=wapA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q08430|KINB_BACSU	Sporulation kinase B OS=Bacillus subtilis (strain 168) OX=224308 GN=kinB PE=3 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	null	335-UNIMOD:21,345-UNIMOD:35,347-UNIMOD:21,349-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P02394|RL7_BACSU	50S ribosomal protein L7/L12 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplL PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.20	20.0	2	2	2
PRT	sp|P54941|YXEB_BACSU	Iron(3+)-hydroxamate-binding protein YxeB OS=Bacillus subtilis (strain 168) OX=224308 GN=yxeB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|P37870|RPOB_BACSU	DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	625-UNIMOD:4	0.05	20.0	4	3	2
PRT	sp|P40750|PBPD_BACSU	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P30950|HEM2_BACSU	Delta-aminolevulinic acid dehydratase OS=Bacillus subtilis (strain 168) OX=224308 GN=hemB PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|O34499|6PGL_BACSU	6-phosphogluconolactonase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgl PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	122-UNIMOD:21	0.28	20.0	4	4	4
PRT	sp|O32167|METQ_BACSU	Methionine-binding lipoprotein MetQ OS=Bacillus subtilis (strain 168) OX=224308 GN=metQ PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	2	1	0
PRT	sp|P39149|UPP_BACSU	Uracil phosphoribosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=upp PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.16	20.0	2	2	2
PRT	sp|O32232|EST_BACSU	Carboxylesterase OS=Bacillus subtilis (strain 168) OX=224308 GN=est PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	194-UNIMOD:35	0.09	20.0	1	1	1
PRT	sp|P96611|YDBP_BACSU	Thioredoxin-like protein YdbP OS=Bacillus subtilis (strain 168) OX=224308 GN=ydbP PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.16	20.0	2	2	2
PRT	sp|P21469|RS7_BACSU	30S ribosomal protein S7 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsG PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	59-UNIMOD:35	0.22	20.0	5	3	1
PRT	sp|O34828|YRZB_BACSU	UPF0473 protein YrzB OS=Bacillus subtilis (strain 168) OX=224308 GN=yrzB PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	20-UNIMOD:4	0.30	20.0	1	1	1
PRT	sp|P21879|IMDH_BACSU	Inosine-5'-monophosphate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=guaB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	76-UNIMOD:35	0.09	20.0	3	2	1
PRT	sp|P21473|RS15_BACSU	30S ribosomal protein S15 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsO PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.33	20.0	1	1	1
PRT	sp|O34328|KGUA_BACSU	Guanylate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmk PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P20458|IF1_BACSU	Translation initiation factor IF-1 OS=Bacillus subtilis (strain 168) OX=224308 GN=infA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	61-UNIMOD:21	0.18	20.0	3	1	0
PRT	sp|P28366|SECA_BACSU	Protein translocase subunit SecA OS=Bacillus subtilis (strain 168) OX=224308 GN=secA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.08	20.0	3	3	3
PRT	sp|P71012|PTF3A_BACSU	PTS system fructose-specific EIIABC component OS=Bacillus subtilis (strain 168) OX=224308 GN=fruA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null	53-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O31749|PYRH_BACSU	Uridylate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=pyrH PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null	14-UNIMOD:21	0.10	20.0	1	1	1
PRT	sp|P54576|MCPC_BACSU	Methyl-accepting chemotaxis protein McpC OS=Bacillus subtilis (strain 168) OX=224308 GN=mcpC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O07513|HIT_BACSU	Protein hit OS=Bacillus subtilis (strain 168) OX=224308 GN=hit PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.40	19.0	4	3	2
PRT	sp|P39634|ROCA_BACSU	1-pyrroline-5-carboxylate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocA PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|P21464|RS2_BACSU	30S ribosomal protein S2 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	2	2	2
PRT	sp|O32165|SUFD_BACSU	FeS cluster assembly protein SufD OS=Bacillus subtilis (strain 168) OX=224308 GN=sufD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	4	3	2
PRT	sp|O34633|YJLC_BACSU	Uncharacterized protein YjlC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjlC PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.24	19.0	2	2	2
PRT	sp|P39758|ABH_BACSU	Putative transition state regulator Abh OS=Bacillus subtilis (strain 168) OX=224308 GN=abh PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|P80866|SUFC_BACSU	Vegetative protein 296 OS=Bacillus subtilis (strain 168) OX=224308 GN=sufC PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null	74-UNIMOD:35	0.04	19.0	1	1	1
PRT	sp|P07343|FUMC_BACSU	Fumarate hydratase class II OS=Bacillus subtilis (strain 168) OX=224308 GN=fumC PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	103-UNIMOD:35,105-UNIMOD:35	0.11	19.0	2	2	2
PRT	sp|P12873|RL29_BACSU	50S ribosomal protein L29 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpmC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.21	19.0	2	1	0
PRT	sp|P37518|YCHF_BACSU	Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) OX=224308 GN=ychF PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null	240-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|C0H3V2|PTMA_BACSU	Mannitol-specific phosphotransferase enzyme IIA component OS=Bacillus subtilis (strain 168) OX=224308 GN=mtlF PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null	117-UNIMOD:4,118-UNIMOD:21	0.17	19.0	2	1	0
PRT	sp|P20429|RPOA_BACSU	DNA-directed RNA polymerase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	1	0
PRT	sp|P37570|MCSB_BACSU	Protein-arginine kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=mcsB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P39789|YPOC_BACSU	Uncharacterized protein YpoC OS=Bacillus subtilis (strain 168) OX=224308 GN=ypoC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	117-UNIMOD:21	0.08	19.0	2	1	0
PRT	sp|O06006|YRAA_BACSU	Putative cysteine protease YraA OS=Bacillus subtilis (strain 168) OX=224308 GN=yraA PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P18255|SYT1_BACSU	Threonine--tRNA ligase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=thrS PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P37476|FTSH_BACSU	ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P39912|AROG_BACSU	Protein AroA(G) OS=Bacillus subtilis (strain 168) OX=224308 GN=aroA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	284-UNIMOD:28,4-UNIMOD:21	0.08	19.0	2	2	2
PRT	sp|Q04796|DAPA_BACSU	4-hydroxy-tetrahydrodipicolinate synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dapA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|Q795U4|YTKL_BACSU	UPF0173 metal-dependent hydrolase YtkL OS=Bacillus subtilis (strain 168) OX=224308 GN=ytkL PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.11	18.0	1	1	1
PRT	sp|P42958|TTUC_BACSU	Probable tartrate dehydrogenase/decarboxylase OS=Bacillus subtilis (strain 168) OX=224308 GN=ycsA PE=3 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	348-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q03523|MURE_BACSU	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=murE PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	422-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|Q06797|RL1_BACSU	50S ribosomal protein L1 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P40924|PGK_BACSU	Phosphoglycerate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgk PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	3	3	3
PRT	sp|P08750|DACA_BACSU	D-alanyl-D-alanine carboxypeptidase DacA OS=Bacillus subtilis (strain 168) OX=224308 GN=dacA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P22326|SYY1_BACSU	Tyrosine--tRNA ligase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=tyrS1 PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O32164|SUFS_BACSU	Cysteine desulfurase SufS OS=Bacillus subtilis (strain 168) OX=224308 GN=sufS PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	215-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|O32090|PNCB_BACSU	Nicotinate phosphoribosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=pncB PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P37465|SYM_BACSU	Methionine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=metG PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O30509|GATB_BACSU	Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus subtilis (strain 168) OX=224308 GN=gatB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P96614|CSHA_BACSU	DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) OX=224308 GN=cshA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	367-UNIMOD:35	0.04	18.0	2	1	0
PRT	sp|P96648|YDDK_BACSU	Uncharacterized protein YddK OS=Bacillus subtilis (strain 168) OX=224308 GN=yddK PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|O06746|YITK_BACSU	UPF0234 protein yitk OS=Bacillus subtilis (strain 168) OX=224308 GN=yitK PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|P71066|YVFG_BACSU	Uncharacterized protein YvfG OS=Bacillus subtilis (strain 168) OX=224308 GN=yvfG PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	39-UNIMOD:21	0.19	18.0	1	1	1
PRT	sp|P28599|CH10_BACSU	10 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=groS PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	22-UNIMOD:21	0.14	18.0	1	1	1
PRT	sp|Q03223|RL31_BACSU	50S ribosomal protein L31 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpmE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	36-UNIMOD:4,39-UNIMOD:4	0.23	18.0	1	1	1
PRT	sp|O31646|MANA1_BACSU	Mannose-6-phosphate isomerase ManA OS=Bacillus subtilis (strain 168) OX=224308 GN=manA PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	257-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P14949|THIO_BACSU	Thioredoxin OS=Bacillus subtilis (strain 168) OX=224308 GN=trxA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	null	34-UNIMOD:35	0.26	18.0	2	2	2
PRT	sp|P12879|RS8_BACSU	30S ribosomal protein S8 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsH PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	55-UNIMOD:21	0.11	18.0	3	2	1
PRT	sp|P94524|ARAB_BACSU	Ribulokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=araB PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	null	231-UNIMOD:21,233-UNIMOD:21,236-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P39148|GLYA_BACSU	Serine hydroxymethyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=glyA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.12	17.0	3	3	3
PRT	sp|P14802|YOXD_BACSU	Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) OX=224308 GN=yoxD PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|O31777|BIOF1_BACSU	8-amino-7-oxononanoate synthase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=kbl PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|O32119|YUTI_BACSU	Putative nitrogen fixation protein YutI OS=Bacillus subtilis (strain 168) OX=224308 GN=yutI PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	61-UNIMOD:4	0.15	17.0	1	1	1
PRT	sp|P36949|RBSB_BACSU	Ribose import binding protein RbsB OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P53001|AAT1_BACSU	Aspartate aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=aspB PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	96-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P50842|KDUD_BACSU	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=kduD PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|O31755|SYP_BACSU	Proline--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=proS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|O32052|YRBF_BACSU	Sec translocon accessory complex subunit YrbF OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbF PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.26	17.0	1	1	1
PRT	sp|P94550|ETFB_BACSU	Electron transfer flavoprotein subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=etfB PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P28264|FTSA_BACSU	Cell division protein FtsA OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	386-UNIMOD:35	0.07	17.0	1	1	1
PRT	sp|Q05852|GTAB_BACSU	UTP--glucose-1-phosphate uridylyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gtaB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.12	17.0	2	2	2
PRT	sp|O31605|PEPF_BACSU	Oligoendopeptidase F homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	2	2	2
PRT	sp|O34589|FLAW_BACSU	Probable flavodoxin 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=ykuP PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	86-UNIMOD:4,100-UNIMOD:4	0.17	17.0	1	1	1
PRT	sp|P94556|MURI1_BACSU	Glutamate racemase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=racE PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	null	199-UNIMOD:35	0.08	17.0	1	1	1
PRT	sp|P96676|YDES_BACSU	Uncharacterized HTH-type transcriptional regulator YdeS OS=Bacillus subtilis (strain 168) OX=224308 GN=ydeS PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P54466|YQFA_BACSU	UPF0365 protein YqfA OS=Bacillus subtilis (strain 168) OX=224308 GN=yqfA PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P04969|RS11_BACSU	30S ribosomal protein S11 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsK PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.11	16.0	1	1	1
PRT	sp|P54616|FABI_BACSU	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI OS=Bacillus subtilis (strain 168) OX=224308 GN=fabI PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|O35008|YTQA_BACSU	Uncharacterized protein YtqA OS=Bacillus subtilis (strain 168) OX=224308 GN=ytqA PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null	54-UNIMOD:4,57-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|P27876|TPIS_BACSU	Triosephosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tpiA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null	91-UNIMOD:4	0.17	16.0	3	2	1
PRT	sp|O07631|BIPA_BACSU	50S ribosomal subunit assembly factor BipA OS=Bacillus subtilis (strain 168) OX=224308 GN=bipA PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P54464|YQEY_BACSU	Uncharacterized protein YqeY OS=Bacillus subtilis (strain 168) OX=224308 GN=yqeY PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.18	16.0	2	2	2
PRT	sp|P96686|YDFI_BACSU	Transcriptional regulatory protein YdfI OS=Bacillus subtilis (strain 168) OX=224308 GN=ydfI PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null	106-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P42297|YXIE_BACSU	Universal stress protein YxiE OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiE PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P80643|ACP_BACSU	Acyl carrier protein OS=Bacillus subtilis (strain 168) OX=224308 GN=acpA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.21	16.0	1	1	1
PRT	sp|O32037|TCDA_BACSU	tRNA threonylcarbamoyladenosine dehydratase OS=Bacillus subtilis (strain 168) OX=224308 GN=tcdA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q01465|MREB_BACSU	Cell shape-determining protein MreB OS=Bacillus subtilis (strain 168) OX=224308 GN=mreB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null	104-UNIMOD:35,106-UNIMOD:4,109-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P37538|DARA_BACSU	Cyclic di-AMP receptor A OS=Bacillus subtilis (strain 168) OX=224308 GN=darA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.13	16.0	1	1	1
PRT	sp|P24072|CHEY_BACSU	Chemotaxis protein CheY OS=Bacillus subtilis (strain 168) OX=224308 GN=cheY PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.16	16.0	1	1	1
PRT	sp|P45913|YQAP_BACSU	Uncharacterized protein YqaP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqaP PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P21476|RS19_BACSU	30S ribosomal protein S19 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsS PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.21	16.0	1	1	1
PRT	sp|P40780|YTXH_BACSU	Uncharacterized protein YtxH OS=Bacillus subtilis (strain 168) OX=224308 GN=ytxH PE=4 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	null	74-UNIMOD:21	0.14	16.0	1	1	1
PRT	sp|O34348|YFMC_BACSU	Fe(3+)-citrate-binding protein YfmC OS=Bacillus subtilis (strain 168) OX=224308 GN=yfmC PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P81101|RRF_BACSU	Ribosome-recycling factor OS=Bacillus subtilis (strain 168) OX=224308 GN=frr PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	null	147-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P54378|GCST_BACSU	Aminomethyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=gcvT PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P39759|YKQA_BACSU	Putative gamma-glutamylcyclotransferase YkqA OS=Bacillus subtilis (strain 168) OX=224308 GN=ykqA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	null	258-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|O31526|YESW_BACSU	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	null	233-UNIMOD:35,235-UNIMOD:21,237-UNIMOD:21,243-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|O32210|GR_BACSU	Glyoxal reductase OS=Bacillus subtilis (strain 168) OX=224308 GN=yvgN PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null	160-UNIMOD:35	0.06	15.0	1	1	1
PRT	sp|P23452|FLIL_BACSU	Flagellar protein FliL OS=Bacillus subtilis (strain 168) OX=224308 GN=fliL PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.14	15.0	1	1	1
PRT	sp|P55180|GALE_BACSU	UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) OX=224308 GN=galE PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P37565|HSLO_BACSU	33 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=hslO PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null	257-UNIMOD:35,268-UNIMOD:4,271-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|P39120|CISY2_BACSU	Citrate synthase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=citZ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P71021|DIV4A_BACSU	Septum site-determining protein DivIVA OS=Bacillus subtilis (strain 168) OX=224308 GN=divIVA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.13	15.0	1	1	1
