MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000100-2 -- main-final
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\130804miao_12_Bacillus_HAM_2_1_1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\130804miao_12_Bacillus_HAM_2_1_1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M),Phospho (H),Phospho (D),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=50
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_bacsu_20200403
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Phospho (D),Phospho (H),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=25
MTD	software[2]-setting	TOL(+)=25
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=100
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M),Phospho (D),Phospho (H),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=25
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	H
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	D
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	S
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	T
MTD	variable_mod[6]-position	Anywhere
MTD	variable_mod[7]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[7]-site	Y
MTD	variable_mod[7]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P80698|TIG_BACSU	Trigger factor OS=Bacillus subtilis (strain 168) OX=224308 GN=tig PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.21	48.0	4	4	4
PRT	sp|P49786|BCCP_BACSU	Biotin carboxyl carrier protein of acetyl-CoA carboxylase OS=Bacillus subtilis (strain 168) OX=224308 GN=accB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	44-UNIMOD:35	0.31	45.0	11	2	0
PRT	sp|P02968|FLA_BACSU	Flagellin OS=Bacillus subtilis (strain 168) OX=224308 GN=hag PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.29	41.0	4	4	4
PRT	sp|P37808|ATPA_BACSU	ATP synthase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=atpA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	2	2	2
PRT	sp|P16263|ODO2_BACSU	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) OX=224308 GN=odhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	102-UNIMOD:28	0.12	40.0	4	2	0
PRT	sp|O34824|GLMM_BACSU	Phosphoglucosamine mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=glmM PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	89-UNIMOD:35,96-UNIMOD:35,100-UNIMOD:21,101-UNIMOD:21	0.05	39.0	3	1	0
PRT	sp|P46899|RL18_BACSU	50S ribosomal protein L18 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplR PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.20	37.0	1	1	1
PRT	sp|C0SP85|YUKE_BACSU	Protein YukE OS=Bacillus subtilis (strain 168) OX=224308 GN=yukE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	66-UNIMOD:35	0.34	37.0	3	2	1
PRT	sp|P18159|PGCA_BACSU	Phosphoglucomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgcA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	144-UNIMOD:21,146-UNIMOD:21,134-UNIMOD:28	0.04	37.0	9	1	0
PRT	sp|P42409|RSBRA_BACSU	RsbT co-antagonist protein RsbRA OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	171-UNIMOD:21,163-UNIMOD:35	0.12	36.0	8	2	0
PRT	sp|P17820|DNAK_BACSU	Chaperone protein DnaK OS=Bacillus subtilis (strain 168) OX=224308 GN=dnaK PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	292-UNIMOD:28	0.06	36.0	3	3	3
PRT	sp|P46353|DEOB_BACSU	Phosphopentomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=drm PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	78-UNIMOD:35,87-UNIMOD:21,88-UNIMOD:35,82-UNIMOD:21,89-UNIMOD:21,91-UNIMOD:21,95-UNIMOD:35,86-UNIMOD:21	0.06	36.0	27	1	0
PRT	sp|P39773|GPMI_BACSU	2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=gpmI PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null	424-UNIMOD:4	0.04	35.0	2	1	0
PRT	sp|P33166|EFTU_BACSU	Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	139-UNIMOD:4,139-UNIMOD:385,141-UNIMOD:35,153-UNIMOD:35,93-UNIMOD:35,100-UNIMOD:35,114-UNIMOD:35,83-UNIMOD:4	0.39	35.0	30	9	6
PRT	sp|P39126|IDH_BACSU	Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) OX=224308 GN=icd PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	104-UNIMOD:21,95-UNIMOD:21	0.13	35.0	7	3	1
PRT	sp|P37455|SSBA_BACSU	Single-stranded DNA-binding protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=ssbA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.23	35.0	92	1	0
PRT	sp|P09124|G3P1_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null	152-UNIMOD:4,156-UNIMOD:4	0.33	35.0	5	5	5
PRT	sp|P08874|ABRB_BACSU	Transition state regulatory protein AbrB OS=Bacillus subtilis (strain 168) OX=224308 GN=abrB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	null	86-UNIMOD:21	0.32	34.0	3	2	1
PRT	sp|P21880|DLDH1_BACSU	Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	74-UNIMOD:35,291-UNIMOD:35	0.08	34.0	5	2	0
PRT	sp|C0H3V2|PTMA_BACSU	Mannitol-specific phosphotransferase enzyme IIA component OS=Bacillus subtilis (strain 168) OX=224308 GN=mtlF PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	117-UNIMOD:4,118-UNIMOD:21,111-UNIMOD:21	0.17	34.0	2	1	0
PRT	sp|P80868|EFG_BACSU	Elongation factor G OS=Bacillus subtilis (strain 168) OX=224308 GN=fusA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	219-UNIMOD:4,226-UNIMOD:35	0.06	34.0	8	2	1
PRT	sp|P54419|METK_BACSU	S-adenosylmethionine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=metK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P14577|RL16_BACSU	50S ribosomal protein L16 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.27	33.0	2	2	2
PRT	sp|P11998|RISB_BACSU	6,7-dimethyl-8-ribityllumazine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=ribH PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.19	33.0	1	1	1
PRT	sp|P80860|G6PI_BACSU	Glucose-6-phosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgi PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	242-UNIMOD:21	0.15	33.0	4	3	2
PRT	sp|P17903|RSBV_BACSU	Anti-sigma-B factor antagonist OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbV PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	54-UNIMOD:35,56-UNIMOD:21,55-UNIMOD:21,53-UNIMOD:21	0.17	32.0	11	1	0
PRT	sp|P28598|CH60_BACSU	60 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=groL PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	68-UNIMOD:35	0.11	32.0	4	3	2
PRT	sp|P37571|CLPC_BACSU	Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) OX=224308 GN=clpC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P13714|LDH_BACSU	L-lactate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ldh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	208-UNIMOD:28	0.06	31.0	2	2	2
PRT	sp|P51777|CSPD_BACSU	Cold shock protein CspD OS=Bacillus subtilis (strain 168) OX=224308 GN=cspD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.27	31.0	2	1	0
PRT	sp|P50848|CBP1_BACSU	Carboxypeptidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ypwA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|P94425|YCNE_BACSU	Putative monooxygenase YcnE OS=Bacillus subtilis (strain 168) OX=224308 GN=ycnE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:21	0.18	30.0	2	1	0
PRT	sp|P45694|TKT_BACSU	Transketolase OS=Bacillus subtilis (strain 168) OX=224308 GN=tkt PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	2	2