PRT	sp|O07621|HEMAT_BACSU	Heme-based aerotactic transducer HemAT OS=Bacillus subtilis (strain 168) OX=224308 GN=hemAT PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P25812|MNMG_BACSU	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Bacillus subtilis (strain 168) OX=224308 GN=mnmG PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P45743|DHBB_BACSU	Isochorismatase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P54170|YPHP_BACSU	UPF0403 protein YphP OS=Bacillus subtilis (strain 168) OX=224308 GN=yphP PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	null		0.10	15.0	1	1	1
PRT	sp|P08065|SDHA_BACSU	Succinate dehydrogenase flavoprotein subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=sdhA PE=3 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	null	40-UNIMOD:21,41-UNIMOD:21,42-UNIMOD:21,44-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|O31404|ACOA_BACSU	Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=acoA PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	null	243-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|P77837|URE1_BACSU	Urease subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=ureC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q45480|YLYB_BACSU	Uncharacterized RNA pseudouridine synthase YlyB OS=Bacillus subtilis (strain 168) OX=224308 GN=ylyB PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	null	152-UNIMOD:35	0.05	15.0	1	1	1
PRT	sp|O07598|YHAA_BACSU	Putative amidohydrolase YhaA OS=Bacillus subtilis (strain 168) OX=224308 GN=yhaA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	null	35-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P16971|RECA_BACSU	Protein RecA OS=Bacillus subtilis (strain 168) OX=224308 GN=recA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	null		0.08	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	1	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	54.0		ms_run[1]:scan=13126	44.537844	4	4270.160560	4269.171287	K	Q	35	77
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	2	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=26415	69.044	3	2901.3727	2901.3727	K	T	61	91
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	3	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=12852	44.021	4	4269.1713	4269.1713	K	Q	35	77
PSM	EEGAVEEGNTVVLDFEGFVDGEAFEGGK	4	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=33314	83.216	3	2929.3141	2929.3141	K	A	156	184
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	5	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	47.0	10-UNIMOD:35	ms_run[1]:scan=11318	41.206554	4	4286.155564	4285.166202	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	6	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=13179	44.638281	5	4270.161122	4269.171287	K	Q	35	77
PSM	HSKPTQANPQGGISNQEAPIHVSNVMPLDPK	7	sp|P0CI78|RL24_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14888	47.773	4	3290.6466	3290.6466	K	T	44	75
PSM	AMLDDQIQVVAINASYSAETLAHLIK	8	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=33271	83.141	3	2813.4633	2813.4633	K	Y	21	47
PSM	ATDLQSIQDEISALTDEIDGISNR	9	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=33428	83.413	3	2603.2562	2603.2562	K	T	106	130
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	10	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15706	49.255	3	3676.4932	3676.4932	K	R	107	145
PSM	AMDAEAGVMISASHNPVQDNGIK	11	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:35,9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14262	46.632	3	2466.0556	2466.0556	K	F	88	111
PSM	EENIEHGTIEFIITVGEESGLIGAK	12	sp|P54542|YQJE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=33368	83.31	3	2684.3545	2684.3545	K	A	123	148
PSM	LAQLAVESIREEGGDAQFIAVR	13	sp|P08164|NADE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21317	59.441	3	2371.2496	2371.2496	R	L	58	80
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	14	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15796	49.414	4	3676.4932	3676.4932	K	R	107	145
PSM	GGTEVHFGEFGIQALEASWITNR	15	sp|P14577|RL16_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=29131	74.514	3	2518.2241	2518.2241	K	Q	23	46
PSM	VPTPNVSLVDLVAELNQEVTAEEVNAALK	16	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=33445	83.444	3	3061.6183	3061.6183	R	E	234	263
PSM	AIEAVDECLGEVVDAILAK	17	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4	ms_run[2]:scan=33357	83.291	2	2014.0293	2014.0293	K	G	417	436
PSM	AMDAEAGVMISASHNPVQDNGIK	18	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=16343	50.395	3	2450.0607	2450.0607	K	F	88	111
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	19	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=26674	69.554	3	2901.3727	2901.3727	K	T	61	91
PSM	HIYAQIIDDVNGVTLASASTLDK	20	sp|P46899|RL18_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=26363	68.944	3	2443.2595	2443.2595	K	D	39	62
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	21	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=33325	83.235	4	3573.8769	3573.8769	K	R	144	176
PSM	LEHTINNLSASGENLTAAESR	22	sp|P02968|FLA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13361	44.983	3	2226.0877	2226.0877	R	I	242	263
PSM	HSKPTQANPQGGISNQEAPIHVSNVMPLDPK	23	sp|P0CI78|RL24_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:35	ms_run[2]:scan=12675	43.684	5	3306.6415	3306.6415	K	T	44	75
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	24	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35	ms_run[2]:scan=10830	40.304	6	4285.1662	4285.1662	K	Q	35	77
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	25	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=22170	60.982	3	2746.3088	2746.3088	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	26	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35	ms_run[2]:scan=25039	66.371	3	2730.3139	2730.3139	K	E	92	119
PSM	QLNAYGGIVVTASHNPPEYNGYK	27	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=17477	52.469	3	2571.1795	2571.1795	R	V	134	157
PSM	QGQENSEVTVDDIAMVVSSWTGVPVSK	28	sp|P37571|CLPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=33392	83.350873	3	2862.381613	2861.375304	K	I	464	491
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	29	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=16555	50.791321	3	3677.479022	3676.493232	K	R	107	145
PSM	HIVLNLEDLSFMDSSGLGVILGR	30	sp|P10727|SP2AA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=33337	83.255	3	2564.271	2564.2710	R	Y	45	68
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	31	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35	ms_run[2]:scan=11034	40.691	4	4285.1662	4285.1662	K	Q	35	77
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	32	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=33191	83.002	3	3532.6587	3532.6587	K	G	66	97
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	33	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=23365	63.201	3	2746.3088	2746.3088	K	E	92	119
PSM	RPNTDELGLEQVGIEMTDR	34	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20801	58.493	3	2172.0481	2172.0481	R	G	276	295
PSM	SGETEDSTIADIAVATNAGQIK	35	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20800	58.491	3	2190.0652	2190.0652	R	T	369	391
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	36	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:35	ms_run[1]:scan=11329	41.225636	5	4286.156885	4285.166202	K	Q	35	77
PSM	AIEAVDECLGEVVDAILAK	37	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:4	ms_run[1]:scan=33359	83.293477	3	2015.034245	2014.029259	K	G	417	436
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	38	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=16083	49.928894	4	3677.483033	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	39	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=17980	53.359155	3	3678.469026	3676.493232	K	R	107	145
PSM	HSDDMGITAENVTVDFTK	40	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=16532	50.748	3	1994.8891	1994.8891	K	V	70	88
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	41	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24538	65.428	3	2752.29	2752.2900	K	M	38	63
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	42	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=19984	57.011	3	2762.3037	2762.3037	K	E	92	119
PSM	NSLIEAVCELDEELMDK	43	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=33323	83.232	2	2006.9177	2006.9177	R	Y	212	229
PSM	AENLEVSDEEVDAELTK	44	sp|P80698|TIG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17388	52.307	2	1889.8742	1889.8742	K	M	369	386
PSM	DADIVCICAGANQKPGETR	45	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=12231	42.869	3	2073.9572	2073.9572	K	L	73	92
PSM	DVSYMDSTGLGVFVGTFK	46	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=32237	81.023	2	2001.8795	2001.8795	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	47	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=32478	81.535	2	2001.8795	2001.8795	K	M	50	68
PSM	NSLIEAVCELDEELMDK	48	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=33327	83.237	3	2006.9177	2006.9177	R	Y	212	229
PSM	PLLLIAEDVEGEALATLVVNK	49	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=33379	83.329	3	2206.2461	2206.2461	K	L	244	265
PSM	SLEEGQEVSFEIVEGNR	50	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20281	57.548	2	1920.9065	1920.9065	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	51	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20293	57.572	2	1876.9167	1876.9167	K	G	40	57
PSM	DVSYMDSTGLGVFVGTFK	52	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=29946	76.169	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	53	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=30192	76.679	2	2017.8744	2017.8744	K	M	50	68
PSM	GQATITEIDGTVVEINEVR	54	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21493	59.75	2	2043.0484	2043.0484	K	D	967	986
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	55	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=22738	62.013	3	2746.3088	2746.3088	K	E	92	119
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	56	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	32.0		ms_run[1]:scan=11800	42.078164	7	5134.5862	5133.5802	K	I	35	84
PSM	MQEASNGKDTMTGHWEIMGLYIDK	57	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=23920	64.261313	3	2867.187985	2866.201319	K	P	78	102
PSM	DFATSELEDNPAYQYAVVR	58	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=27257	70.724	2	2266.9784	2266.9784	K	N	239	258
PSM	DGFYQIVNVQSDAAAVQEFDR	59	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27744	71.686	3	2371.1081	2371.1081	R	L	57	78
PSM	DGHHVELAANIGTPDDVK	60	sp|P08838|PT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12009	42.46	3	1886.9123	1886.9123	K	G	265	283
PSM	DITASPVLSETAPTSAPSEAAAANEIK	61	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=20139	57.294	3	2720.2794	2720.2794	K	Q	460	487
PSM	EGAEQIISEIQNQLQNLK	62	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=33459	83.467	3	2134.0307	2134.0307	K	-	79	97
PSM	KVEIAQVNTVDIEDVK	63	sp|P37487|PPAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16051	49.873	3	1798.9676	1798.9676	K	K	213	229
PSM	NEDVTIVMGVNEDQFDAER	64	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:35	ms_run[2]:scan=17681	52.831	2	2195.9641	2195.9641	K	H	125	144
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	65	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17398	52.325	3	3676.4932	3676.4932	K	R	107	145
PSM	RPNTDELGLEQVGIEMTDR	66	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=20770	58.438321	3	2172.050358	2172.048096	R	G	276	295
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	67	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:35	ms_run[1]:scan=11801	42.079568	4	4157.075486	4157.071239	K	Q	36	77
PSM	AMDAEAGVMISASHNPVQDNGIK	68	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=16049	49.87	3	2450.0607	2450.0607	K	F	88	111
PSM	DDLVRPADLYLEGSDQYR	69	sp|Q45477|SYI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20429	57.814	3	2124.0124	2124.0124	R	G	542	560
PSM	DRPAVTYNGQSWTYGELNAK	70	sp|Q04747|SRFAB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17205	51.974	3	2269.0764	2269.0764	K	A	2556	2576
PSM	DVEVTFPEEYHAEDLAGK	71	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19010	55.268	3	2047.9375	2047.9375	K	P	214	232
PSM	EHVINPVVPEELIDEETK	72	sp|P54419|METK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21132	59.101	3	2089.0579	2089.0579	K	Y	219	237
PSM	HLHEEGANLIVTDINK	73	sp|P54531|DHLE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13524	45.288	3	1801.9323	1801.9323	R	Q	191	207
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	74	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	28-UNIMOD:21	ms_run[2]:scan=33460	83.469	4	3557.882	3557.8820	K	R	144	176
PSM	IRFPETSGIGIKPVSEEGTSR	75	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15958	49.703	4	2259.1859	2259.1859	K	L	179	200
PSM	STALLPLVGDIDTER	76	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=27123	70.449	2	1678.8179	1678.8179	K	A	174	189
PSM	VNVGEETLQIVCGAPNVDQGQK	77	sp|O34943|YTPR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=21526	59.812	3	2354.1536	2354.1536	K	V	118	140
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	78	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13675	45.564314	4	4271.152126	4269.171287	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	79	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:35	ms_run[1]:scan=12736	43.791506	5	4286.190882	4285.166202	K	Q	35	77
PSM	NDAYKQEELDQIVDDVK	80	sp|P13714|LDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19533	56.198682	2	2020.961206	2020.958930	K	N	203	220
PSM	MQEASNGKDTMTGHWEIMGLYIDK	81	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=23374	63.220422	3	2867.190627	2866.201319	K	P	78	102
PSM	ADDNVVDAEYEEVNDDQNK	82	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14698	47.414	3	2180.8982	2180.8982	K	K	592	611
PSM	ALEEVIYFASYVVTDPANTPLEK	83	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=33225	83.061	3	2568.2999	2568.2999	R	K	124	147
PSM	ALSILTVSDHVLTGEETTAEER	84	sp|O34925|DEOD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23436	63.351	3	2370.1914	2370.1914	K	Q	195	217
PSM	DGSIVEWTGDEDADTPHSITNITSAK	85	sp|P94431|YCNI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20319	57.616	3	2758.257	2758.2570	K	Q	131	157
PSM	DLLSEYDFPGDDVPVVK	86	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=26696	69.6	2	1906.92	1906.9200	R	G	157	174
PSM	DVSYMDSTGLGVFVGTFK	87	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=29699	75.66	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	88	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=31175	78.784	2	2017.8744	2017.8744	K	M	50	68
PSM	DYTIWAVSGDSVQNHIDK	89	sp|P46318|PTJB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20207	57.419	3	2046.9647	2046.9647	K	A	30	48
PSM	GIAQAANTTGVPVIFGIVTTENIEQAIER	90	sp|P11998|RISB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=33249	83.102	3	3011.5928	3011.5928	K	A	99	128
PSM	HLHEEGANLIVTDINK	91	sp|P54531|DHLE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13523	45.286	2	1801.9323	1801.9323	R	Q	191	207
PSM	KDEETGKPLVDVILDK	92	sp|P80859|6PGD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19407	55.979	3	1797.9724	1797.9724	K	A	241	257
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	93	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12634	43.608	5	4269.1713	4269.1713	K	Q	35	77
PSM	KQELLQSLEVGSVLDGK	94	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22013	60.691	3	1842.0098	1842.0098	K	V	178	195
PSM	MQEASNGKDTMTGHWEIMGLYIDK	95	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=22837	62.193	3	2866.2013	2866.2013	K	P	78	102
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	96	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=33194	83.006	4	3532.6587	3532.6587	K	G	66	97
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	97	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=20267	57.525	3	2762.3037	2762.3037	K	E	92	119
PSM	STALLPLVGDIDTER	98	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=27333	70.895	3	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	99	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=27635	71.479	2	1678.8179	1678.8179	K	A	174	189
PSM	TLEEGQAVSFEIVEGNR	100	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20009	57.057	2	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	101	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20576	58.088	2	1876.9167	1876.9167	K	G	40	57
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	102	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=12718	43.758999	7	4270.1762	4269.1712	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	103	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:35	ms_run[1]:scan=10762	40.180501	4	4285.170521	4285.166202	K	Q	35	77
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	104	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=17786	53.014427	4	3678.471430	3676.493232	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	105	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=21771	60.259174	3	2554.1553	2554.1524	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	106	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=22062	60.778411	3	2554.1553	2554.1524	R	V	134	157
PSM	DNDDATHSHQFMQIEGLVVDK	107	sp|P17921|SYFA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:35	ms_run[2]:scan=18932	55.118	3	2414.0809	2414.0809	R	N	200	221
PSM	EGAEQIISEIQNQLQNLK	108	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=32902	82.455	3	2054.0644	2054.0644	K	-	79	97
PSM	HIGTPHEVLEEGQTVK	109	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10156	39.061	3	1772.9057	1772.9057	K	V	309	325
PSM	IRFPETSGIGIKPVSEEGTSR	110	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15939	49.669	3	2259.1859	2259.1859	K	L	179	200
PSM	ITGTSNYEDTAGSDIVVITAGIAR	111	sp|P49814|MDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25149	66.585	3	2423.218	2423.2180	K	K	64	88
PSM	MENGSTVEEYITSAVAK	112	sp|P80700|EFTS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=21901	60.494	2	1843.851	1843.8510	K	I	115	132
PSM	NIPGVTVVEANGINVLDVVNHEK	113	sp|P42921|RL4_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=26401	69.016	3	2429.2914	2429.2914	R	L	169	192
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	114	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=23241	62.947	3	2746.3088	2746.3088	K	E	92	119
PSM	REEFLSEAQSLVQHSR	115	sp|P94425|YCNE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:21	ms_run[2]:scan=20655	58.236	3	1994.9211	1994.9211	K	A	15	31
PSM	SLEEGQEVSFEIVEGNR	116	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20565	58.069	2	1920.9065	1920.9065	K	G	40	57
PSM	STALLPLVGDIDTER	117	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=27372	70.969	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTERAK	118	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=23489	63.459	2	1877.95	1877.9500	K	F	174	191
PSM	SVFEISDEINGLATK	119	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23981	64.369	2	1621.8199	1621.8199	K	A	328	343
PSM	TELINAVAEASELSK	120	sp|P08821|DBH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22339	61.285	2	1573.8199	1573.8199	K	K	4	19
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	121	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=18265	53.877012	3	3678.469026	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	122	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=15988	49.75944	3	3677.482337	3676.493232	K	R	107	145
PSM	AVDSVFDTILDALK	123	sp|P08821|DBH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=33434	83.425	2	1505.7977	1505.7977	K	N	24	38
PSM	CDMVDDEELLELVEMEVR	124	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=33252	83.106	3	2222.9745	2222.9745	K	D	139	157
PSM	DDAEDTDIKDNDWIECFNR	125	sp|P42175|NARG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:4	ms_run[2]:scan=22209	61.051	3	2369.9706	2369.9706	K	N	1115	1134
PSM	DDQNVGVIVLAGAGDK	126	sp|P23966|MENB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18863	54.992	3	1569.7999	1569.7999	R	A	52	68
PSM	EIELEDAFENMGAK	127	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35	ms_run[2]:scan=19275	55.739	2	1610.7134	1610.7134	K	L	58	72
PSM	ELGVEVYSVSTDTHFVHK	128	sp|P80239|AHPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16734	51.12	3	2046.0058	2046.0058	K	G	63	81
PSM	ENIALPNLSSFSPK	129	sp|P36947|RBSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:21	ms_run[2]:scan=25583	67.396	2	1595.7596	1595.7596	R	G	348	362
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIRG	130	sp|C0SP85|YUKE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35	ms_run[2]:scan=33258	83.119	3	3589.6802	3589.6802	K	-	66	98
PSM	QIVEAVGGAENIAAATHCVTR	131	sp|P39794|PTTBC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:4	ms_run[2]:scan=16772	51.188	3	2166.0851	2166.0852	R	L	10	31
PSM	REEFLSEAQSLVQHSR	132	sp|P94425|YCNE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18707	54.701	3	1914.9548	1914.9548	K	A	15	31
PSM	REGTDLSIITYGAMVHESLK	133	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21318	59.442	3	2219.1256	2219.1256	K	A	200	220
PSM	SLLIDIVDETGSVSEEMLK	134	sp|P46347|YBEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=33326	83.236	3	2077.0501	2077.0501	M	E	2	21
PSM	STALLPLVGDIDTERAK	135	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=23240	62.946	2	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	136	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=23389	63.249	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	137	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=23660	63.771	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	138	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=23931	64.28	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	139	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=24475	65.306	3	1877.95	1877.9500	K	F	174	191
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	140	sp|P49786|BCCP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	27.0	9-UNIMOD:35	ms_run[1]:scan=10939	40.511846	5	5021.4847	5021.4797	K	I	36	84
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	141	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18068	53.524042	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	142	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18814	54.901545	3	3677.474556	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	143	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=17215	51.991868	4	3677.480622	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	144	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16371	50.448725	4	3677.483033	3676.493232	K	R	107	145
PSM	QEVLDVLAEVCQDDIVK	145	sp|P39579|DLTC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,11-UNIMOD:4	ms_run[1]:scan=33367	83.308306	2	1954.9576	1954.9552	K	E	5	22
PSM	ALSILTVSDHVLTGEETTAEER	146	sp|O34925|DEOD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23419	63.311	3	2370.1914	2370.1914	K	Q	195	217
PSM	AMLEDIAVLTGGEVITEDLGLDLK	147	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=33294	83.18	3	2530.3088	2530.3088	K	S	285	309
PSM	ASENAEIDVPQAMVDTELDR	148	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22193	61.022	3	2202.011	2202.0110	K	M	296	316
PSM	DVLQVVIGDGEEIGNVFTSSPK	149	sp|P94428|GABD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=33391	83.349	3	2302.1693	2302.1693	K	I	181	203
PSM	DVSYMDSTGLGVFVGTFK	150	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30438	77.187	2	2017.8744	2017.8744	K	M	50	68
PSM	GMDIVIVTTANTDEEAR	151	sp|P12877|RL5_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=14185	46.494	2	1849.8728	1849.8728	R	E	151	168
PSM	KGDSQDTYLQSAGDESDLDPER	152	sp|O07636|YLAL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13430	45.117	3	2425.0517	2425.0517	R	V	33	55
PSM	QAEPAAQEVSEEAQSEAK	153	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10953	40.539	3	1900.865	1900.8650	K	S	102	120
PSM	QLNAYGGIVVTASHNPPEYNGYK	154	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=17764	52.976	3	2571.1795	2571.1795	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	155	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=21976	60.629	3	2571.1795	2571.1795	R	V	134	157
PSM	SEVHNEDMYNAIDLATNK	156	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:35	ms_run[2]:scan=13173	44.626	3	2078.9215	2078.9215	R	L	66	84
PSM	SIMGVMSLGIAK	157	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:21,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=16331	50.375	2	1317.6074	1317.6074	K	G	46	58
PSM	STALLPLVGDIDTER	158	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=27881	71.984	2	1678.8179	1678.8179	K	A	174	189
PSM	THQSQEVISAYQDLTK	159	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16382	50.472	3	1846.9061	1846.9061	R	E	40	56
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	160	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:35	ms_run[1]:scan=12725	43.772402	4	4285.166004	4285.166202	K	Q	35	77
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	161	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=16278	50.274796	3	3677.482337	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	162	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17494	52.500109	4	3677.480622	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	163	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17689	52.846096	3	3678.469026	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	164	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=20506	57.957365	3	3677.476085	3676.493232	K	R	107	145
PSM	DAVAIIGANSTPLK	165	sp|P80861|YJLD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17529	52.56	2	1368.7613	1368.7613	K	G	352	366
PSM	DAVVVADRHESGDASINAYLVNR	166	sp|Q08787|SRFAC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15777	49.38	3	2470.2201	2470.2201	K	T	888	911
PSM	DLLSEYDFPGDDVPVVK	167	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=26956	70.114	2	1906.92	1906.9200	R	G	157	174
PSM	DVSYMDSTGLGVFVGTFK	168	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=29887	76.057	3	2017.8744	2017.8744	K	M	50	68
PSM	EHANAFTELNDPIDQR	169	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15892	49.585	3	1868.8653	1868.8653	R	E	417	433
PSM	GSDESDDAKTEAQVQSTAEAGQDVAK	170	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10821	40.287	3	2636.1685	2636.1685	K	E	88	114
PSM	HPETGEVLVNENELIDEDK	171	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16434	50.57	3	2179.0281	2179.0281	K	A	854	873
PSM	HTAPHVTLMDEVDVTNLVAHR	172	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20022	57.082	4	2354.1801	2354.1801	K	K	233	254
PSM	ITNIQEILPVLEQVVQQGK	173	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=33044	82.731	3	2148.2154	2148.2154	K	P	225	244
PSM	IVLDDLIEEGFGALIK	174	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=33458	83.466	2	1743.9659	1743.9659	K	E	319	335
PSM	KIPFFVGGSADLAGSNK	175	sp|P45694|TKT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19175	55.562	3	1706.8992	1706.8992	K	T	370	387
PSM	LLGYSINQQIENDR	176	sp|P39779|CODY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17791	53.025	2	1661.8373	1661.8373	K	M	48	62
PSM	MQEASNGKDTMTGHWEIMGLYIDK	177	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23109	62.708	4	2866.2013	2866.2013	K	P	78	102
PSM	SSELLDALTILEK	178	sp|P32727|NUSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:21	ms_run[2]:scan=33358	83.292	2	1510.7532	1510.7532	M	E	2	15
PSM	STALLPLVGDIDTERAK	179	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=24206	64.796	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	180	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=24747	65.819	3	1877.95	1877.9500	K	F	174	191
PSM	TGQTADEVLNTLNK	181	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15954	49.697	2	1502.7577	1502.7577	K	K	255	269
PSM	TLEEGQAVSFEIVEGNR	182	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20304	57.591	3	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	183	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21978	60.631	2	1876.9167	1876.9167	K	G	40	57
PSM	TYELTDFIVNVLGVEDVGATLHTK	184	sp|O07020|LUTA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=33315	83.217	3	2633.3588	2633.3588	K	A	107	131
PSM	VTVPVAIHLDHGSSFESCAK	185	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	14-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=17921	53.255	3	2233.0239	2233.0239	K	A	76	96
PSM	DRPAVTYNGQSWTYGELNAK	186	sp|P27206|SRFAA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17482	52.479869	3	2270.062809	2269.076360	K	A	2560	2580
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	187	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=14210	46.536952	4	4142.067156	4141.076324	K	Q	36	77
PSM	MQEASNGKDTMTGHWEIMGLYIDK	188	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=23906	64.234046	4	2867.187026	2866.201319	K	P	78	102
PSM	NGGNNDTGWENPEFKK	189	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12157	42.723001	3	1806.782289	1805.796891	K	L	464	480
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	190	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19091	55.414938	3	3677.474556	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	191	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19945	56.94132	3	3677.474556	3676.493232	K	R	107	145
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	192	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=33550	83.628155	4	3374.749555	3374.744849	K	A	144	174
PSM	QLNAYGGIVVTASHNPPEYNGYK	193	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=18337	54.003199	3	2572.168945	2571.179519	R	V	134	157
PSM	AAVEEGIVSGGGTALVNVYNK	194	sp|P28598|CH60_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19489	56.122	3	2047.0586	2047.0586	R	V	403	424
PSM	AYTAQIAVLAVLASVAADK	195	sp|P0CI73|GLMS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=33329	83.24	3	1874.0513	1874.0513	K	N	401	420
PSM	DHAYLPQGSELLLITQNR	196	sp|P12045|PURK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23035	62.571	3	2067.0749	2067.0749	K	E	91	109
PSM	EGAEQIISEIQNQLQNLK	197	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=32891	82.436	2	2054.0644	2054.0644	K	-	79	97
PSM	GSDESDDAKTEAQVQSTAEAGQDVAKEEQAQEPAK	198	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14053	46.26	4	3646.6354	3646.6354	K	A	88	123
PSM	GSEHPHEAQKPEVYELR	199	sp|P70974|RL13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7877	34.525	3	2004.9654	2004.9654	R	G	128	145
PSM	GSEHPHEAQKPEVYELRG	200	sp|P70974|RL13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8135	35.083	3	2061.9868	2061.9868	R	-	128	146
PSM	INHNIAALNTLNR	201	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12728	43.777	3	1462.8005	1462.8005	R	L	3	16
PSM	KVQLVGDDLFVTNTK	202	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18294	53.925	3	1675.9145	1675.9145	K	K	308	323
PSM	MGGEQITVQNLEIVK	203	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=18895	55.048	2	1673.8658	1673.8658	R	V	164	179
PSM	MQEASNGKDTMTGHWEIMGLYIDK	204	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=22838	62.195	4	2866.2013	2866.2013	K	P	78	102
PSM	NFDVLDEETGLADR	205	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21119	59.075	2	1592.7318	1592.7318	R	G	107	121
PSM	NGEFIDVTNEDLK	206	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17299	52.143	2	1492.7046	1492.7046	K	G	18	31
PSM	NSLIEAVCELDEELMDK	207	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=32853	82.356	2	2022.9126	2022.9126	R	Y	212	229
PSM	QAGIAANVVAEINDR	208	sp|P21882|ODPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19872	56.809	2	1539.8005	1539.8005	K	A	266	281
PSM	RIEEIETTVQTIEENISR	209	sp|O05519|YDIF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=26606	69.429	3	2159.107	2159.1070	R	N	579	597
PSM	RQENFAEEVMNQVK	210	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20128	57.271	2	1720.8203	1720.8203	K	K	279	293
PSM	RTSHITIVVSEK	211	sp|P42060|RL22_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8320	35.464	3	1368.7725	1368.7725	K	K	99	111
PSM	SANIALINYADGEK	212	sp|P42919|RL2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17896	53.212	2	1477.7413	1477.7413	R	R	88	102
PSM	SIMGVMSLGIAK	213	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=26517	69.245	2	1285.6175	1285.6175	K	G	46	58
PSM	STALLPLVGDIDTER	214	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=27090	70.38	3	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	215	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=27602	71.414	3	1678.8179	1678.8179	K	A	174	189
PSM	STVSAFSDQYQQETGDQLTDFNK	216	sp|P08164|NADE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20110	57.238	3	2608.1565	2608.1565	K	G	110	133
PSM	TLEEGQAVSFEIVEGNR	217	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20857	58.597	2	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	218	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21131	59.099	2	1876.9167	1876.9167	K	G	40	57
PSM	TVAILEQLTEEQLDR	219	sp|O34334|YJOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25962	68.147	2	1756.9207	1756.9207	K	E	89	104
PSM	VGDDHYGTAILNNLK	220	sp|P36945|RBSK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17693	52.852	3	1628.8158	1628.8158	K	A	61	76
PSM	MQEASNGKDTMTGHWEIMGLYIDK	221	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19366	55.902237	4	2882.185937	2882.196234	K	P	78	102
PSM	AMDAEAGVMISASHNPVQDNGIK	222	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=16095	49.949409	3	2450.061727	2450.060726	K	F	88	111
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	223	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=16835	51.301513	3	3677.479022	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	224	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=36910	94.89896	3	3677.476924	3676.493232	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	225	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=18054	53.496966	3	2572.168945	2571.179519	R	V	134	157
PSM	AMLDDQIQVVAINASYSAETLAHLIK	226	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=33078	82.802	3	2829.4582	2829.4582	K	Y	21	47
PSM	AVEEAGIEPVDRPEIDVEK	227	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14283	46.669	3	2094.0481	2094.0481	K	I	79	98
PSM	DPEGNEYMDMLSAYSAVNQGHR	228	sp|P38021|OAT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35	ms_run[2]:scan=21323	59.449	3	2499.0431	2499.0431	K	H	39	61
PSM	DPEGNEYMDMLSAYSAVNQGHR	229	sp|P38021|OAT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:35	ms_run[2]:scan=21364	59.521	3	2499.0431	2499.0431	K	H	39	61
PSM	DSHESFAELDAVIIGVSPDSQEK	230	sp|Q796Y8|BCP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=26532	69.283	3	2472.1656	2472.1656	R	H	54	77
PSM	DVSYMDSTGLGVFVGTFK	231	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=32307	81.17	3	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	232	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:21	ms_run[2]:scan=32439	81.457	3	2001.8795	2001.8795	K	M	50	68
PSM	GLNTAVGDEGGFAPNLGSNEEALQTIVEAIEK	233	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=33204	83.024	3	3242.5943	3242.5943	K	A	197	229
PSM	GVADNQAEIIACVGNFHGR	234	sp|P38021|OAT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:4	ms_run[2]:scan=19556	56.238	3	2026.9643	2026.9643	K	T	129	148
PSM	HSDDMGITAENVTVDFTK	235	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19025	55.296	3	1978.8942	1978.8942	K	V	70	88
PSM	IEDQLAETAQYHGINSFYNLNK	236	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20878	58.637	3	2567.2292	2567.2292	R	-	409	431
PSM	KVEIAQVNTVDIEDVKK	237	sp|P37487|PPAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13668	45.551	3	1927.0626	1927.0626	K	R	213	230
PSM	MQEASNGKDTMTGHWEIMGLYIDK	238	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=18815	54.903	3	2882.1962	2882.1962	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	239	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=19080	55.396	4	2882.1962	2882.1962	K	P	78	102
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	240	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:35	ms_run[2]:scan=24463	65.281	3	2730.3139	2730.3139	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	241	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=27601	71.413	3	2714.319	2714.3190	K	E	92	119
PSM	RGAIVIDNTSAFR	242	sp|Q04797|DHAS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:21	ms_run[2]:scan=15528	48.932	3	1498.7293	1498.7293	K	M	89	102
PSM	RQENFAEEVMNQVK	243	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35	ms_run[2]:scan=14225	46.566	3	1736.8152	1736.8152	K	K	279	293
PSM	SEVHNEDMYNAIDLATNK	244	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16939	51.488	3	2062.9266	2062.9266	R	L	66	84