PRT	sp|O34860|RSBRB_BACSU	RsbT co-antagonist protein RsbRB OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	186-UNIMOD:21	0.06	30.0	17	2	0
PRT	sp|O34788|BDHA_BACSU	(R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=bdhA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.23	29.0	4	4	4
PRT	sp|P37871|RPOC_BACSU	DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	3	3	3
PRT	sp|O34425|G3P2_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null	152-UNIMOD:4,156-UNIMOD:4	0.19	29.0	4	3	2
PRT	sp|P37869|ENO_BACSU	Enolase OS=Bacillus subtilis (strain 168) OX=224308 GN=eno PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null	369-UNIMOD:21,355-UNIMOD:35	0.21	29.0	7	4	2
PRT	sp|P37477|SYK_BACSU	Lysine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=lysS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:21	0.10	29.0	3	3	3
PRT	sp|P23452|FLIL_BACSU	Flagellar protein FliL OS=Bacillus subtilis (strain 168) OX=224308 GN=fliL PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	2	1	0
PRT	sp|P42175|NARG_BACSU	Nitrate reductase alpha chain OS=Bacillus subtilis (strain 168) OX=224308 GN=narG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null	1130-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P32081|CSPB_BACSU	Cold shock protein CspB OS=Bacillus subtilis (strain 168) OX=224308 GN=cspB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.27	28.0	6	1	0
PRT	sp|P08821|DBH1_BACSU	DNA-binding protein HU 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=hupA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.35	27.0	3	2	1
PRT	sp|O31645|PTN3B_BACSU	PTS system mannose-specific EIIBCA component OS=Bacillus subtilis (strain 168) OX=224308 GN=manP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	474-UNIMOD:21,477-UNIMOD:21,541-UNIMOD:21,66-UNIMOD:21	0.09	27.0	5	4	3
PRT	sp|P17921|SYFA_BACSU	Phenylalanine--tRNA ligase alpha subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=pheS PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|P46318|PTJB_BACSU	Lichenan-specific phosphotransferase enzyme IIB component OS=Bacillus subtilis (strain 168) OX=224308 GN=licB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.19	27.0	1	1	1
PRT	sp|P80239|AHPC_BACSU	Alkyl hydroperoxide reductase C OS=Bacillus subtilis (strain 168) OX=224308 GN=ahpC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.26	27.0	8	3	1
PRT	sp|P46336|IOLS_BACSU	Aldo-keto reductase IolS OS=Bacillus subtilis (strain 168) OX=224308 GN=iolS PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P36947|RBSA_BACSU	Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsA PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null	357-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P54531|DHLE_BACSU	Leucine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiT PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	2	1	0
PRT	sp|P39779|CODY_BACSU	GTP-sensing transcriptional pleiotropic repressor CodY OS=Bacillus subtilis (strain 168) OX=224308 GN=codY PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|O31605|PEPF_BACSU	Oligoendopeptidase F homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P08877|PTHP_BACSU	Phosphocarrier protein HPr OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsH PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:21,48-UNIMOD:35,51-UNIMOD:35,52-UNIMOD:21	0.30	26.0	4	2	1
PRT	sp|P18255|SYT1_BACSU	Threonine--tRNA ligase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=thrS PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	2	2
PRT	sp|P08838|PT1_BACSU	Phosphoenolpyruvate-protein phosphotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	3	3	3
PRT	sp|Q04747|SRFAB_BACSU	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	3342-UNIMOD:4	0.01	25.0	2	2	2
PRT	sp|P37487|PPAC_BACSU	Manganese-dependent inorganic pyrophosphatase OS=Bacillus subtilis (strain 168) OX=224308 GN=ppaC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P54375|SODM_BACSU	Superoxide dismutase [Mn] OS=Bacillus subtilis (strain 168) OX=224308 GN=sodA PE=1 SV=5	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:21	0.18	25.0	2	2	2
PRT	sp|P21882|ODPB_BACSU	Pyruvate dehydrogenase E1 component subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P32727|NUSA_BACSU	Transcription termination/antitermination protein NusA OS=Bacillus subtilis (strain 168) OX=224308 GN=nusA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|O34589|FLAW_BACSU	Probable flavodoxin 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=ykuP PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	86-UNIMOD:4,100-UNIMOD:4	0.17	25.0	1	1	1
PRT	sp|P37877|ACKA_BACSU	Acetate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=ackA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O34925|DEOD_BACSU	Purine nucleoside phosphorylase DeoD-type OS=Bacillus subtilis (strain 168) OX=224308 GN=deoD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P12045|PURK_BACSU	N5-carboxyaminoimidazole ribonucleotide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=purK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P54464|YQEY_BACSU	Uncharacterized protein YqeY OS=Bacillus subtilis (strain 168) OX=224308 GN=yqeY PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.18	24.0	2	2	2
PRT	sp|P80859|6PGD_BACSU	6-phosphogluconate dehydrogenase, NADP(+)-dependent, decarboxylating OS=Bacillus subtilis (strain 168) OX=224308 GN=gndA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P09339|ACNA_BACSU	Aconitate/2-methylaconitate hydratase OS=Bacillus subtilis (strain 168) OX=224308 GN=citB PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P21883|ODP2_BACSU	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.16	24.0	3	3	3
PRT	sp|P39789|YPOC_BACSU	Uncharacterized protein YpoC OS=Bacillus subtilis (strain 168) OX=224308 GN=ypoC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	117-UNIMOD:21	0.08	24.0	2	1	0
PRT	sp|P42920|RL3_BACSU	50S ribosomal protein L3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	164-UNIMOD:35	0.16	24.0	2	2	2
PRT	sp|O32047|SECDF_BACSU	Protein translocase subunit SecDF OS=Bacillus subtilis (strain 168) OX=224308 GN=secDF PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P29727|GUAA_BACSU	GMP synthase [glutamine-hydrolyzing] OS=Bacillus subtilis (strain 168) OX=224308 GN=guaA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P71021|DIV4A_BACSU	Septum site-determining protein DivIVA OS=Bacillus subtilis (strain 168) OX=224308 GN=divIVA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	2	1	0
PRT	sp|P42919|RL2_BACSU	50S ribosomal protein L2 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P20458|IF1_BACSU	Translation initiation factor IF-1 OS=Bacillus subtilis (strain 168) OX=224308 GN=infA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	60-UNIMOD:21,61-UNIMOD:21	0.18	23.0	2	1	0
PRT	sp|P21468|RS6_BACSU	30S ribosomal protein S6 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsF PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	null		0.41	23.0	3	2	1