PSM	SGGGVRPGFEGGQMPLFQR	245	sp|P19946|RL15_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:35	ms_run[2]:scan=14391	46.861	3	1991.9636	1991.9636	R	L	42	61
PSM	SIMGVMSLGIAK	246	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=22108	60.865	2	1301.6124	1301.6124	K	G	46	58
PSM	STALLPLVGDIDTERAK	247	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:21	ms_run[2]:scan=23769	63.974	2	1877.95	1877.9500	K	F	174	191
PSM	YIQAITQTEDDRIK	248	sp|P39808|YVYG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:21	ms_run[2]:scan=12347	43.083	3	1772.8346	1772.8346	K	T	49	63
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	249	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=24985	66.265221	3	2747.334966	2746.308822	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	250	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=23263	62.992827	3	2763.339507	2762.303737	K	E	92	119
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	251	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	23.0	10-UNIMOD:35	ms_run[1]:scan=10657	39.992197	5	5150.5652	5149.5742	K	I	35	84
PSM	DLAEEREEECFTFEQITAQPK	252	sp|P42175|NARG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:4	ms_run[1]:scan=21693	60.11267	3	2571.175837	2569.164249	K	T	979	1000
PSM	CSIATDIAALVADK	253	sp|O34591|ACOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=33435	83.426303	2	1429.7146	1429.7118	R	G	279	293
PSM	CASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVK	254	sp|P80875|G16U_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=23794	64.024273	4	4083.767285	4082.782446	K	V	55	94
PSM	AMDAEAGVMISASHNPVQDNGIK	255	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=17997	53.390292	3	2434.067678	2434.065811	K	F	88	111
PSM	NGGNNDTGWENPEFK	256	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16070	49.90707	2	1678.687585	1677.701927	K	K	464	479
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	257	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=26631	69.474922	3	2753.277825	2752.289994	K	M	38	63
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	258	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=19656	56.422369	3	3677.474556	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	259	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18357	54.038737	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	260	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16650	50.964657	4	3677.480874	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	261	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=23325	63.116965	3	3677.476555	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	262	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=32908	82.467351	3	3677.476533	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	263	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=33177	82.978577	3	3677.476533	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	264	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18545	54.389397	3	3678.469026	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	265	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=21069	58.986523	3	3677.476417	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	266	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=30941	78.27781	2	2018.878992	2017.874412	K	M	50	68
PSM	HEQLEADIAAAGSDFGK	267	sp|O06476|YFMR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=18203	53.768373	3	1837.790886	1837.788374	K	I	579	596
PSM	AENLEVSDEEVDAELTK	268	sp|P80698|TIG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17390	52.31	3	1889.8742	1889.8742	K	M	369	386
PSM	AINEDGNVTTFEAVVR	269	sp|P09339|ACNA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18830	54.931	2	1733.8584	1733.8584	R	F	867	883
PSM	AMDAEAGVMISASHNPVQDNGIK	270	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35,9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14544	47.143	3	2466.0556	2466.0556	K	F	88	111
PSM	DEAIHGVYVGLLAQEIYNK	271	sp|P50621|RIR2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25824	67.87	3	2131.095	2131.0950	R	Q	197	216
PSM	DFRPIDEECDCYTCK	272	sp|O32053|TGT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=13284	44.842	3	2006.7808	2006.7808	R	N	300	315
PSM	DGLVDVLQGEYNLLNR	273	sp|P46336|IOLS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=31411	79.269	2	1816.9319	1816.9319	K	E	168	184
PSM	DNLTLYANAVNK	274	sp|O31567|YFIY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15210	48.353	2	1334.683	1334.6830	K	A	152	164
PSM	DYADFLHEDLK	275	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19986	57.014	2	1364.6248	1364.6248	K	I	27	38
PSM	EISEHIPSAALIEDIK	276	sp|P21470|RS9_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20791	58.475	3	1763.9305	1763.9305	R	Q	34	50
PSM	EQDIMDVWFDSGSSHQAVLEER	277	sp|Q45477|SYI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26023	68.271	3	2577.1442	2577.1442	K	D	520	542
PSM	GAEITISASGADENDALNALEETMK	278	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=27011	70.222	3	2549.1803	2549.1803	K	S	58	83
PSM	GEDLTDFDKFEALDDR	279	sp|P37464|SYS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21595	59.935	3	1884.8378	1884.8378	K	R	22	38
PSM	IEDDIVITENGNR	280	sp|P54518|YQHT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13224	44.723	2	1486.7264	1486.7264	R	T	329	342
PSM	IVLMASEEGGTEIEEVAEK	281	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:35	ms_run[2]:scan=17805	53.052	3	2048.9824	2048.9824	R	T	121	140
PSM	LLDYAEAGDNIGALLR	282	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26273	68.769	2	1702.889	1702.8890	K	G	267	283
PSM	MQEASNGKDTMTGHWEIMGLYIDK	283	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=19380	55.929	3	2882.1962	2882.1962	K	P	78	102
PSM	MREDDLLIITADHGNDPIHHGTDHTR	284	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=13475	45.197	4	2994.4002	2994.4002	K	E	318	344
PSM	MSGVDAIIFTAGIGENSVEVR	285	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=25851	67.922	3	2180.0783	2180.0783	R	E	318	339
PSM	NADLGLAFDGDGDR	286	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17391	52.311	2	1434.6375	1434.6375	K	L	232	246
PSM	NEGETVAAYQTGNFQETLGVNDR	287	sp|P14192|GLMU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18847	54.962	3	2512.1466	2512.1466	K	V	208	231
PSM	NPNTVSEVQELSESR	288	sp|P23129|ODO1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14838	47.677	2	1687.8013	1687.8013	R	F	791	806
PSM	RSGLYDQVIEQLNK	289	sp|O05239|YUGJ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20008	57.055	3	1661.8737	1661.8737	K	A	44	58
PSM	STALLPLVGDIDTER	290	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:21	ms_run[2]:scan=28377	73.005	2	1678.8179	1678.8179	K	A	174	189
PSM	TGYFLLEDGNK	291	sp|P35137|PPIB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19121	55.468	2	1255.6085	1255.6085	K	I	3	14
PSM	YDADVNLEYNGK	292	sp|P08877|PTHP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12396	43.174	2	1399.6256	1399.6256	K	T	29	41
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	293	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=25018	66.330157	3	2747.334966	2746.308822	K	E	92	119
PSM	CDMVDDEELLELVEMEVR	294	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=33470	83.486549	2	2237.9401	2237.9373	K	D	139	157
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	295	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=10799	40.247634	6	4285.168764	4285.166202	K	Q	35	77
PSM	VTADSGIHARPATVLVQTASK	296	sp|P08877|PTHP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=13027	44.36081	3	2201.123272	2201.120547	K	Y	8	29
PSM	NSLIEAVCELDEELMDK	297	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=33282	83.159718	3	2022.910418	2022.912574	R	Y	212	229
PSM	QEELDQIVDDVK	298	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=25395	67.043376	2	1412.6683	1412.6666	K	N	208	220
PSM	MQEASNGKDTMTGHWEIMGLYIDK	299	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=23373	63.219027	4	2867.188726	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	300	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19947	56.944099	4	2883.182985	2882.196234	K	P	78	102
PSM	HGDLIVITAGTVGESGTTNLMK	301	sp|P80885|KPYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	21-UNIMOD:35	ms_run[1]:scan=17703	52.869252	3	2229.133473	2229.131098	K	V	447	469
PSM	HDIQPVNTINNGAIASIPDDSAVEVNCVMTK	302	sp|P46320|LICH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	27-UNIMOD:4,29-UNIMOD:35	ms_run[1]:scan=19306	55.796655	3	3338.582736	3337.591856	K	T	331	362
PSM	MIENEVQGVEYIAVNTDAQALNLSK	303	sp|P17865|FTSZ_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35	ms_run[1]:scan=26839	69.881085	3	2765.377053	2764.358926	R	A	30	55
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	304	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=18912	55.078854	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	305	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=17116	51.809149	3	3678.481324	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	306	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=28538	73.334389	3	3678.483266	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	307	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=29802	75.882926	3	3677.476723	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	308	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21921	60.53294	3	3677.475630	3676.493232	K	R	107	145
PSM	SLEEGQEVSFEIVEGNR	309	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=20236	57.470374	2	1920.909213	1920.906501	K	G	40	57
PSM	SLEEGQEVSFEIVEGNR	310	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=20810	58.509227	2	1920.909213	1920.906501	K	G	40	57
PSM	ASLETDSFLSAASFQETTR	311	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23162	62.804	3	2059.9698	2059.9698	K	V	1126	1145
PSM	DAVVVADRHESGDASINAYLVNR	312	sp|Q08787|SRFAC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15766	49.361	3	2470.2201	2470.2201	K	T	888	911
PSM	DFATSELEDNPAYQYAVVR	313	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:21	ms_run[2]:scan=27201	70.608	3	2266.9784	2266.9784	K	N	239	258
PSM	DKLEEWIEMSNR	314	sp|P80870|GS13_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20802	58.494	3	1548.7242	1548.7242	K	K	113	125
PSM	DLNEIDGIGHR	315	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12414	43.206	2	1237.6051	1237.6051	K	V	79	90
PSM	DLTTDLIINER	316	sp|P20277|RL17_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21146	59.128	2	1301.6827	1301.6827	R	I	19	30
PSM	DVEDVVATILNR	317	sp|Q03224|GLPX_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=30972	78.342	2	1342.7092	1342.7092	K	E	153	165
PSM	DWDQEVPVYEK	318	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17192	51.948	2	1406.6354	1406.6354	K	G	340	351
PSM	EANYDDSFYTENTR	319	sp|P54418|PCKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12821	43.955	2	1723.6962	1723.6962	R	A	306	320
PSM	EETSTGFQLGDLIGDK	320	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=26709	69.626	2	1788.7819	1788.7819	K	L	362	378
PSM	EGVVTEEVVQNIEK	321	sp|P23129|ODO1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17939	53.287	2	1571.8043	1571.8043	K	S	499	513
PSM	GNQMPDDVNALSPQIIIGAQYIQTAGVALGLK	322	sp|P21881|ODPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:35	ms_run[2]:scan=33250	83.104	3	3310.7231	3310.7231	R	K	131	163
PSM	HVIISNASCTTNCLAPVVK	323	sp|O34425|G3P2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=13749	45.694	3	2083.0554	2083.0554	R	V	144	163
PSM	HYDEDIFENGIQCR	324	sp|O32248|YVBK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=16117	49.987	3	1794.7631	1794.7631	R	D	133	147
PSM	KAEDALEIDTTSLSIQEVADK	325	sp|P38493|KCY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20924	58.732	3	2275.1431	2275.1431	R	I	194	215
PSM	KQPVQSNTTNFDILK	326	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:21	ms_run[2]:scan=16563	50.806	3	1811.8819	1811.8819	K	R	68	83
PSM	NDLLITSVLSGNR	327	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23963	64.336	2	1400.7623	1400.7623	K	N	537	550
PSM	NDLLITSVLSGNR	328	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24237	64.851	2	1400.7623	1400.7623	K	N	537	550
PSM	PGSVIVDVAIDQGGIVETVDHITTHDQPTYEK	329	sp|Q08352|DHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=26807	69.813	4	3432.7049	3432.7049	K	H	258	290
PSM	QAAITQEITEIVGGAAALE	330	sp|P37810|ATPG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=33279	83.156	2	1883.984	1883.9840	R	-	269	288
PSM	RIEEQQAELDEIRGEQK	331	sp|P28367|RF2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10374	39.468	3	2070.0342	2070.0342	R	E	298	315
PSM	RPDQLVTVFAGQDK	332	sp|P54534|YQIW_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16581	50.839	3	1572.826	1572.8260	K	E	72	86
PSM	RQENFAEEVMNQVK	333	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20076	57.176	3	1720.8203	1720.8203	K	K	279	293
PSM	SFNANLDTLYR	334	sp|O32163|SUFU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:21	ms_run[2]:scan=21006	58.876	2	1392.6075	1392.6075	M	Q	2	13
PSM	SPVILGVSEGAGR	335	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=15585	49.034	2	1320.6439	1320.6439	K	Y	43	56
PSM	TDDVVAEIAER	336	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15877	49.557	2	1216.5935	1216.5935	K	T	222	233
PSM	TLEEGQAVSFEIVEGNR	337	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20021	57.081	3	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	338	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22262	61.144	2	1876.9167	1876.9167	K	G	40	57
PSM	VEIFSAGEIVDVTGVSK	339	sp|P42920|RL3_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24487	65.33	2	1748.9196	1748.9196	K	G	99	116
PSM	VISWYDNESGYSNR	340	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16152	50.047	3	1688.7431	1688.7431	K	V	309	323
PSM	VLFEISGVSEEVAR	341	sp|P14577|RL16_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22139	60.924	2	1533.8039	1533.8039	K	E	102	116
PSM	YLEGEEITIDELK	342	sp|P80868|EFG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20743	58.389	2	1550.7716	1550.7716	K	A	229	242
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	343	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	21.0	10-UNIMOD:35	ms_run[1]:scan=10658	39.993577	6	5150.5662	5149.5742	K	I	35	84
PSM	MQEASNGKDTMTGHWEIMGLYIDK	344	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19657	56.423749	4	2883.182985	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	345	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,9-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=21371	59.534747	3	2867.188033	2866.201319	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	346	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19376	55.919952	3	3677.474556	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	347	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=33287	83.170423	4	3677.478819	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	348	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=22487	61.559379	3	3677.476275	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	349	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18627	54.552464	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	350	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23870	64.164689	3	3678.475702	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	351	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=24433	65.219485	4	3678.479412	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	352	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18632	54.563195	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	353	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20259	57.509903	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	354	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23588	63.639216	3	3677.476555	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	355	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=24681	65.696309	3	3678.475534	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	356	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18934	55.120705	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	357	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20225	57.451351	3	3677.476085	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	358	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=30539	77.408077	3	3677.477169	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	359	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=30300	76.89981	3	3677.477169	3676.493232	K	R	107	145
PSM	NGGDILTESYEYDANGNR	360	sp|Q07833|WAPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19119	55.465357	2	1987.841485	1986.855528	K	T	1887	1905
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	361	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=26266	68.755237	3	3679.480581	3676.493232	K	R	107	145
PSM	MQEASNGKDTMTGHWEIMGLYIDK	362	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=16640	50.946927	4	2965.228208	2962.162565	K	P	78	102
PSM	NSIEAVPHGKGMIHISAK	363	sp|Q08430|KINB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,12-UNIMOD:35,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=11318	41.206554	2	2144.843326	2143.892810	K	R	334	352
PSM	ADDNVVDAEYEEVNDDQNKK	364	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13091	44.474	3	2308.9931	2308.9931	K	-	592	612
PSM	ALNIEEIIASVK	365	sp|P02394|RL7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=29047	74.338	2	1298.7446	1298.7446	M	E	2	14
PSM	DALEIYVDDEK	366	sp|P08874|ABRB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17440	52.403	2	1308.6085	1308.6085	K	I	34	45
PSM	DATFGIYENTDK	367	sp|P54941|YXEB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15087	48.133	2	1372.6147	1372.6147	K	G	185	197
PSM	DDTTVTDEDVQNELK	368	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13476	45.199	3	1720.7639	1720.7639	K	A	129	144
PSM	DDVYTSIHIEEYESEAR	369	sp|P37870|RPOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18270	53.884	3	2054.9069	2054.9069	K	D	784	801
PSM	DGSLVSEIVSDHENR	370	sp|P40750|PBPD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18746	54.77	2	1655.7751	1655.7751	R	V	62	77
PSM	DGVILNDESLELLAQTAVSQAK	371	sp|P30950|HEM2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=31243	78.931	3	2313.2064	2313.2064	K	A	135	157
PSM	DGVLTESGSHSFAPGAGPR	372	sp|O34499|6PGL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12566	43.49	3	1840.8704	1840.8704	K	H	177	196