PRT	sp|P80865|SUCD_BACSU	Succinate--CoA ligase [ADP-forming] subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=sucD PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q45477|SYI_BACSU	Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=ileS PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O31567|YFIY_BACSU	Probable siderophore-binding lipoprotein YfiY OS=Bacillus subtilis (strain 168) OX=224308 GN=yfiY PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O32165|SUFD_BACSU	FeS cluster assembly protein SufD OS=Bacillus subtilis (strain 168) OX=224308 GN=sufD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	1	0
PRT	sp|Q03224|GLPX_BACSU	Fructose-1,6-bisphosphatase class 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=glpX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P21465|RS3_BACSU	30S ribosomal protein S3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	2	2	2
PRT	sp|P21879|IMDH_BACSU	Inosine-5'-monophosphate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=guaB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	76-UNIMOD:35	0.07	22.0	2	2	2
PRT	sp|P0CI78|RL24_BACSU	50S ribosomal protein L24 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	69-UNIMOD:35	0.31	22.0	2	1	0
PRT	sp|P80700|EFTS_BACSU	Elongation factor Ts OS=Bacillus subtilis (strain 168) OX=224308 GN=tsf PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	288-UNIMOD:35	0.05	22.0	3	1	0
PRT	sp|P20277|RL17_BACSU	50S ribosomal protein L17 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplQ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	2	1	0
PRT	sp|P80886|SUCC_BACSU	Succinate--CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=sucC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	193-UNIMOD:4,210-UNIMOD:35,220-UNIMOD:21,124-UNIMOD:35	0.24	21.0	6	5	4
PRT	sp|O32221|COPZ_BACSU	Copper chaperone CopZ OS=Bacillus subtilis (strain 168) OX=224308 GN=copZ PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.23	21.0	1	1	1
PRT	sp|P27876|TPIS_BACSU	Triosephosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tpiA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	91-UNIMOD:4	0.06	21.0	2	1	0
PRT	sp|O34633|YJLC_BACSU	Uncharacterized protein YjlC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjlC PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.13	21.0	1	1	1
PRT	sp|P23129|ODO1_BACSU	2-oxoglutarate dehydrogenase E1 component OS=Bacillus subtilis (strain 168) OX=224308 GN=odhA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|P37464|SYS_BACSU	Serine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=serS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P0CI74|GPSB_BACSU	Cell cycle protein GpsB OS=Bacillus subtilis (strain 168) OX=224308 GN=gpsB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	75-UNIMOD:21,73-UNIMOD:21	0.16	21.0	2	1	0
PRT	sp|P13243|ALF_BACSU	Probable fructose-bisphosphate aldolase OS=Bacillus subtilis (strain 168) OX=224308 GN=fbaA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	50-UNIMOD:21,88-UNIMOD:21,93-UNIMOD:4	0.12	21.0	2	2	2
PRT	sp|P80875|G16U_BACSU	General stress protein 16U OS=Bacillus subtilis (strain 168) OX=224308 GN=yceD PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P54170|YPHP_BACSU	UPF0403 protein YphP OS=Bacillus subtilis (strain 168) OX=224308 GN=yphP PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|P19946|RL15_BACSU	50S ribosomal protein L15 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplO PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	55-UNIMOD:35	0.14	21.0	2	1	0
PRT	sp|P46898|RL6_BACSU	50S ribosomal protein L6 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplF PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P54941|YXEB_BACSU	Iron(3+)-hydroxamate-binding protein YxeB OS=Bacillus subtilis (strain 168) OX=224308 GN=yxeB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P37870|RPOB_BACSU	DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P40924|PGK_BACSU	Phosphoglycerate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgk PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P80643|ACP_BACSU	Acyl carrier protein OS=Bacillus subtilis (strain 168) OX=224308 GN=acpA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.21	20.0	1	1	1
PRT	sp|P28368|HPF_BACSU	Ribosome hibernation promotion factor OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	73-UNIMOD:35	0.10	20.0	2	1	0
PRT	sp|O32163|SUFU_BACSU	Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) OX=224308 GN=sufU PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	2-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|O31404|ACOA_BACSU	Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=acoA PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	2	1	0
PRT	sp|P24141|OPPA_BACSU	Oligopeptide-binding protein OppA OS=Bacillus subtilis (strain 168) OX=224308 GN=oppA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	3	1	0
PRT	sp|O07513|HIT_BACSU	Protein hit OS=Bacillus subtilis (strain 168) OX=224308 GN=hit PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null		0.14	20.0	1	1	1
PRT	sp|P39120|CISY2_BACSU	Citrate synthase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=citZ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	334-UNIMOD:35	0.05	20.0	2	1	0
PRT	sp|O32218|BDBD_BACSU	Disulfide bond formation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=bdbD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P20429|RPOA_BACSU	DNA-directed RNA polymerase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P21470|RS9_BACSU	30S ribosomal protein S9 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|O07636|YLAL_BACSU	Uncharacterized protein YlaL OS=Bacillus subtilis (strain 168) OX=224308 GN=ylaL PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.14	19.0	1	1	1
PRT	sp|P39794|PTTBC_BACSU	PTS system trehalose-specific EIIBC component OS=Bacillus subtilis (strain 168) OX=224308 GN=treP PE=2 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null	27-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|P21469|RS7_BACSU	30S ribosomal protein S7 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsG PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.19	19.0	2	2	2
PRT	sp|P28599|CH10_BACSU	10 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=groS PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null	22-UNIMOD:21	0.14	19.0	1	1	1
PRT	sp|P36945|RBSK_BACSU	Ribokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O32232|EST_BACSU	Carboxylesterase OS=Bacillus subtilis (strain 168) OX=224308 GN=est PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P37810|ATPG_BACSU	ATP synthase gamma chain OS=Bacillus subtilis (strain 168) OX=224308 GN=atpG PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P23966|MENB_BACSU	1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=menB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P37476|FTSH_BACSU	ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P80870|GS13_BACSU	General stress protein 13 OS=Bacillus subtilis (strain 168) OX=224308 GN=yugI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.12	18.0	1	1	1
PRT	sp|Q08352|DHA_BACSU	Alanine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ald PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.12	18.0	2	2	2