PSM	DKLEEWIEMSNR	373	sp|P80870|GS13_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20842	58.569	2	1548.7242	1548.7242	K	K	113	125
PSM	DLPDGATIILTNNVAEQGR	374	sp|O32167|METQ_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22414	61.42	3	1996.0225	1996.0225	K	M	126	145
PSM	DLPLEEVDINTPVQAAK	375	sp|P39149|UPP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22136	60.919	2	1850.9626	1850.9626	R	S	47	64
PSM	DSVGDDQYEIFK	376	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18085	53.555	2	1414.6252	1414.6252	K	S	99	111
PSM	DVSYMDSTGLGVFVGTFK	377	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30134	76.568	3	2017.8744	2017.8744	K	M	50	68
PSM	EATVLELNDLVK	378	sp|P02394|RL7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22403	61.401	2	1342.7344	1342.7344	K	A	14	26
PSM	EGTDLSIITYGAMVHESLK	379	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23982	64.37	3	2063.0245	2063.0245	R	A	201	220
PSM	ELAESGIHFIGTGVSGGEEGALK	380	sp|P80859|6PGD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19478	56.103	3	2257.1226	2257.1226	K	G	114	137
PSM	GITISTAHVEYETETR	381	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13335	44.936	3	1805.8796	1805.8796	R	H	61	77
PSM	HDHMINTESANIIYNEVETDDK	382	sp|O32232|EST_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:35	ms_run[2]:scan=16604	50.882	4	2603.1446	2603.1446	R	Q	191	213
PSM	KDEETGKPLVDVILDK	383	sp|P80859|6PGD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19122	55.47	3	1797.9724	1797.9724	K	A	241	257
PSM	KITTNEQFNELIQSDK	384	sp|P96611|YDBP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15946	49.679	3	1906.9636	1906.9636	K	E	3	19
PSM	LANEILDAANNTGAAVK	385	sp|P21469|RS7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16849	51.325	3	1683.8792	1683.8792	R	K	120	137
PSM	MQEASNGKDTMTGHWEIMGLYIDK	386	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=18802	54.877	4	2882.1962	2882.1962	K	P	78	102
PSM	NDAYKQEELDQIVDDVK	387	sp|P13714|LDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19442	56.039	2	2020.9589	2020.9589	K	N	203	220
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	388	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24419	65.192	3	3676.4932	3676.4932	K	R	107	145
PSM	NITIVDDQGNEQLCEVLFTFENEEFGK	389	sp|O34828|YRZB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:4	ms_run[2]:scan=33213	83.041	3	3187.4656	3187.4656	K	S	7	34
PSM	NMSIEQQAEQVDK	390	sp|P21879|IMDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:35	ms_run[2]:scan=9612	38.035	2	1534.6933	1534.6933	K	V	75	88
PSM	NSLIEAVCELDEELMDK	391	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=33088	82.82	3	2022.9126	2022.9126	R	Y	212	229
PSM	QVVSAATACIPFLENDDSNR	392	sp|P37870|RPOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4	ms_run[2]:scan=23393	63.259	2	2206.0324	2206.0324	K	A	617	637
PSM	RLQEQSLQSEPHQYVPLYDIQSQADQPK	393	sp|Q08787|SRFAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17052	51.69	4	3324.6375	3324.6375	K	L	320	348
PSM	SEYYSEGTVPLHTLR	394	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14512	47.086	3	1750.8526	1750.8526	R	A	164	179
PSM	STALLPLVGDIDTERAK	395	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	13-UNIMOD:21	ms_run[2]:scan=26081	68.389	3	1877.95	1877.9500	K	F	174	191
PSM	THESDTGSPEVQIAILTDSINNLNEHLR	396	sp|P21473|RS15_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=28715	73.704	4	3102.5218	3102.5218	K	T	17	45
PSM	TRDEFEQMIADNK	397	sp|O34328|KGUA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15415	48.729	3	1595.725	1595.7250	K	L	58	71
PSM	TTLTAAITTVLHK	398	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21676	60.085	2	1368.7977	1368.7977	K	K	26	39
PSM	VGDEVEIIGLQEENKK	399	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15555	48.981	3	1798.9313	1798.9313	K	T	240	256
PSM	VPTPNVSLVDLVAELNQEVTAEEVNAALK	400	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=33447	83.447	4	3061.6183	3061.6183	R	E	234	263
PSM	VQLVGDDLFVTNTK	401	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21374	59.543	2	1547.8195	1547.8195	K	K	309	323
PSM	VTVELSPYDLTR	402	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21	ms_run[2]:scan=20677	58.274	2	1471.696	1471.6960	K	G	53	65
PSM	YDAANHDVISNASCTTNCLAPFAK	403	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=17626	52.732	3	2639.1744	2639.1744	K	V	139	163
PSM	YTGLEGDVLGIDR	404	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20459	57.87	2	1406.7042	1406.7042	K	F	624	637
PSM	RPNTDELGLEQVGIEMTDR	405	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:35	ms_run[1]:scan=16498	50.689259	3	2188.044775	2188.043011	R	G	276	295
PSM	QAIQSTTIAGETVIVSIWEK	406	sp|O34788|BDHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28	ms_run[1]:scan=33214	83.041905	3	2156.1386	2156.1360	R	G	252	272
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	407	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=10822	40.288762	7	4285.1682	4285.1657	K	Q	35	77
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	408	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:35	ms_run[1]:scan=11904	42.268614	5	4157.072905	4157.071239	K	Q	36	77
PSM	MQEASNGKDTMTGHWEIMGLYIDK	409	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19670	56.449327	3	2883.183343	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	410	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=24195	64.777161	3	2867.187985	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	411	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=24248	64.870073	4	2850.204863	2850.206404	K	P	78	102
PSM	NGEFIDVTNEDLK	412	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19522	56.179632	2	1493.689794	1492.704553	K	G	18	31
PSM	NGEFIDVTNEDLK	413	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19812	56.703321	2	1493.689794	1492.704553	K	G	18	31
PSM	DVDYVVEDGQVVIVDSFTGR	414	sp|P28366|SECA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=26951	70.1029	3	2212.098134	2211.069543	K	L	303	323
PSM	NADLGLAFDGDGDR	415	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17483	52.481252	2	1434.639745	1434.637536	K	L	232	246
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	416	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=28283	72.826009	3	3677.476024	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	417	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24696	65.724778	4	3677.478235	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	418	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20319	57.615748	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	419	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21385	59.561698	4	3677.478264	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	420	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24950	66.201223	3	3677.476689	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	421	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19467	56.08453	4	3677.480622	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	422	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=29630	75.528047	4	3677.479897	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	423	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=32757	82.142043	4	3677.478819	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	424	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=31562	79.59547	4	3677.479135	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	425	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=23052	62.602126	3	3677.476555	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	426	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=26787	69.777922	3	3677.476390	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	427	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=29375	75.013531	4	3677.479897	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	428	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=28793	73.855039	3	3677.476952	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	429	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=28037	72.319547	3	3677.476024	3676.493232	K	R	107	145
PSM	ESQSSTGIGEGIAIPHAK	430	sp|P71012|PTF3A_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=14714	47.444218	3	1860.863173	1860.861873	R	T	52	70
PSM	LSGEALAGEQGNGINPTVIQSIAK	431	sp|O31749|PYRH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=23186	62.844953	3	2446.213368	2446.210485	K	Q	13	37
PSM	NGGNNDTGWENPEFK	432	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16624	50.917172	2	1679.676669	1677.701927	K	K	464	479
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	433	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=33551	83.629567	3	3374.749794	3374.744849	K	A	144	174
PSM	ADIDYATSEADTTYGK	434	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11788	42.058	2	1719.7475	1719.7475	R	L	179	195
PSM	AIEEVAAGASEQASEVETINEK	435	sp|P54576|MCPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16950	51.507	3	2274.0863	2274.0863	K	S	383	405
PSM	AIRDEFEPIGLNTLNNNGEK	436	sp|O07513|HIT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19365	55.901	3	2243.1182	2243.1182	R	A	74	94
PSM	AREDFHVGNLYFNR	437	sp|P39634|ROCA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17447	52.416	3	1736.8383	1736.8383	R	G	459	473
PSM	AVDSVFDTILDALK	438	sp|P08821|DBH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=33437	83.429	3	1505.7977	1505.7977	K	N	24	38
PSM	CQSNQIVSHFLSHR	439	sp|O34334|YJOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=15243	48.411	3	1711.8213	1711.8213	M	N	2	16
PSM	DDAEDTDIKDNDWIECFNR	440	sp|P42175|NARG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	16-UNIMOD:4	ms_run[2]:scan=22489	61.562	3	2369.9706	2369.9706	K	N	1115	1134
PSM	DDQNVGVIVLAGAGDK	441	sp|P23966|MENB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19055	55.35	2	1569.7999	1569.7999	R	A	52	68
PSM	DDSSAFGAYLHMGGR	442	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20472	57.892	2	1582.6834	1582.6834	K	I	147	162
PSM	DLPDALFIIDPR	443	sp|P21464|RS2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=29926	76.13	2	1383.7398	1383.7398	K	K	156	168
PSM	DQTPAHLSLSQELK	444	sp|O32165|SUFD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13975	46.113	3	1565.8049	1565.8049	R	D	97	111
PSM	DQTPAHLSLSQELK	445	sp|O32165|SUFD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14021	46.196	2	1565.8049	1565.8049	R	D	97	111
PSM	DRAEASNETIGLFGLLR	446	sp|O34633|YJLC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26629	69.472	3	1860.9694	1860.9694	K	M	96	113
PSM	DSIEFFVDGDK	447	sp|P39758|ABH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21596	59.936	2	1270.5717	1270.5717	K	I	32	43
PSM	DVLEMEVDER	448	sp|P80866|SUFC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:35	ms_run[2]:scan=12359	43.103	2	1249.5496	1249.5496	K	A	70	80
PSM	FHALTSHDEITYAHGALK	449	sp|P07343|FUMC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12540	43.443	3	2009.9959	2009.9959	K	A	263	281
PSM	FQLATGQLENTAR	450	sp|P12873|RL29_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15349	48.611	2	1447.7419	1447.7419	R	I	30	43
PSM	GAEITISASGADENDALNALEETMK	451	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	24-UNIMOD:35	ms_run[2]:scan=22543	61.664	3	2565.1752	2565.1752	K	S	58	83
PSM	GITISTAHVEYETETR	452	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13347	44.956	2	1805.8796	1805.8796	R	H	61	77
PSM	HTSQPADDTLDIPTFLR	453	sp|P17865|FTSZ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=24800	65.92	3	2005.9146	2005.9146	R	N	360	377
PSM	IREYAAGENAEVIVVCAK	454	sp|P37518|YCHF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	16-UNIMOD:4	ms_run[2]:scan=14307	46.71	3	1991.0146	1991.0146	K	I	225	243
PSM	ITTNEQFNELIQSDK	455	sp|P96611|YDBP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18443	54.196	2	1778.8687	1778.8687	K	E	4	19
PSM	KFGSPLITNDGVTIAK	456	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16486	50.665	3	1659.9196	1659.9196	K	E	42	58
PSM	KIPFFVGGSADLAGSNK	457	sp|P45694|TKT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19131	55.486	3	1706.8992	1706.8992	K	T	370	387
PSM	MQEASNGKDTMTGHWEIMGLYIDK	458	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23227	62.921	3	2850.2064	2850.2064	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	459	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=31726	79.938	3	3676.4932	3676.4932	K	R	107	145
PSM	NNEHLDILSNIAIICSEEENIER	460	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	15-UNIMOD:4	ms_run[2]:scan=27933	72.097	3	2724.3025	2724.3025	K	L	103	126
PSM	RDDQPIGVIPIDSIYTPVSR	461	sp|P20429|RPOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23305	63.078	3	2240.1801	2240.1801	K	V	156	176
PSM	RGMMTTVHSYTNDQQILDLPHK	462	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:35	ms_run[2]:scan=13947	46.063	4	2600.2475	2600.2475	K	D	172	194
PSM	RGMMTTVHSYTNDQQILDLPHK	463	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15905	49.607	4	2584.2526	2584.2526	K	D	172	194
PSM	SEQDIVEDLNSVAAQLIEQER	464	sp|P37570|MCSB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=33322	83.231	3	2385.166	2385.1660	K	S	232	253
PSM	SGGGVRPGFEGGQMPLFQR	465	sp|P19946|RL15_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18380	54.078	3	1975.9687	1975.9687	R	L	42	61
PSM	SYPAKPINWAER	466	sp|P39789|YPOC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:21	ms_run[2]:scan=14302	46.703	2	1510.697	1510.6970	K	V	117	129
PSM	TLEEGQAVSFEIVEGNR	467	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20588	58.109	3	1876.9167	1876.9167	K	G	40	57
PSM	TPDDLEAFNR	468	sp|O06006|YRAA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13505	45.25	2	1176.5411	1176.5411	R	E	153	163
PSM	TPINEDGTVEIITEGSEEGLQIMR	469	sp|P18255|SYT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=28445	73.143	3	2630.2745	2630.2745	R	H	52	76
PSM	VAEEIIFGEVSTGAHNDFQR	470	sp|P37476|FTSH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20722	58.352	3	2218.0655	2218.0655	R	A	483	503
PSM	VTVELSPYDLTR	471	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:21	ms_run[2]:scan=20395	57.755	2	1471.696	1471.6960	K	G	53	65
PSM	LEHTINNLSASGENLTAAESR	472	sp|P02968|FLA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13445	45.144602	3	2226.090491	2226.087653	R	I	242	263
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	473	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=11704	41.906091	6	5133.5852	5133.5797	K	I	35	84
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	474	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:35	ms_run[1]:scan=13826	45.836046	4	4158.101109	4157.071239	K	Q	36	77
PSM	MQEASNGKDTMTGHWEIMGLYIDK	475	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20236	57.470374	3	2883.183343	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	476	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:35,5-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=18850	54.966566	4	2948.2542	2946.1672	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	477	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=25356	66.970027	3	2851.192301	2850.206404	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	478	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20227	57.454127	4	2883.182985	2882.196234	K	P	78	102
PSM	GDYENLSDDALK	479	sp|P28366|SECA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13284	44.841985	2	1338.594721	1338.593940	R	H	31	43
PSM	DINEHLSVGDEVQVK	480	sp|P80870|GS13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13825	45.834648	3	1680.833077	1680.831879	K	V	47	62
PSM	QETHLPVFVDVTHSTGR	481	sp|P39912|AROG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=19587	56.292606	3	1904.9416	1904.9376	K	R	284	301
PSM	TLEEGQAVSFEIVEGNR	482	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21697	60.121987	2	1877.913796	1876.916671	K	G	40	57
PSM	QIVEAVGGAENIAAATHCVTR	483	sp|P39794|PTTBC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,18-UNIMOD:4	ms_run[1]:scan=23636	63.725503	3	2149.0607	2149.0581	R	L	10	31
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	484	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33474	83.495889	3	3677.476529	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	485	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33576	83.675944	4	3676.479120	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	486	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22809	62.13913	4	3677.478321	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	487	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26296	68.8124	4	3677.479049	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	488	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25520	67.277759	4	3677.478235	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	489	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22239	61.104511	4	3677.478321	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	490	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25233	66.741629	4	3677.478235	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	491	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23076	62.646893	4	3676.479134	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	492	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=29555	75.376723	3	3677.476723	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	493	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25752	67.72803	3	3677.476685	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	494	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21351	59.499334	3	3677.475855	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	495	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24144	64.682827	3	3677.476216	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	496	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22775	62.080445	3	3677.476737	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	497	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27040	70.281869	3	3677.476024	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	498	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26525	69.263759	3	3677.476390	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	499	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=20785	58.466768	3	3677.476417	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	500	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=31240	78.923431	3	3677.476035	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	501	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22206	61.047277	3	3677.475630	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	502	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21641	60.017895	3	3677.475376	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	503	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26008	68.24226	3	3677.476685	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	504	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=30773	77.912074	3	3677.477169	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	505	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=30127	76.549942	4	3677.479897	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	506	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19753	56.598793	4	3678.471430	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	507	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=31807	80.104407	4	3677.479678	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	508	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=20829	58.543122	4	3677.477588	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	509	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27627	71.464238	4	3677.478123	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	510	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25490	67.21997	3	3677.476689	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	511	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=29876	76.036147	4	3677.479897	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	512	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21954	60.590234	4	3677.478321	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	513	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33003	82.653524	4	3677.478819	3676.493232	K	R	107	145