PRT	sp|O06476|YFMR_BACSU	Uncharacterized ABC transporter ATP-binding protein YfmR OS=Bacillus subtilis (strain 168) OX=224308 GN=yfmR PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P05649|DPO3B_BACSU	Beta sliding clamp OS=Bacillus subtilis (strain 168) OX=224308 GN=dnaN PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q06797|RL1_BACSU	50S ribosomal protein L1 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P37887|CYSK_BACSU	Cysteine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=cysK PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P31847|YPUA_BACSU	Uncharacterized protein YpuA OS=Bacillus subtilis (strain 168) OX=224308 GN=ypuA PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P21464|RS2_BACSU	30S ribosomal protein S2 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|O05519|YDIF_BACSU	Putative ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) OX=224308 GN=ydiF PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q08787|SRFAC_BACSU	Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O34943|YTPR_BACSU	Putative tRNA-binding protein YtpR OS=Bacillus subtilis (strain 168) OX=224308 GN=ytpR PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	129-UNIMOD:4	0.11	18.0	1	1	1
PRT	sp|P39808|YVYG_BACSU	Uncharacterized protein YvyG OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyG PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	49-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|P21881|ODPA_BACSU	Pyruvate dehydrogenase E1 component subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	null	22-UNIMOD:28	0.03	18.0	1	1	1
PRT	sp|P94556|MURI1_BACSU	Glutamate racemase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=racE PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	null	199-UNIMOD:35	0.08	18.0	1	1	1
PRT	sp|P94524|ARAB_BACSU	Ribulokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=araB PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	null	231-UNIMOD:21,233-UNIMOD:21,236-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P42176|NARH_BACSU	Nitrate reductase beta chain OS=Bacillus subtilis (strain 168) OX=224308 GN=narH PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	null	214-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|O31777|BIOF1_BACSU	8-amino-7-oxononanoate synthase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=kbl PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P36949|RBSB_BACSU	Ribose import binding protein RbsB OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P80866|SUFC_BACSU	Vegetative protein 296 OS=Bacillus subtilis (strain 168) OX=224308 GN=sufC PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	74-UNIMOD:35	0.04	17.0	2	1	0
PRT	sp|P17865|FTSZ_BACSU	Cell division protein FtsZ OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsZ PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P38494|RS1H_BACSU	30S ribosomal protein S1 homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=ypfD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	364-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P46208|HTPG_BACSU	Chaperone protein HtpG OS=Bacillus subtilis (strain 168) OX=224308 GN=htpG PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P22250|SYE_BACSU	Glutamate--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=gltX PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P54569|YQKF_BACSU	Uncharacterized oxidoreductase YqkF OS=Bacillus subtilis (strain 168) OX=224308 GN=yqkF PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P49814|MDH_BACSU	Malate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P19670|MURA2_BACSU	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=murAB PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	418-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|P08066|SDHB_BACSU	Succinate dehydrogenase iron-sulfur subunit OS=Bacillus subtilis (strain 168) OX=224308 GN=sdhB PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	212-UNIMOD:4,218-UNIMOD:4,222-UNIMOD:4	0.11	17.0	1	1	1
PRT	sp|P39646|PTAS_BACSU	Phosphate acetyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=pta PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P39758|ABH_BACSU	Putative transition state regulator Abh OS=Bacillus subtilis (strain 168) OX=224308 GN=abh PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	null	54-UNIMOD:4,56-UNIMOD:35	0.21	17.0	1	1	1
PRT	sp|P42921|RL4_BACSU	50S ribosomal protein L4 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	null		0.12	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	EEGAVEEGNTVVLDFEGFVDGEAFEGGK	1	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=34931	83.226	3	2929.3141	2929.3141	K	A	156	184
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	2	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	45.0	10-UNIMOD:35	ms_run[1]:scan=12443	41.536169	4	4286.155346	4285.166202	K	Q	35	77
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	3	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=14249	44.848524	4	4270.160098	4269.171287	K	Q	35	77
PSM	ATDLQSIQDEISALTDEIDGISNR	4	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=35043	83.42	3	2603.2562	2603.2562	K	T	106	130
PSM	QQIQNYQSDIEVQDVGTVIQVGDGIAR	5	sp|P37808|ATPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=26439	66.884	3	2972.4839	2972.4839	K	V	14	41
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	6	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=27585	69.082	3	2901.3727	2901.3727	K	T	61	91
PSM	AMDAEAGVMISASHNPVQDNGIK	7	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:35,9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=15371	46.879	3	2466.0556	2466.0556	K	F	88	111
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	8	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	38.0	10-UNIMOD:35	ms_run[1]:scan=11323	39.46319	6	5149.5802	5149.5747	K	I	35	84
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	9	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27856	69.59	3	2901.3727	2901.3727	K	T	61	91
PSM	HIYAQIIDDVNGVTLASASTLDK	10	sp|P46899|RL18_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27624	69.16	3	2443.2595	2443.2595	K	D	39	62
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	11	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=34822	83.036	3	3532.6587	3532.6587	K	G	66	97
PSM	QLNAYGGIVVTASHNPPEYNGYK	12	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=18653	52.751097	3	2571.175343	2571.179519	R	V	134	157
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	13	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	28-UNIMOD:21	ms_run[2]:scan=35085	83.493	4	3557.882	3557.8820	K	R	144	176
PSM	ADDNVVDAEYEEVNDDQNKK	14	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=14176	44.713491	3	2308.993577	2308.993143	K	-	592	612
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	15	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	36.0		ms_run[1]:scan=12821	42.231158	6	5133.5849	5133.5797	K	I	35	84
PSM	MQEASNGKDTMTGHWEIMGLYIDK	16	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=25074	64.369564	3	2867.187625	2866.201319	K	P	78	102
PSM	AIEAVDECLGEVVDAILAK	17	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=34978	83.306	3	2014.0293	2014.0293	K	G	417	436
PSM	CDMVDDEELLELVEMEVR	18	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=34863	83.108	2	2222.9745	2222.9745	K	D	139	157
PSM	GPLTTPVGGGIRSLNVALR	19	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=22427	59.543	3	1957.051	1957.0510	K	Q	92	111
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	20	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16852	49.524	4	3676.4932	3676.4932	K	R	107	145
PSM	VPTPNVSLVDLVAELNQEVTAEEVNAALK	21	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=35066	83.459	3	3061.6183	3061.6183	R	E	234	263
PSM	CDMVDDEELLELVEMEVR	22	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35	ms_run[1]:scan=35164	83.629162	2	2221.9426	2221.9424	K	D	139	157
PSM	CDMVDDEELLELVEMEVR	23	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=35305	83.874103	2	2205.9490	2205.9474	K	D	139	157
PSM	EGAEQIISEIQNQLQNLK	24	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=35082	83.489	3	2134.0307	2134.0307	K	-	79	97
PSM	HSDDMGITAENVTVDFTK	25	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=17605	50.888	3	1994.8891	1994.8891	K	V	70	88
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	26	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=35166	83.632	3	3374.7448	3374.7448	K	A	144	174
PSM	NNEHLDILSNIAIICSEEENIER	27	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=29855	73.454	3	2804.2688	2804.2688	K	L	103	126
PSM	NSLIEAVCELDEELMDK	28	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=34941	83.243	2	2006.9177	2006.9177	R	Y	212	229
PSM	ADDNVVDAEYEEVNDDQNK	29	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15741	47.537	3	2180.8982	2180.8982	K	K	592	611
PSM	CDMVDDEELLELVEMEVR	30	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4	ms_run[2]:scan=34855	83.093	3	2222.9745	2222.9745	K	D	139	157
PSM	EHVINPVVPEELIDEETK	31	sp|P54419|METK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22231	59.192	3	2089.0579	2089.0579	K	Y	219	237
PSM	GGTEVHFGEFGIQALEASWITNR	32	sp|P14577|RL16_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=30397	74.482	3	2518.2241	2518.2241	K	Q	23	46
PSM	GIAQAANTTGVPVIFGIVTTENIEQAIER	33	sp|P11998|RISB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=34875	83.129	3	3011.5928	3011.5928	K	A	99	128
PSM	HELTIEEADNDLDGLNYLAGK	34	sp|P80860|G6PI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=24889	64.036	3	2329.1074	2329.1074	K	T	336	357
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	35	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=34949	83.258	4	3573.8769	3573.8769	K	R	144	176
PSM	CDMVDDEELLELVEMEVR	36	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=35075	83.475398	2	2237.9389	2237.9373	K	D	139	157
PSM	AIEAVDECLGEVVDAILAK	37	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=34975	83.302	2	2014.0293	2014.0293	K	G	417	436
PSM	DLLSEYDFPGDDVPVVK	38	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=28008	69.885	2	1906.92	1906.9200	R	G	157	174
PSM	DVSYMDSTGLGVFVGTFK	39	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=31200	76.011	2	2017.8744	2017.8744	K	M	50	68
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	40	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=34825	83.04	4	3532.6587	3532.6587	K	G	66	97
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	41	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=21104	57.157	3	2762.3037	2762.3037	K	E	92	119
PSM	PLLLIAEDVEGEALATLVVNK	42	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=35009	83.361	3	2206.2461	2206.2461	K	L	244	265
PSM	QGQENSEVTVDDIAMVVSSWTGVPVSK	43	sp|P37571|CLPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=35011	83.364	3	2861.3753	2861.3753	K	I	464	491
PSM	RPNTDELGLEQVGIEMTDR	44	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21903	58.588	3	2172.0481	2172.0481	R	G	276	295
PSM	LEHTINNLSASGENLTAAESR	45	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14439	45.199	3	2226.0877	2226.0877	R	I	242	263
PSM	NDAYKQEELDQIVDDVK	46	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20572	56.203	2	2020.9589	2020.9589	K	N	203	220
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	47	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16609	49.078	3	3676.4932	3676.4932	K	R	107	145
PSM	NSLIEAVCELDEELMDK	48	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=34945	83.249	3	2006.9177	2006.9177	R	Y	212	229
PSM	SLEEGQEVSFEIVEGNR	49	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21396	57.671	2	1920.9065	1920.9065	K	G	40	57
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	50	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=12428	41.507526	5	4286.157177	4285.166202	K	Q	35	77
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIRG	51	sp|C0SP85|YUKE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35	ms_run[1]:scan=34877	83.131505	3	3591.690097	3589.680213	K	-	66	98
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	52	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18322	52.163776	3	3677.479700	3676.493232	K	R	107	145
PSM	HYAHVDCPGHADYVK	53	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=7471	31.937	4	1767.7787	1767.7787	R	N	77	92
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	54	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=25667	65.474	3	2752.29	2752.2900	K	M	38	63
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	55	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=23144	60.839	3	2746.3088	2746.3088	K	E	92	119
PSM	REEFLSEAQSLVQHSR	56	sp|P94425|YCNE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=21802	58.406	3	1994.9211	1994.9211	K	A	15	31
PSM	FGASAPGETIINEYGFSVPNVVNRVK	57	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=26608	67.19471	3	2764.428350	2764.418430	R	A	637	663
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	58	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=18617	52.686059	3	3678.469440	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	59	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=28497	70.824474	2	1678.819135	1678.817883	K	A	174	189
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	60	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	28-UNIMOD:21	ms_run[1]:scan=35083	83.490261	3	3557.884735	3557.882011	K	R	144	176
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	61	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=35163	83.62775	4	3374.748959	3374.744849	K	A	144	174
PSM	AAGATDIYAVELSPER	62	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19164	53.648	2	1661.8261	1661.8261	K	Q	190	206
PSM	ALEEVIYFASYVVTDPANTPLEK	63	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=34841	83.07	3	2568.2999	2568.2999	R	K	124	147
PSM	AMLDDQIQVVAINASYSAETLAHLIK	64	sp|O34425|G3P2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=34885	83.147	3	2813.4633	2813.4633	K	Y	21	47
PSM	QAEPAAQEVSEEAQSEAK	65	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12075	40.844	3	1900.865	1900.8650	K	S	102	120
PSM	SGETEDSTIADIAVATNAGQIK	66	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:21	ms_run[2]:scan=24335	63.006	2	2270.0315	2270.0315	R	T	369	391
PSM	THQSQEVISAYQDLTK	67	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17477	50.658	3	1846.9061	1846.9061	R	E	40	56