PSM	NGTDSLVVAGTTGESPTLSTEEK	514	sp|Q04796|DAPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17111	51.79843	3	2293.081430	2292.096880	K	I	35	58
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	515	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	28-UNIMOD:21	ms_run[1]:scan=33466	83.480962	3	3557.884547	3557.882011	K	R	144	176
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	516	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	28-UNIMOD:21	ms_run[1]:scan=33679	83.86096	4	3358.759969	3358.749934	K	A	144	174
PSM	STALLPLVGDIDTERAK	517	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=25015	66.322239	3	1878.955496	1877.949960	K	F	174	191
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	518	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33750	83.998437	3	3679.480265	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	519	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=29131	74.513968	2	1678.819197	1678.817883	K	A	174	189
PSM	MQEASNGKDTMTGHWEIMGLYIDK	520	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=16081	49.926118	4	2965.234300	2962.162565	K	P	78	102
PSM	AAAENIIPTSTGAAK	521	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:21	ms_run[2]:scan=12291	42.979	2	1493.7127	1493.7127	R	A	200	215
PSM	APAIFVVQNNR	522	sp|P21881|ODPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14853	47.706	2	1227.6724	1227.6724	K	Y	196	207
PSM	ARGDANPILLIDEDDVTAGHAASVGR	523	sp|O32165|SUFD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19455	56.06	4	2632.3205	2632.3205	K	V	359	385
PSM	CDMVDDEELLELVEMEVR	524	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=31478	79.409	3	2254.9644	2254.9644	K	D	139	157
PSM	DDSSAFGAYLHMGGR	525	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:35	ms_run[2]:scan=16369	50.446	3	1598.6784	1598.6784	K	I	147	162
PSM	DGFYQIVNVQSDAAAVQEFDR	526	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=28730	73.732	3	2371.1081	2371.1081	R	L	57	78
PSM	DHHIIFDPFLTGNSLTDIKPEDVK	527	sp|Q795U4|YTKL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24425	65.201	4	2750.3915	2750.3915	K	A	17	41
PSM	DIFPAVLSLMK	528	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:35	ms_run[2]:scan=26011	68.246	2	1248.6788	1248.6788	R	E	295	306
PSM	DIGGQSTTAEVTDEICSR	529	sp|P42958|TTUC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	16-UNIMOD:4	ms_run[2]:scan=16105	49.967	2	1937.8636	1937.8636	R	L	333	351
PSM	DLFETVLNVEK	530	sp|P80860|G6PI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26880	69.961	2	1305.6816	1305.6816	R	P	323	334
PSM	DLLSEYDFPGDDVPVVK	531	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26899	69.999	3	1906.92	1906.9200	R	G	157	174
PSM	DMEAGVENAYYHSIANR	532	sp|Q03523|MURE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=14573	47.191	3	1954.8479	1954.8479	R	E	421	438
PSM	DQFFEQNEVK	533	sp|P16263|ODO2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13362	44.984	2	1282.583	1282.5830	K	L	233	243
PSM	DVSYMDSTGLGVFVGTFK	534	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21	ms_run[2]:scan=32718	82.048	2	2001.8795	2001.8795	K	M	50	68
PSM	EAEAAGADFVGDTDYINK	535	sp|Q06797|RL1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16768	51.182	3	1884.8378	1884.8378	K	I	86	104
PSM	ELPGVAALNDK	536	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15347	48.604	2	1125.603	1125.6030	K	-	384	395
PSM	ELYQATAIYSANAAAIAIAEIVAGSETK	537	sp|P08750|DACA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=33496	83.534	3	2838.4651	2838.4651	K	F	122	150
PSM	ERTGNDAMEVFEQALK	538	sp|P21469|RS7_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:35	ms_run[2]:scan=18086	53.557	3	1852.8625	1852.8625	K	N	52	68
PSM	GLIQQMTDEEGLNK	539	sp|P22326|SYY1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19240	55.675	2	1574.761	1574.7610	R	Q	12	26
PSM	IDVQDLDCDFFALSSHK	540	sp|O32164|SUFS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:4	ms_run[2]:scan=27152	70.508	3	2008.92	2008.9200	K	M	208	225
PSM	IINQSNHHSEGDYIALYDEQVNDQK	541	sp|O32090|PNCB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15391	48.688	4	2929.3478	2929.3478	R	R	368	393
PSM	INYDLANDLGNLLNR	542	sp|P37465|SYM_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=28110	72.474	2	1716.8795	1716.8795	R	T	359	374
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	543	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:35	ms_run[2]:scan=10777	40.209	5	4285.1662	4285.1662	K	Q	35	77
PSM	KPLFIFLSQSGETADSR	544	sp|P0CI73|GLMS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21709	60.142	3	1894.9789	1894.9789	K	A	338	355
PSM	LTHTGDGYSLVDFNR	545	sp|O30509|GATB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16298	50.314	3	1693.806	1693.8060	K	Q	130	145
PSM	MKEPTLDEALEGQQQVTVER	546	sp|P96614|CSHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=15426	48.748	3	2316.1267	2316.1267	R	L	367	387
PSM	MQEASNGKDTMTGHWEIMGLYIDK	547	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23228	62.922	4	2850.2064	2850.2064	K	P	78	102
PSM	NEFVFNEFEHHETENK	548	sp|P96648|YDDK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16237	50.199	3	2048.8864	2048.8864	K	I	67	83
PSM	NKDDLQQIISAVR	549	sp|O06746|YITK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19996	57.031	2	1498.8104	1498.8104	K	G	137	150
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	550	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27337	70.901	3	2714.319	2714.3190	K	E	92	119
PSM	QAAITQEITEIVGGAAALE	551	sp|P37810|ATPG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=33281	83.158	3	1883.984	1883.9840	R	-	269	288
PSM	QAIQSTTIAGETVIVSIWEK	552	sp|O34788|BDHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27930	72.093	3	2173.163	2173.1630	R	G	252	272
PSM	QVVSAATACIPFLENDDSNR	553	sp|P37870|RPOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:4	ms_run[2]:scan=23211	62.891	3	2206.0324	2206.0324	K	A	617	637
PSM	RADLDAQLVADNIAR	554	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16558	50.795	3	1639.8642	1639.8642	K	Q	107	122
PSM	SGTTTEPAIAFR	555	sp|P80860|G6PI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:21	ms_run[2]:scan=15184	48.306	2	1329.5966	1329.5966	K	I	145	157
PSM	SLEEGQEVSFEIVEGNR	556	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20516	57.979	3	1920.9065	1920.9065	K	G	40	57
PSM	SLEEGQEVSFEIVEGNR	557	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22020	60.705	2	1920.9065	1920.9065	K	G	40	57
PSM	SLLEEDKIELAK	558	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15733	49.304	2	1386.7606	1386.7606	K	S	236	248
PSM	STALLPLVGDIDTER	559	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=28889	74.035	2	1678.8179	1678.8179	K	A	174	189
PSM	SVVSTLVQDQLTK	560	sp|P71066|YVFG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=25671	67.574	2	1496.7487	1496.7487	R	N	36	49
PSM	TASGIVLPDSAK	561	sp|P28599|CH10_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=13597	45.42	2	1237.5955	1237.5955	K	E	20	32
PSM	TEAQVQSTAEAGQDVAKEEQAQEPAK	562	sp|P21883|ODP2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11403	41.359	3	2742.2944	2742.2944	K	A	97	123
PSM	TGNDAMEVFEQALK	563	sp|P21469|RS7_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=20067	57.16	2	1567.7188	1567.7188	R	N	54	68
PSM	TGNDAMEVFEQALK	564	sp|P21469|RS7_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=20480	57.906	2	1567.7188	1567.7188	R	N	54	68
PSM	THADDYKPEDLQNISSSIAK	565	sp|O07513|HIT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15089	48.136	4	2231.0706	2231.0706	K	R	121	141
PSM	TLEEGQAVSFEIVEGNR	566	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21415	59.615	2	1876.9167	1876.9167	K	G	40	57
PSM	TNRLIIIDEANPR	567	sp|O34591|ACOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14338	46.769	3	1523.842	1523.8420	K	C	266	279
PSM	VEICSECHPFYTGR	568	sp|Q03223|RL31_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=13006	44.324	3	1753.7552	1753.7552	R	Q	33	47
PSM	VEIFSAGEIVDVTGVSK	569	sp|P42920|RL3_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24220	64.82	2	1748.9196	1748.9196	K	G	99	116
PSM	WNLSGSASLK	570	sp|O31646|MANA1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=16518	50.725	2	1141.5169	1141.5169	K	Q	252	262
PSM	TIEVSAERDPAKLSWGK	571	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=15076	48.113978	3	1965.958096	1965.956108	K	Q	71	88
PSM	NSSTIDALSTMVMEGSMVK	572	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:35	ms_run[1]:scan=26697	69.601196	3	2015.922349	2015.921365	K	V	290	309
PSM	QAGIAANVVAEINDR	573	sp|P21882|ODPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=19929	56.911304	2	1539.802240	1539.800519	K	A	266	281
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	574	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13392	45.045398	4	4271.152126	4269.171287	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	575	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=11602	41.721577	4	4286.155564	4285.166202	K	Q	35	77
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	576	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35	ms_run[1]:scan=12353	43.095038	4	4158.061501	4157.071239	K	Q	36	77
PSM	NSLIEAVCELDEELMDK	577	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=33375	83.323354	3	2023.899403	2022.912574	R	Y	212	229
PSM	MQEASNGKDTMTGHWEIMGLYIDK	578	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=19956	56.96042	3	2883.183343	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	579	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=24262	64.897221	3	2852.198236	2850.206404	K	P	78	102
PSM	SDTDTEVVVQVIEQFVNGGLETEEAFRK	580	sp|P0CI73|GLMS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=33361	83.296253	3	3139.521319	3138.535704	K	T	120	148
PSM	GMTTSDFAEITTDKPEK	581	sp|P42919|RL2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35	ms_run[1]:scan=12009	42.460087	3	1885.860442	1885.861525	R	S	15	32
PSM	MIAPVLEELDQEMGDK	582	sp|P14949|THIO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35	ms_run[1]:scan=26780	69.76438	2	1832.854392	1832.853603	K	L	34	50
PSM	NGGNNDTGWENPEFK	583	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15780	49.384198	2	1678.687585	1677.701927	K	K	464	479
PSM	DVEFVEDSKQGIIR	584	sp|P12879|RS8_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=16813	51.259734	3	1713.798580	1713.797482	R	V	48	62
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	585	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=29305	74.865867	3	3677.476952	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	586	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=25214	66.707493	3	3677.476689	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	587	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=27544	71.29877	3	3677.476024	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	588	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21106	59.052948	4	3677.477588	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	589	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=30709	77.770629	2	2017.876468	2017.874412	K	M	50	68
PSM	SLEEGQEVSFEIVEGNR	590	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=22298	61.209271	2	1920.906665	1920.906501	K	G	40	57
PSM	TITKDKLSGSIHSVGEK	591	sp|P94524|ARAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	3-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=21202	59.224433	2	2040.8472	2038.8772	K	A	229	246
PSM	GALLSESGFK	592	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=17693	52.851617	2	1087.496309	1087.495092	R	Q	535	545
PSM	QLNAYGGIVVTASHNPPEYNGYK	593	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=18882	55.026013	3	2572.168945	2571.179519	R	V	134	157
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	594	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=33333	83.24958	3	3573.879206	3573.876926	K	R	144	176
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	595	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=23343	63.154084	4	3679.481583	3676.493232	K	R	107	145
PSM	AAVEEGIVSGGGTALVNVYNK	596	sp|P28598|CH60_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19476	56.101	2	2047.0586	2047.0586	R	V	403	424
PSM	AEELGAIIVDPSK	597	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17952	53.309	2	1340.7187	1340.7187	K	T	209	222
PSM	AIDSAVEELTFIAGQK	598	sp|P12877|RL5_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26364	68.946	3	1690.8778	1690.8778	K	P	49	65
PSM	ALVPSGASTGEYEAVELR	599	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18082	53.551	2	1847.9265	1847.9265	R	D	35	53
PSM	AVSFGEVLQDDFK	600	sp|P39148|GLYA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24533	65.421	2	1453.7089	1453.7089	K	T	267	280
PSM	DADQVNQAVAQVK	601	sp|P14802|YOXD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10135	39.02	2	1384.6947	1384.6947	K	E	66	79
PSM	DELDQALDVIEK	602	sp|O31777|BIOF1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24682	65.698	2	1386.6878	1386.6878	K	T	373	385
PSM	DFATSELEDNPAYQYAVVR	603	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24617	65.577	3	2187.012	2187.0120	K	N	239	258
PSM	DGDVLVLENVR	604	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18735	54.751	2	1227.6459	1227.6459	K	F	108	119
PSM	DGFYQIVNVQSDAAAVQEFDR	605	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=27981	72.203	3	2371.1081	2371.1081	R	L	57	78
PSM	DGGDCELVDVDEGIVK	606	sp|O32119|YUTI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4	ms_run[2]:scan=19217	55.636	2	1718.7669	1718.7669	R	L	57	73
PSM	DILVIGFDGNK	607	sp|P36949|RBSB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22064	60.781	2	1189.6343	1189.6343	K	D	242	253
PSM	DLDEEDPKEIEASK	608	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9072	36.977	3	1616.7417	1616.7417	R	Y	234	248
PSM	DNDWIECFNR	609	sp|P42175|NARG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=21523	59.808	2	1367.5564	1367.5564	K	N	1124	1134
PSM	DQNIEYKPSQIIVCTGAK	610	sp|P53001|AAT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	14-UNIMOD:4	ms_run[2]:scan=15197	48.331	3	2063.0357	2063.0357	R	H	83	101
PSM	DSAAELFENR	611	sp|P50842|KDUD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15249	48.423	2	1150.5255	1150.5255	K	Q	77	87
PSM	DVEDVVATILNR	612	sp|Q03224|GLPX_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=30985	78.369	3	1342.7092	1342.7092	K	E	153	165
PSM	DVSYMDSTGLGVFVGTFK	613	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=29827	75.937	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	614	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=32212	80.975	2	2017.8744	2017.8744	K	M	50	68
PSM	EFALGATHEEVITSLVR	615	sp|O31755|SYP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21759	60.235	3	1870.9789	1870.9789	R	D	103	120
PSM	EQDLSIELTDAAK	616	sp|P37571|CLPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=18301	53.938	2	1511.6756	1511.6756	K	A	736	749
PSM	EQLIFPEIDYDK	617	sp|P12877|RL5_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23045	62.589	2	1508.7399	1508.7399	K	V	134	146
PSM	GALLSESGFK	618	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:21	ms_run[2]:scan=17625	52.731	2	1087.4951	1087.4951	R	Q	535	545
PSM	GITISTAHVEYETETR	619	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14027	46.208	3	1805.8796	1805.8796	R	H	61	77
PSM	GSSLASRASSGEVLNGLAK	620	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13970	46.106	3	1802.9486	1802.9486	K	K	351	370
PSM	GVEERPDGVTVTFEVK	621	sp|P21880|DLDH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15779	49.383	3	1760.8945	1760.8945	K	G	243	259
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	622	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13823	45.832	5	4141.0763	4141.0763	K	Q	36	77
PSM	HHSDVDIYIAALDEK	623	sp|P39149|UPP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18046	53.482	3	1724.837	1724.8370	K	L	173	188
PSM	IGETHEGASQMDWMEQEQER	624	sp|P80868|EFG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14957	47.899	3	2389.9903	2389.9903	K	G	40	60
PSM	KGDSVVTIGGLHGTVDSIDESK	625	sp|O32052|YRBF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15458	48.804	4	2213.1176	2213.1176	K	V	43	65
PSM	KKPLEELELDDLDLDEEDAEPK	626	sp|P94550|ETFB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20952	58.782	4	2582.2487	2582.2487	K	L	196	218
PSM	LAMDAASSEFYNK	627	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:35	ms_run[2]:scan=10616	39.92	2	1461.6446	1461.6446	K	E	239	252
PSM	LNFDSNALYR	628	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=19026	55.298	2	1291.5598	1291.5598	K	Q	216	226
PSM	MPEEAIQEIAVSSSEEQEQHHHQNEVQQRPK	629	sp|P28264|FTSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=11989	42.425	6	3667.6921	3667.6921	K	G	386	417