PSM	NSQDGISLIQTAEGALTETHAILQR	68	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=34766	82.938888	3	2666.354556	2665.367122	K	V	65	90
PSM	STALLPLVGDIDTER	69	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=28498	70.82573	3	1678.819061	1678.817883	K	A	174	189
PSM	DVSYMDSTGLGVFVGTFK	70	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=31162	75.935649	3	2017.875392	2017.874412	K	M	50	68
PSM	CDMVDDEELLELVEMEVR	71	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,3-UNIMOD:35	ms_run[2]:scan=33939	81.354	3	2238.9694	2238.9694	K	D	139	157
PSM	DAVISLLADTNADQIEGDK	72	sp|P23452|FLIL_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25719	65.565	2	1986.9746	1986.9746	K	G	89	108
PSM	DDAEDTDIKDNDWIECFNR	73	sp|P42175|NARG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:4	ms_run[2]:scan=23262	61.065	3	2369.9706	2369.9706	K	N	1115	1134
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	74	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=21074	57.104	3	2762.3037	2762.3037	K	E	92	119
PSM	PHPLTNETAPVTMGHEFSGEVVEVGEGVENYK	75	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23317	61.167	4	3452.6194	3452.6194	K	V	56	88
PSM	STALLPLVGDIDTERAK	76	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=24677	63.656	2	1877.95	1877.9500	K	F	174	191
PSM	TLEEGQAVSFEIVEGNR	77	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21126	57.195	2	1876.9167	1876.9167	K	G	40	57
PSM	STALLPLVGDIDTER	78	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=28762	71.329121	2	1678.819135	1678.817883	K	A	174	189
PSM	AENLEVSDEEVDAELTK	79	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18419	52.34	2	1889.8742	1889.8742	K	M	369	386
PSM	AVDSVFDTILDALK	80	sp|P08821|DBH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=35050	83.433	2	1505.7977	1505.7977	K	N	24	38
PSM	DITASPVLSETAPTSAPSEAAAANEIK	81	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:21	ms_run[2]:scan=21257	57.426	3	2720.2794	2720.2794	K	Q	460	487
PSM	DNDDATHSHQFMQIEGLVVDK	82	sp|P17921|SYFA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:35	ms_run[2]:scan=20044	55.256	3	2414.0809	2414.0809	R	N	200	221
PSM	DYTIWAVSGDSVQNHIDK	83	sp|P46318|PTJB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21309	57.521	3	2046.9647	2046.9647	K	A	30	48
PSM	HPETGEVLVNENELIDEDK	84	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17431	50.572	3	2179.0281	2179.0281	K	A	854	873
PSM	NFDVLDEETGLADR	85	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21921	58.625	2	1592.7318	1592.7318	R	G	107	121
PSM	QGVEIVVESTGFFTK	86	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25795	65.709	2	1639.8457	1639.8457	K	R	88	103
PSM	TLEEGQAVSFEIVEGNR	87	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21420	57.716	2	1876.9167	1876.9167	K	G	40	57
PSM	VGDEVEIIGLQEENK	88	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19336	53.951	2	1670.8363	1670.8363	K	K	240	255
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	89	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=14180	44.722821	5	4270.160650	4269.171287	K	Q	35	77
PSM	GRNPQTGEEIEIPASK	90	sp|P08821|DBH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10843	38.578554	3	1724.871178	1724.869327	K	V	60	76
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	91	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19206	53.721368	3	3678.469440	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	92	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18910	53.201408	3	3678.469440	3676.493232	K	R	107	145
PSM	DGLVDVLQGEYNLLNR	93	sp|P46336|IOLS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=32877	79.255	2	1816.9319	1816.9319	K	E	168	184
PSM	DVSYMDSTGLGVFVGTFK	94	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=34828	83.048	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	95	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=31461	76.522	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	96	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:21	ms_run[2]:scan=33748	80.97	2	2001.8795	2001.8795	K	M	50	68
PSM	ENIALPNLSSFSPK	97	sp|P36947|RBSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:21	ms_run[2]:scan=26730	67.428	2	1595.7596	1595.7596	R	G	348	362
PSM	GLNTAVGDEGGFAPNLGSNEEALQTIVEAIEK	98	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=34839	83.067	3	3242.5943	3242.5943	K	A	197	229
PSM	HLHEEGANLIVTDINK	99	sp|P54531|DHLE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14629	45.558	3	1801.9323	1801.9323	R	Q	191	207
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	100	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13958	44.327	4	4269.1713	4269.1713	K	Q	35	77
PSM	LLGYSINQQIENDR	101	sp|P39779|CODY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18874	53.136	2	1661.8373	1661.8373	K	M	48	62
PSM	SDQDTGNSFYQGLNDK	102	sp|O31605|PEPF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14514	45.35	2	1787.7598	1787.7598	R	A	148	164
PSM	SGETEDSTIADIAVATNAGQIK	103	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21884	58.554	3	2190.0652	2190.0652	R	T	369	391
PSM	SIMGVMSLGIAK	104	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:21,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=17439	50.586	2	1317.6074	1317.6074	K	G	46	58
PSM	STALLPLVGDIDTERAK	105	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=24405	63.136	2	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	106	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=24544	63.397	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	107	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=24817	63.91	3	1877.95	1877.9500	K	F	174	191
PSM	TPINEDGTVEIITEGSEEGLQIMR	108	sp|P18255|SYT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=29734	73.216	3	2630.2745	2630.2745	R	H	52	76
PSM	QAEPAAQEVSEEAQSEAK	109	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=15922	47.863422	2	1883.8412	1883.8380	K	S	102	120
PSM	MQEASNGKDTMTGHWEIMGLYIDK	110	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=25063	64.350429	4	2867.187205	2866.201319	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	111	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17180	50.102448	3	3677.482849	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	112	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17142	50.031197	4	3677.483917	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	113	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=18562	52.590916	4	3678.470808	3676.493232	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	114	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=18947	53.267949	3	2571.175343	2571.179519	R	V	134	157
PSM	DFATSELEDNPAYQYAVVR	115	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=28436	70.698	3	2266.9784	2266.9784	K	N	239	258
PSM	DQLPTEDEQFDAYK	116	sp|P08838|PT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16506	48.89	2	1697.7421	1697.7421	R	T	305	319
PSM	DRPAVTYNGQSWTYGELNAK	117	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18273	52.073	3	2269.0764	2269.0764	K	A	2556	2576
PSM	HSDDMGITAENVTVDFTK	118	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20165	55.473	3	1978.8942	1978.8942	K	V	70	88
PSM	KVEIAQVNTVDIEDVK	119	sp|P37487|PPAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17196	50.128	3	1798.9676	1798.9676	K	K	213	229