PSM	MQEASNGKDTMTGHWEIMGLYIDK	630	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=23110	62.709	3	2866.2013	2866.2013	K	P	78	102
PSM	NEDVTIVMGVNEDQFDAER	631	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21127	59.09	3	2179.9692	2179.9692	K	H	125	144
PSM	NFDVLDEETGLADR	632	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20813	58.513	2	1592.7318	1592.7318	R	G	107	121
PSM	NFDVLDEETGLADR	633	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21593	59.932	2	1592.7318	1592.7318	R	G	107	121
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	634	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=31976	80.45	3	3676.4932	3676.4932	K	R	107	145
PSM	NGGNNDTGWENPEFK	635	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13785	45.76	2	1677.7019	1677.7019	K	K	464	479
PSM	NGIYIIDLQK	636	sp|P21464|RS2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20443	57.84	2	1175.655	1175.6550	R	T	36	46
PSM	NMSIEQQAEQVDK	637	sp|P21879|IMDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12375	43.133	2	1518.6984	1518.6984	K	V	75	88
PSM	NNEHLDILSNIAIICSEEENIER	638	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	15-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=28580	73.429	3	2804.2688	2804.2688	K	L	103	126
PSM	NVGVPYIVVFLNK	639	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=28533	73.324	2	1460.8391	1460.8391	K	C	126	139
PSM	QAIQSTTIAGETVIVSIWEK	640	sp|O34788|BDHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=28182	72.613	3	2173.163	2173.1630	R	G	252	272
PSM	RAIEDHFDYSPELER	641	sp|Q05852|GTAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13954	46.072	3	1875.8751	1875.8751	K	N	62	77
PSM	SDQDTGNSFYQGLNDK	642	sp|O31605|PEPF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13466	45.181	2	1787.7598	1787.7598	R	A	148	164
PSM	SIMGVMSLGIAK	643	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:35,6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=16041	49.856	2	1317.6074	1317.6074	K	G	46	58
PSM	SIMGVMSLGIAK	644	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=21116	59.071	2	1301.6124	1301.6124	K	G	46	58
PSM	STALLPLVGDIDTER	645	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=28118	72.492	2	1678.8179	1678.8179	K	A	174	189
PSM	TCAVFGSGDTAYEFFCGAVDTLEAK	646	sp|O34589|FLAW_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=33052	82.75	3	2715.1833	2715.1833	K	I	85	110
PSM	TLEEGQAVSFEIVEGNR	647	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20868	58.616	3	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	648	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22824	62.168	2	1876.9167	1876.9167	K	G	40	57
PSM	TVDADYVLITVGR	649	sp|P21880|DLDH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21870	60.435	2	1420.7562	1420.7562	K	R	263	276
PSM	VAEHVLDEIGITSNK	650	sp|P39148|GLYA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16500	50.692	3	1623.8468	1623.8468	K	N	326	341
PSM	TTLTAAITTVLHK	651	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=24200	64.78416	2	1448.766061	1448.763997	K	K	26	39
PSM	GITISTAHVEYETETR	652	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14825	47.651337	3	1805.880270	1805.879558	R	H	61	77
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	653	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=19930	56.9127	3	2762.306257	2762.303737	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	654	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=21891	60.476214	3	2746.311794	2746.308822	K	E	92	119
PSM	AENLEVSDEEVDAELTK	655	sp|P80698|TIG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17448	52.417508	3	1889.875834	1889.874197	K	M	369	386
PSM	KVQLVGDDLFVTNTK	656	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18259	53.864843	3	1675.915663	1675.914486	K	K	308	323
PSM	NSQDGISLIQTAEGALTETHAILQR	657	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=33126	82.888176	3	2666.356375	2665.367122	K	V	65	90
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	658	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=11048	40.717686	5	4285.170398	4285.166202	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	659	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=11329	41.225636	6	5150.5682	5149.5742	K	I	35	84
PSM	NDLLITSVLSGNR	660	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=27676	71.557154	2	1401.747512	1400.762343	K	N	537	550
PSM	MQEASNGKDTMTGHWEIMGLYIDK	661	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=20396	57.756302	4	2866.199937	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	662	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=24174	64.740252	4	2867.187026	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	663	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=15238	48.403767	4	2964.2482	2962.1622	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	664	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=25330	66.922418	4	2851.192389	2850.206404	K	P	78	102
PSM	THADDYKPEDLQNISSSIAK	665	sp|O07513|HIT_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15131	48.213034	3	2233.111469	2231.070606	K	R	121	141
PSM	AMDAEAGVMISASHNPVQDNGIK	666	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=14822	47.647179	3	2467.044449	2466.055641	K	F	88	111
PSM	NGGNNDTGWENPEFKK	667	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12705	43.737197	3	1807.768728	1805.796891	K	L	464	480
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	668	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=36866	94.748263	4	3676.478052	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	669	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=34289	85.209556	4	3676.479537	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	670	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=31080	78.5776	4	3677.478804	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	671	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23615	63.688563	4	3676.478934	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	672	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=32438	81.45546	3	3677.476426	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	673	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20541	58.024621	4	3677.478870	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	674	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=22520	61.616661	4	3677.478321	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	675	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=21672	60.075974	4	3677.478321	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	676	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16935	51.482398	4	3678.472560	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	677	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=32952	82.55102	2	2002.884448	2001.879497	K	M	50	68
PSM	FQLATGQLENTAR	678	sp|P12873|RL29_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15382	48.671709	2	1447.742827	1447.741942	R	I	30	43
PSM	SYPAKPINWAER	679	sp|P39789|YPOC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=14246	46.602448	3	1510.697986	1510.696980	K	V	117	129
PSM	EAIQRYMGEHVNIISSGDETAR	680	sp|P94556|MURI1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=33478	83.501497	3	2492.210339	2491.176151	K	E	193	215
PSM	EGTVIKELIGAGQLDEK	681	sp|P96676|YDES_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=16416	50.533928	3	1798.9292	1798.9672	R	L	99	116
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	682	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	25-UNIMOD:21	ms_run[1]:scan=33682	83.865135	3	3358.752708	3358.749934	K	A	144	174
PSM	STALLPLVGDIDTERAK	683	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=25282	66.832636	3	1878.955496	1877.949960	K	F	174	191
PSM	MQEASNGKDTMTGHWEIMGLYIDK	684	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=18718	54.719736	4	2885.220620	2882.196234	K	P	78	102
PSM	AEIENNLEREEVVQGQTTAHQPQEGDDNKK	685	sp|P28366|SECA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10194	39.133	5	3405.6033	3405.6033	K	A	778	808
PSM	AGLNVGTNQLESHYLAGGNVDR	686	sp|P54466|YQFA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17036	51.664	3	2284.1196	2284.1196	K	V	69	91
PSM	AIHAGFTSVMIDASHHPFEENVATTAK	687	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18550	54.4	4	2880.3865	2880.3865	K	V	96	123
PSM	ALQAAGLEVTAIR	688	sp|P04969|RS11_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17432	52.387	2	1311.751	1311.7510	R	D	101	114
PSM	DADRLTFAGIEK	689	sp|P16263|ODO2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15517	48.913	2	1334.683	1334.6830	R	E	297	309
PSM	DDQNVGVIVLAGAGDK	690	sp|P23966|MENB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18778	54.829	2	1569.7999	1569.7999	R	A	52	68
PSM	DEETGKPLVDVILDK	691	sp|P80859|6PGD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22836	62.192	3	1669.8774	1669.8774	K	A	242	257
PSM	DGFLLAHNISSYSLTAVVK	692	sp|P54616|FABI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25852	67.924	3	2034.0786	2034.0786	R	A	113	132
PSM	DGFYQIVNVQSDAAAVQEFDR	693	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=28811	73.892	3	2371.1081	2371.1081	R	L	57	78
PSM	DGTVAHGGCTFCSAAGSGDFAGNR	694	sp|O35008|YTQA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=11917	42.29	3	2370.9706	2370.9706	R	T	46	70
PSM	DKLEEWIEMSNR	695	sp|P80870|GS13_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:35	ms_run[2]:scan=18733	54.748	3	1564.7192	1564.7192	K	K	113	125
PSM	DLGVDYCVIGHSER	696	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=15542	48.956	3	1618.741	1618.7410	K	R	85	99
PSM	DLGVDYCVIGHSER	697	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=15544	48.958	2	1618.741	1618.7410	K	R	85	99
PSM	DNDLVVNVSK	698	sp|O07631|BIPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11269	41.118	2	1101.5666	1101.5666	R	M	532	542
PSM	DRLENAIQQLINR	699	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25284	66.835	3	1581.8587	1581.8587	K	H	1095	1108
PSM	DSLQEFSNANR	700	sp|P54464|YQEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11016	40.658	2	1279.5793	1279.5793	K	L	63	74
PSM	DTSSETLFHTMDAAIR	701	sp|P96686|YDFI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=24791	65.903	3	1873.7917	1873.7917	K	G	104	120
PSM	DVSYMDSTGLGVFVGTFK	702	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=29793	75.857	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	703	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=31982	80.468	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	704	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=33188	82.998	3	2001.8795	2001.8795	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	705	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=33221	83.055	2	2001.8795	2001.8795	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	706	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=33518	83.572	2	2001.8795	2001.8795	K	M	50	68
PSM	EADGSIAALHSVNDLDVTK	707	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16881	51.385	3	1953.9643	1953.9643	K	F	183	202
PSM	EGIQLVSGGTDNHLILVDLR	708	sp|P39148|GLYA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24448	65.249	3	2148.1539	2148.1539	K	S	299	319
PSM	EQQAELSILHVGR	709	sp|P42297|YXIE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16579	50.836	3	1478.7841	1478.7841	K	E	28	41
PSM	EYETVFDDNK	710	sp|P09339|ACNA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12475	43.318	2	1258.5354	1258.5354	K	R	625	635
PSM	GDLGVEIPAEEVPLVQK	711	sp|P80885|KPYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22187	61.013	2	1791.9618	1791.9618	R	E	245	262
PSM	GILGYSEEPLVSGDYNGNK	712	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20539	58.022	2	2010.9535	2010.9535	K	N	271	290
PSM	GLAGLSEEQVAASVIAYEPIWAIGTGK	713	sp|P27876|TPIS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=32931	82.511	3	2729.4276	2729.4276	K	S	150	177
PSM	GMTTSDFAEITTDKPEK	714	sp|P42919|RL2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14808	47.62	3	1869.8666	1869.8666	R	S	15	32
PSM	HVDVEIINVK	715	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13701	45.608	2	1164.6503	1164.6503	K	Q	30	40
PSM	IATVGDAVNYIQNQQ	716	sp|P80643|ACP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21014	58.891	2	1632.8107	1632.8107	K	-	63	78
PSM	ILLVDKDDVDITNVNR	717	sp|O32037|TCDA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17769	52.983	3	1840.9894	1840.9894	R	Q	49	65
PSM	KPYVMVCVPSGITAVEER	718	sp|Q01465|MREB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35,7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=19948	56.945	3	2129.9891	2129.9891	R	A	100	118
PSM	KVQLVGDDLFVTNTK	719	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18296	53.928	2	1675.9145	1675.9145	K	K	308	323
PSM	LIVAVVQDQDSNR	720	sp|P37538|DARA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13506	45.251	2	1455.7682	1455.7682	K	L	3	16
PSM	LTGRDPEHIDVVEAYCR	721	sp|P09339|ACNA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	16-UNIMOD:4	ms_run[2]:scan=13189	44.656	3	2028.9687	2028.9687	R	S	336	353
PSM	LVEANVDVIVIDTAHGHSQGVLNTVTK	722	sp|P21879|IMDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21296	59.4	4	2828.5032	2828.5032	K	I	240	267
PSM	MQEASNGKDTMTGHWEIMGLYIDK	723	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=19092	55.416	3	2882.1962	2882.1962	K	P	78	102
PSM	NDENVLVFGEDVGVNGGVFR	724	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26679	69.565	3	2135.0283	2135.0283	K	A	20	40
PSM	NDLLITSVLSGNR	725	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24508	65.375	2	1400.7623	1400.7623	K	N	537	550
PSM	NGFEVVAEAENGAQAVEK	726	sp|P24072|CHEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20272	57.532	2	1860.8854	1860.8854	K	Y	25	43
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	727	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=36767	94.394	3	3676.4932	3676.4932	K	R	107	145
PSM	NLEEPQQLLETLADNLPEQE	728	sp|P45913|YQAP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=33291	83.176	3	2322.1227	2322.1227	K	-	290	310
PSM	QAIQSTTIAGETVIVSIWEK	729	sp|O34788|BDHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=28435	73.121	3	2173.163	2173.1630	R	G	252	272
PSM	QEVPEEEYTIELGK	730	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17364	52.259	2	1662.7988	1662.7988	R	A	182	196
PSM	SIMGVMSLGIAK	731	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=20835	58.551	2	1301.6124	1301.6124	K	G	46	58
PSM	STIFPQFIGHTIAVYDGR	732	sp|P21476|RS19_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25519	67.276	3	2021.0371	2021.0371	R	K	38	56
PSM	TEAQVQSTAEAGQDVAKEEQAQEPAK	733	sp|P21883|ODP2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11311	41.193	4	2742.2944	2742.2944	K	A	97	123
PSM	TLEEGQAVSFEIVEGNR	734	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22538	61.653	2	1876.9167	1876.9167	K	G	40	57
PSM	VEIFSAGEIVDVTGVSK	735	sp|P42920|RL3_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24229	64.836	3	1748.9196	1748.9196	K	G	99	116
PSM	VGDEVEIIGLQEENK	736	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18202	53.767	2	1670.8363	1670.8363	K	K	240	255
PSM	VTVELSPYDLTR	737	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:21	ms_run[2]:scan=20332	57.638	2	1471.696	1471.6960	K	G	53	65
PSM	YDGGHDFDLDSSVFLLDAAGK	738	sp|P80875|G16U_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26877	69.953	3	2241.0226	2241.0226	K	C	34	55
PSM	YRPQAPIVAVTVNDSISR	739	sp|P80885|KPYK_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16721	51.095	3	1985.0694	1985.0694	K	K	392	410
PSM	QAEPAAQEVSEEAQSEAK	740	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28	ms_run[1]:scan=14946	47.876294	3	1883.8387	1883.8380	K	S	102	120
PSM	DDAEDTDIKDNDWIECFNR	741	sp|P42175|NARG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:4	ms_run[1]:scan=21250	59.317557	3	2370.956204	2369.970634	K	N	1115	1134
PSM	DNDWIECFNR	742	sp|P42175|NARG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=21676	60.085322	2	1367.557295	1367.556449	K	N	1124	1134
PSM	YRPQAPIVAVTVNDSISR	743	sp|P80885|KPYK_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16726	51.101468	3	1985.071291	1985.069424	K	K	392	410
PSM	MIENEVQGVEYIAVNTDAQALNLSK	744	sp|P17865|FTSZ_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35	ms_run[1]:scan=26859	69.916798	3	2765.377053	2764.358926	R	A	30	55
PSM	DATFGIYENTDKGEFWVFNDNGGR	745	sp|P54941|YXEB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26780	69.76438	3	2753.277825	2751.220124	K	G	185	209
PSM	RDDQPIGVIPIDSIYTPVSR	746	sp|P20429|RPOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23288	63.043428	3	2240.181532	2240.180097	K	V	156	176
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	747	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32204	80.953215	3	3677.476426	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	748	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=24159	64.711437	4	3678.479412	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	749	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26549	69.319404	4	3677.479049	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	750	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32051	80.613144	4	3677.478819	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	751	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=33986	84.514301	3	3677.476886	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	752	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23889	64.202577	4	3678.479412	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	753	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=30057	76.392738	3	3677.476723	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	754	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32527	81.635914	4	3677.478819	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	755	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=27801	71.809597	3	3677.476024	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	756	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=27285	70.791669	3	3678.482323	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	757	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26038	68.302763	4	3677.478351	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	758	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=31316	79.081672	4	3677.479135	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	759	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=34066	84.689874	4	3677.481294	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	760	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=30610	77.557097	4	3677.478804	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	761	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=27882	71.985398	4	3677.478123	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	762	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=27364	70.953732	4	3677.478342	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	763	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26853	69.908459	4	3677.479049	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	764	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32678	81.962812	3	3677.476533	3676.493232	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	765	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=17339	52.216646	4	2571.177534	2571.179519	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	766	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=17622	52.726677	4	2571.177534	2571.179519	R	V	134	157