PSM	LEITSTPNQDSPLSEGK	120	sp|P54375|SODM_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15054	46.309	2	1814.8898	1814.8898	K	T	141	158
PSM	MQEASNGKDTMTGHWEIMGLYIDK	121	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23958	62.313	3	2866.2013	2866.2013	K	P	78	102
PSM	QEVPEEEYTIELGK	122	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18474	52.439	2	1662.7988	1662.7988	R	A	182	196
PSM	SLEEGQEVSFEIVEGNR	123	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21672	58.176	2	1920.9065	1920.9065	K	G	40	57
PSM	SSELLDALTILEK	124	sp|P32727|NUSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:21	ms_run[2]:scan=34987	83.322	2	1510.7532	1510.7532	M	E	2	15
PSM	STALLPLVGDIDTERAK	125	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=25099	64.419	3	1877.95	1877.9500	K	F	174	191
PSM	TCAVFGSGDTAYEFFCGAVDTLEAK	126	sp|O34589|FLAW_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=34682	82.792	3	2715.1833	2715.1833	K	I	85	110
PSM	TGQTADEVLNTLNK	127	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17058	49.885	2	1502.7577	1502.7577	K	K	255	269
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	128	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=12859	42.302901	7	5134.5842	5133.5802	K	I	35	84
PSM	MQEASNGKDTMTGHWEIMGLYIDK	129	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=24518	63.346373	3	2867.190399	2866.201319	K	P	78	102
PSM	QLNAYGGIVVTASHNPPEYNGYK	130	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=23127	60.81199	3	2554.1555	2554.1524	R	V	134	157
PSM	ALSILTVSDHVLTGEETTAEER	131	sp|O34925|DEOD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24604	63.511	3	2370.1914	2370.1914	K	Q	195	217
PSM	DGHHVELAANIGTPDDVK	132	sp|P08838|PT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13107	42.754	3	1886.9123	1886.9123	K	G	265	283
PSM	DHAYLPQGSELLLITQNR	133	sp|P12045|PURK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24182	62.733	3	2067.0749	2067.0749	K	E	91	109
PSM	DSLTEDEELTVLSR	134	sp|P54464|YQEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21478	57.815	2	1605.7734	1605.7734	K	E	43	57
PSM	DVEVTFPEEYHAEDLAGK	135	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20129	55.412	3	2047.9375	2047.9375	K	P	214	232
PSM	DVSYMDSTGLGVFVGTFK	136	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:21	ms_run[2]:scan=34001	81.479	2	2001.8795	2001.8795	K	M	50	68
PSM	ELGVEVYSVSTDTHFVHK	137	sp|P80239|AHPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17851	51.322	3	2046.0058	2046.0058	K	G	63	81
PSM	GIYPSSANYSTDLHSLGQYVQEGR	138	sp|P80860|G6PI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23145	60.841	3	2641.2409	2641.2409	K	R	298	322
PSM	KDEETGKPLVDVILDK	139	sp|P80859|6PGD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20559	56.181	3	1797.9724	1797.9724	K	A	241	257
PSM	LISFLQNELNVNK	140	sp|P39126|IDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24594	63.494	2	1530.8406	1530.8406	K	I	166	179
PSM	LLDYAEAGDNIGALLR	141	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=27487	68.887	2	1702.889	1702.8890	K	G	267	283
PSM	NDLLITSVLSGNR	142	sp|P09339|ACNA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25388	64.958	2	1400.7623	1400.7623	K	N	537	550
PSM	NGEFIDVTNEDLK	143	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18379	52.269	2	1492.7046	1492.7046	K	G	18	31
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	144	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=23900	62.213	3	2746.3088	2746.3088	K	E	92	119
PSM	STALLPLVGDIDTERAK	145	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=25374	64.931	3	1877.95	1877.9500	K	F	174	191
PSM	SVFEISDEINGLATK	146	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25135	64.485	2	1621.8199	1621.8199	K	A	328	343
PSM	SYPAKPINWAER	147	sp|P39789|YPOC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=15374	46.883	2	1510.697	1510.6970	K	V	117	129
PSM	TLEEGQAVSFEIVEGNR	148	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21697	58.222	2	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	149	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21409	57.697	3	1876.9167	1876.9167	K	G	40	57
PSM	VEIFSAGEIVDVTGVSK	150	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25391	64.962	2	1748.9196	1748.9196	K	G	99	116
PSM	RANVLGVSEPNIQIEGNNR	151	sp|O32047|SECDF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17345	50.415309	3	2080.073407	2079.082114	R	I	71	90
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	152	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21464	57.791839	3	3677.476885	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	153	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18279	52.085112	4	3677.480732	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	154	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17458	50.623895	3	3677.479402	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	155	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=28391	70.608972	3	3678.482415	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	156	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19764	54.735415	3	3677.477036	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	157	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19490	54.227872	3	3677.477036	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	158	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21741	58.298584	3	3677.477730	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	159	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=29025	71.845654	2	1678.819135	1678.817883	K	A	174	189
PSM	AAVEEGIVSGGGTALVNVYNK	160	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20651	56.343	3	2047.0586	2047.0586	R	V	403	424
PSM	GIDYLAQGTLYTDIIESGTATAQTIK	161	sp|P29727|GUAA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=32122	77.795	3	2742.3964	2742.3964	K	S	319	345
PSM	GQATITEIDGTVVEINEVR	162	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22617	59.89	2	2043.0484	2043.0484	K	D	967	986
PSM	GSDESDDAKTEAQVQSTAEAGQDVAK	163	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11852	40.423	3	2636.1685	2636.1685	K	E	88	114
PSM	GVLENGGEAVGLYR	164	sp|P08838|PT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17864	51.343	2	1432.731	1432.7310	K	T	283	297
PSM	GYDEDEVNEFLAQVR	165	sp|P71021|DIV4A_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=26891	67.756	2	1782.8061	1782.8061	R	K	19	34
PSM	IGETHEGASQMDWMEQEQER	166	sp|P80868|EFG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16021	48.039	3	2389.9903	2389.9903	K	G	40	60
PSM	IVLDDLIEEGFGALIK	167	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=35076	83.477	2	1743.9659	1743.9659	K	E	319	335
PSM	SANIALINYADGEK	168	sp|P42919|RL2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18962	53.293	2	1477.7413	1477.7413	R	R	88	102
PSM	SIMGVMSLGIAK	169	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=22979	60.539	2	1301.6124	1301.6124	K	G	46	58
PSM	VTVELSPYDLTR	170	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:21	ms_run[2]:scan=21765	58.343	2	1471.696	1471.6960	K	G	53	65
PSM	MQEASNGKDTMTGHWEIMGLYIDK	171	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=24507	63.32741	4	2867.189606	2866.201319	K	P	78	102