PSM	GKYDDNFPLVVWQTGSGTQSNMNMNEVVANR	767	sp|P07343|FUMC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:35,24-UNIMOD:35	ms_run[1]:scan=22413	61.418495	3	3502.591653	3502.588168	K	A	82	113
PSM	DKTSNITQLVADQSGQIMNK	768	sp|P40780|YTXH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=21473	59.714549	3	2270.061441	2270.061378	K	V	72	92
PSM	NGQVYDADRDTWTR	769	sp|O34348|YFMC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11915	42.287701	3	1696.746133	1695.760111	K	F	281	295
PSM	STALLPLVGDIDTER	770	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=33382	83.333079	2	1678.819558	1678.817883	K	A	174	189
PSM	STALLPLVGDIDTER	771	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=33679	83.86096	2	1678.824337	1678.817883	K	A	174	189
PSM	DVSYMDSTGLGVFVGTFK	772	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=35412	89.108944	2	2019.875706	2017.874412	K	M	50	68
PSM	SLEEGQEVSFEIVEGNR	773	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21150	59.133144	2	1920.909213	1920.906501	K	G	40	57
PSM	SLEEGQEVSFEIVEGNR	774	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21438	59.654348	2	1920.909213	1920.906501	K	G	40	57
PSM	KLEKNGDITEDELR	775	sp|P81101|RRF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=10787	40.227099	3	1740.8712	1738.8132	K	A	141	155
PSM	SFNANLDTLYR	776	sp|O32163|SUFU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=21132	59.100544	2	1392.6087	1392.6070	M	Q	2	13
PSM	EHAAGDVQIDNQSDQIALLAVQGPK	777	sp|P54378|GCST_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=20148	57.306117	3	2617.319998	2616.314359	K	A	126	151
PSM	GAELYLSPEFTEK	778	sp|P39759|YKQA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=12789	43.890855	3	1562.6552	1562.6902	R	L	254	267
PSM	AEVAMKTADGTKDGTGK	779	sp|O31526|YESW_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0	5-UNIMOD:35,7-UNIMOD:21,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=26415	69.043805	2	1936.7592	1934.7132	K	V	229	246
PSM	STALLPLVGDIDTER	780	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=36666	94.029842	2	1678.820050	1678.817883	K	A	174	189
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	781	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=27107	70.415329	4	3679.480572	3676.493232	K	R	107	145
PSM	MNKTELINAVAEASELSK	782	sp|P08821|DBH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=23316	63.097079	3	2042.960369	2042.959539	-	K	1	19
PSM	QLNAYGGIVVTASHNPPEYNGYK	783	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=19450	56.053299	3	2572.168945	2571.179519	R	V	134	157
PSM	MQEASNGKDTMTGHWEIMGLYIDK	784	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=22946	62.401352	4	2853.179391	2850.206404	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	785	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=33840	84.180307	4	3679.474657	3676.493232	K	R	107	145
PSM	AEELGAIIVDPSKTDDVVAEIAER	786	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=26274	68.77	3	2539.3017	2539.3017	K	T	209	233
PSM	AETALEVFASR	787	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=19448	56.047	2	1192.6088	1192.6088	R	I	296	307
PSM	AIDFLVENR	788	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=18564	54.431	2	1075.5662	1075.5662	K	-	416	425
PSM	DADLDLAASSIVYSAFGYSGQK	789	sp|P39634|ROCA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=31723	79.93	3	2277.0801	2277.0801	K	C	298	320
PSM	DAEIKPMVNQVEFHPR	790	sp|O32210|GR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	7-UNIMOD:35	ms_run[2]:scan=12053	42.537	3	1924.9465	1924.9465	K	L	154	170
PSM	DAVISLLADTNADQIEGDK	791	sp|P23452|FLIL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=24548	65.446	3	1986.9746	1986.9746	K	G	89	108
PSM	DDSSAFGAYLHMGGR	792	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	12-UNIMOD:35	ms_run[2]:scan=16385	50.476	2	1598.6784	1598.6784	K	I	147	162
PSM	DLTFYEADLLDR	793	sp|P55180|GALE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=26171	68.576	2	1469.7038	1469.7038	K	E	51	63
PSM	DSLTEDEELTVLSR	794	sp|P54464|YQEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20362	57.69	2	1605.7734	1605.7734	K	E	43	57
PSM	DTSSVLCELTAEDTK	795	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	7-UNIMOD:4	ms_run[2]:scan=21000	58.864	2	1667.756	1667.7560	K	H	3336	3351
PSM	DVEFVEDSK	796	sp|P12879|RS8_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=10535	39.772	2	1066.4819	1066.4819	R	Q	48	57
PSM	DVEFVEDSKQGIIR	797	sp|P12879|RS8_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	8-UNIMOD:21	ms_run[2]:scan=16798	51.235	3	1713.7975	1713.7975	R	V	48	62
PSM	DVSYMDSTGLGVFVGTFK	798	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=31503	79.462	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	799	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=31741	79.967	2	2017.8744	2017.8744	K	M	50	68
PSM	EAVDTLIVIPNDR	800	sp|P17865|FTSZ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20285	57.554	2	1453.7777	1453.7777	K	I	156	169
PSM	EIQDMIEEDGQAEAVCHFCNEK	801	sp|P37565|HSLO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	5-UNIMOD:35,16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=16899	51.413	3	2667.0887	2667.0887	K	Y	253	275
PSM	EIQVVSAIPDDFTDNSQGSAIHVTQDGR	802	sp|O34499|6PGL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=21254	59.323	3	2998.4268	2998.4268	R	F	230	258
PSM	EQDIMDVWFDSGSSHQAVLEER	803	sp|Q45477|SYI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=26042	68.312	3	2577.1442	2577.1442	K	D	520	542
PSM	ERTGNDAMEVFEQALK	804	sp|P21469|RS7_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=22958	62.426	3	1836.8676	1836.8676	K	N	52	68
PSM	GDANPILLIDEDDVTAGHAASVGR	805	sp|O32165|SUFD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=21668	60.067	3	2405.1823	2405.1823	R	V	361	385
PSM	GHDSIAVFEVNQYSGELAFVER	806	sp|O34499|6PGL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=25590	67.406	3	2466.1816	2466.1816	R	V	265	287
PSM	GITISTAHVEYETETR	807	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=14677	47.374	3	1805.8796	1805.8796	R	H	61	77
PSM	IGVLTVLNGTTDEETAK	808	sp|P80700|EFTS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20894	58.667	2	1759.9204	1759.9204	R	D	162	179
PSM	ITGTSNYEDTAGSDIVVITAGIAR	809	sp|P49814|MDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=24882	66.072	3	2423.218	2423.2180	K	K	64	88
PSM	ITGTSNYEDTAGSDIVVITAGIAR	810	sp|P49814|MDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=25441	67.127	3	2423.218	2423.2180	K	K	64	88
PSM	KHSKPTQANPQGGISNQEAPIHVSNVMPLDPK	811	sp|P0CI78|RL24_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=13835	45.852	5	3418.7416	3418.7416	K	T	43	75
PSM	KITNIQEILPVLEQVVQQGK	812	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=29919	76.116	3	2276.3104	2276.3104	K	P	224	244
PSM	LADSADHLYEALTYQDK	813	sp|O31605|PEPF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=19702	56.509	3	1951.9163	1951.9163	K	V	116	133
PSM	LLDYAEAGDNIGALLR	814	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=26779	69.763	2	1782.8553	1782.8553	K	G	267	283
PSM	LVETAANEVNGVILVDHNER	815	sp|P37487|PPAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=17270	52.087	3	2191.1233	2191.1233	R	Q	60	80
PSM	MREDDLLIITADHGNDPIHHGTDHTR	816	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	1-UNIMOD:35	ms_run[2]:scan=13498	45.237	6	2994.4002	2994.4002	K	E	318	344
PSM	MSGWLAHILEQYDNNR	817	sp|P39120|CISY2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=27146	70.492	2	1945.9105	1945.9105	R	L	334	350
PSM	NDAYKQEELDQIVDDVK	818	sp|P13714|LDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=19384	55.935	3	2020.9589	2020.9589	K	N	203	220
PSM	NDDWDHLLEYEVDAVFEEKE	819	sp|P71021|DIV4A_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=33239	83.084	3	2494.0812	2494.0812	K	-	145	165
PSM	NICVIGSCSMDLVVTSDK	820	sp|P36945|RBSK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=18015	53.423	2	2012.9217	2012.9217	R	R	3	21
PSM	NLDHESSLMDIINDHSSVDR	821	sp|O07621|HEMAT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20525	57.995	3	2296.039	2296.0390	K	L	72	92
PSM	NTQEVYVQGLSTSLPEDVQQR	822	sp|P25812|MNMG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=19780	56.648	3	2390.1714	2390.1714	R	M	303	324
PSM	QADGLALSGDEEPEETASADVER	823	sp|P37870|RPOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=15389	48.685	3	2388.0565	2388.0565	K	D	1165	1188
PSM	QIAELLQETPEDITDQEDLLDR	824	sp|P45743|DHBB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=27159	70.522	3	2583.2552	2583.2552	K	G	238	260
PSM	RGMTTSDFAEITTDKPEK	825	sp|P42919|RL2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=12925	44.181	3	2025.9677	2025.9677	R	S	14	32
PSM	SELESIDSPVIK	826	sp|P38021|OAT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=15634	49.121	2	1315.6871	1315.6871	K	E	324	336
PSM	SLNVALR	827	sp|P39126|IDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	1-UNIMOD:21	ms_run[2]:scan=13096	44.484	2	851.42662	851.4266	R	Q	104	111
PSM	SNTELELLR	828	sp|P39912|AROG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=19309	55.801	2	1153.538	1153.5380	M	Q	2	11
PSM	STALLPLVGDIDTER	829	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	13-UNIMOD:21	ms_run[2]:scan=28623	73.512	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	830	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	13-UNIMOD:21	ms_run[2]:scan=32990	82.627	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	831	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	13-UNIMOD:21	ms_run[2]:scan=33265	83.132	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	832	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	13-UNIMOD:21	ms_run[2]:scan=33959	84.461	2	1678.8179	1678.8179	K	A	174	189
PSM	SYDFAQSVATDEVLK	833	sp|O34633|YJLC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20510	57.963	2	1671.7992	1671.7992	K	S	52	67
PSM	THIENVYEFTDELAK	834	sp|O07513|HIT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=20570	58.076	3	1807.8628	1807.8628	K	Q	48	63
PSM	TLEEGQAVSFEIVEGNR	835	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=22162	60.967	3	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	836	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=23098	62.689	2	1876.9167	1876.9167	K	G	40	57
PSM	TLSSIIGVQQVPEEETHR	837	sp|Q05852|GTAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=16830	51.291	3	2022.0382	2022.0382	K	Y	152	170
PSM	TPDNTVTVFAGQDK	838	sp|P54170|YPHP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=12783	43.879	2	1491.7205	1491.7205	K	E	74	88
PSM	VHVFPVQEDGSLQSPVSEAAHTGK	839	sp|O34499|6PGL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	9-UNIMOD:21	ms_run[2]:scan=16339	50.386	4	2598.2115	2598.2115	K	G	114	138
PSM	VNLSAVPANIDK	840	sp|P80875|G16U_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=15979	49.739	2	1319.6486	1319.6486	K	I	94	106
PSM	YKPNMTCQVTGEVSDDNLK	841	sp|P08874|ABRB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	15.0	7-UNIMOD:4	ms_run[2]:scan=12399	43.178	3	2197.9984	2197.9984	K	L	50	69
PSM	GITISTAHVEYETETR	842	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=15505	48.892132	3	1885.846627	1885.845889	R	H	61	77
PSM	GITISTAHVEYETETR	843	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=13786	45.761253	3	1805.881113	1805.879558	R	H	61	77
PSM	GITISTAHVEYETETR	844	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=14220	46.558754	3	1805.881134	1805.879558	R	H	61	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	845	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:35	ms_run[1]:scan=11886	42.23602	4	4287.149245	4285.166202	K	Q	35	77
PSM	MQEASNGKDTMTGHWEIMGLYIDK	846	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=15301	48.521489	3	2964.2492	2962.1622	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	847	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=20681	58.279662	4	2866.199937	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	848	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=24448	65.248882	4	2867.187026	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	849	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=21655	60.044833	3	2867.188033	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	850	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=23636	63.725503	4	2867.188726	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	851	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=24715	65.759037	4	2867.189726	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	852	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19235	55.668203	4	2866.199105	2866.201319	K	P	78	102
PSM	QALQDAGLSASEIDK	853	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28	ms_run[1]:scan=18431	54.175347	2	1527.7424	1527.7411	R	V	292	307
PSM	GPLTTPVGGGIRSLNVALR	854	sp|P39126|IDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=21306	59.418022	3	1957.053046	1957.051011	K	Q	92	111
PSM	IRFPETSGIGIKPVSEEGTSR	855	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=15880	49.560994	3	2259.185932	2259.185910	K	L	179	200
PSM	DADFVTTQFR	856	sp|P46320|LICH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=16769	51.183611	2	1198.564345	1198.561852	K	V	80	90
PSM	DRVLVEGVNMVK	857	sp|P0CI78|RL24_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:35	ms_run[1]:scan=10396	39.509832	3	1373.733988	1373.733686	K	K	31	43
PSM	DKLEEWIEMSNRK	858	sp|P80870|GS13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:35	ms_run[1]:scan=16529	50.74372	3	1692.814235	1692.814121	K	D	113	126
PSM	EALQELVNK	859	sp|P14949|THIO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=12789	43.890855	2	1042.566675	1042.565875	K	H	94	103
PSM	MKEPTLDEALEGQQQVTVER	860	sp|P96614|CSHA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35	ms_run[1]:scan=15511	48.900431	3	2318.078462	2316.126741	R	L	367	387
PSM	TLEEGQAVSFEIVEGNR	861	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=34132	84.852461	2	1877.924893	1876.916671	K	G	40	57
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	862	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=28117	72.491013	4	3677.478610	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	863	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=30843	78.067361	4	3677.479135	3676.493232	K	R	107	145
PSM	DITASPVLSETAPTSAPSEAAAANEIK	864	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=19853	56.775384	3	2720.282255	2720.279352	K	Q	460	487
PSM	QLNAYGGIVVTASHNPPEYNGYK	865	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=22910	62.328891	3	2555.1432	2554.1522	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	866	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=22626	61.814597	3	2555.1432	2554.1522	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	867	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=22348	61.301776	3	2555.1432	2554.1522	R	V	134	157
PSM	DVSYMDSTGLGVFVGTFK	868	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=33232	83.074593	2	2018.879030	2017.874412	K	M	50	68
PSM	RSHSVCAQGGINGAVNTK	869	sp|P08065|SDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	2-UNIMOD:21,3-UNIMOD:21,4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=9393	37.597615	3	2096.8762	2094.8102	K	G	39	57
PSM	KQPVQSNTTNFDILK	870	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=15927	49.64472	3	1811.883441	1811.881880	K	R	68	83
PSM	DLPDGATIILTNNVAEQGR	871	sp|O32167|METQ_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=22466	61.518834	3	1996.024569	1996.022533	K	M	126	145
PSM	NGGGPSLIECMTYR	872	sp|O31404|ACOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:4	ms_run[1]:scan=22001	60.670974	2	1554.681603	1553.696648	R	N	234	248
PSM	DLTTDLIINER	873	sp|P20277|RL17_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=21116	59.070638	2	1301.683690	1301.682696	R	I	19	30
PSM	GVAESLGLEK	874	sp|P77837|URE1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0		ms_run[1]:scan=14747	47.50902	2	1002.5602	1001.5392	R	R	502	512
PSM	NDMAHESLVNQLVNK	875	sp|Q45480|YLYB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35	ms_run[1]:scan=14640	47.310573	3	1726.832222	1726.830834	K	T	150	165
PSM	RHFHMYPELSFQEEK	876	sp|O07598|YHAA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=26560	69.342171	3	2058.9022	2056.8862	R	T	26	41
PSM	EHYGLDNNGVVQQQAEETQEELEFEE	877	sp|P16971|RECA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=23231	62.929762	3	3064.310117	3063.321748	R	-	323	349
PSM	STALLPLVGDIDTER	878	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=34876	87.011468	2	1679.823597	1678.817883	K	A	174	189
PSM	YDAANHDVISNASCTTNCLAPFAK	879	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=18499	54.299473	3	2642.165529	2639.174436	K	V	139	163
PSM	AGVTDNFFMIGGHSLK	880	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=22112	60.874797	3	1788.792576	1788.790623	K	A	986	1002
PSM	PFMMPVEDVFSITGR	881	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=24277	64.925641	3	1836.784009	1836.782760	K	G	211	226
PSM	STALLPLVGDIDTERAK	882	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=30246	76.790007	3	1877.952385	1877.949960	K	F	174	191
PSM	GILGYSEEPLVSGDYNGNK	883	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=21179	59.184886	3	2011.940513	2010.953451	K	N	271	290
PSM	QLNAYGGIVVTASHNPPEYNGYK	884	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=20018	57.073169	3	2571.175538	2571.179519	R	V	134	157