PSM	DGFYQIVNVQSDAAAVQEFDR	172	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=28929	71.6627	3	2371.109097	2371.108054	R	L	57	78
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	173	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18852	53.098371	4	3678.470808	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	174	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=20603	56.261178	3	3677.477036	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	175	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=17747	51.139032	3	3677.479402	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	176	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=20322	55.751347	3	3677.477036	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	177	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=19142	53.609971	4	3678.470808	3676.493232	K	R	107	145
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	178	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	28-UNIMOD:21	ms_run[1]:scan=35294	83.855054	3	3358.754226	3358.749934	K	A	144	174
PSM	AMDAEAGVMISASHNPVQDNGIK	179	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=17316	50.356542	3	2451.064443	2450.060726	K	F	88	111
PSM	AFNEDPDTHAVIMIGEIGGTAEEEAAEWVK	180	sp|P80865|SUCD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=34310	82.094	3	3228.4921	3228.4921	K	A	194	224
PSM	DDLVRPADLYLEGSDQYR	181	sp|Q45477|SYI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21500	57.857	3	2124.0124	2124.0124	R	G	542	560
PSM	DNLTLYANAVNK	182	sp|O31567|YFIY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16313	48.55	2	1334.683	1334.6830	K	A	152	164
PSM	DQTPAHLSLSQELK	183	sp|O32165|SUFD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15125	46.442	3	1565.8049	1565.8049	R	D	97	111
PSM	DVEDVVATILNR	184	sp|Q03224|GLPX_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=32403	78.337	2	1342.7092	1342.7092	K	E	153	165
PSM	DYADFLHEDLK	185	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21049	57.062	2	1364.6248	1364.6248	K	I	27	38
PSM	EELVTASVGTTLDEAEK	186	sp|P21879|IMDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19413	54.088	2	1790.8786	1790.8786	K	I	160	177
PSM	EGAEQIISEIQNQLQNLK	187	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=34520	82.494	3	2054.0644	2054.0644	K	-	79	97
PSM	HSKPTQANPQGGISNQEAPIHVSNVMPLDPK	188	sp|P0CI78|RL24_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	26-UNIMOD:35	ms_run[2]:scan=13789	43.99	5	3306.6415	3306.6415	K	T	44	75
PSM	IRFPETSGIGIKPVSEEGTSR	189	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17061	49.889	3	2259.1859	2259.1859	K	L	179	200
PSM	LDAEVSVDGNNLVVNGK	190	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17663	50.991	2	1741.8846	1741.8846	K	T	54	71
PSM	MQEASNGKDTMTGHWEIMGLYIDK	191	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=19920	55.03	4	2882.1962	2882.1962	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	192	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=20205	55.544	4	2882.1962	2882.1962	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	193	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23959	62.314	4	2866.2013	2866.2013	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	194	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16896	49.6	3	3676.4932	3676.4932	K	R	107	145
PSM	RADLDAQLVADNIAR	195	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17655	50.977	3	1639.8642	1639.8642	K	Q	107	122
PSM	RQENFAEEVMNQVK	196	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:35	ms_run[2]:scan=15687	47.443	3	1736.8152	1736.8152	K	K	279	293
PSM	SGETEDSTIADIAVATNAGQIK	197	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:21	ms_run[2]:scan=24323	62.985	3	2270.0315	2270.0315	R	T	369	391
PSM	STALLPLVGDIDTERAK	198	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:21	ms_run[2]:scan=25929	65.948	3	1877.95	1877.9500	K	F	174	191
PSM	VTVELSPYDLTR	199	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:21	ms_run[2]:scan=21489	57.838	2	1471.696	1471.6960	K	G	53	65
PSM	GITISTAHVEYETETR	200	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14705	45.690672	3	1805.881501	1805.879558	R	H	61	77
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	201	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35	ms_run[1]:scan=26194	66.437495	3	2730.315601	2730.313907	K	E	92	119
PSM	CDMVDDEELLELVEMEVR	202	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=32878	79.255896	3	2254.964526	2254.964352	K	D	139	157
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	203	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=12165	41.014535	4	4285.170083	4285.166202	K	Q	35	77
PSM	NFDVLDEETGLADR	204	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=25303	64.802224	2	1593.717757	1592.731831	R	G	107	121
PSM	MQEASNGKDTMTGHWEIMGLYIDK	205	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,5-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=21557	57.961601	3	2866.200103	2866.201319	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	206	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=30795	75.249787	3	3676.479443	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	207	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=27857	69.591733	3	3677.477570	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	208	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=27312	68.558644	3	3677.476833	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	209	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=33972	81.419555	3	3678.476354	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	210	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=28314	70.457049	2	1678.819135	1678.817883	K	A	174	189
PSM	DITASPVLSETAPTSAPSEAAAANEIK	211	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=21038	57.04282	3	2720.282809	2720.279352	K	Q	460	487
PSM	DLTTDLIINER	212	sp|P20277|RL17_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=22352	59.412557	2	1301.683588	1301.682696	R	I	19	30
PSM	AVDSVFDTILDALK	213	sp|P08821|DBH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=35056	83.441	3	1505.7977	1505.7977	K	N	24	38
PSM	DCSIAEINPLVVTGDGNVMALDAK	214	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=26897	67.768	3	2517.2091	2517.2091	K	L	192	216
PSM	DIADAIEDQGYDVAK	215	sp|O32221|COPZ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21142	57.221	2	1621.7471	1621.7471	K	-	55	70
PSM	DLGVDYCVIGHSER	216	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=16648	49.151	2	1618.741	1618.7410	K	R	85	99
PSM	DLGVDYCVIGHSER	217	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=16675	49.2	3	1618.741	1618.7410	K	R	85	99
PSM	DRAEASNETIGLFGLLR	218	sp|O34633|YJLC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=27868	69.614	3	1860.9694	1860.9694	K	M	96	113
PSM	DSVGDDQYEIFK	219	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19134	53.595	2	1414.6252	1414.6252	K	S	99	111
PSM	EGVVTEEVVQNIEK	220	sp|P23129|ODO1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19037	53.427	2	1571.8043	1571.8043	K	S	499	513
PSM	GEDLTDFDKFEALDDR	221	sp|P37464|SYS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22691	60.024	3	1884.8378	1884.8378	K	R	22	38
PSM	GPLTTPVGGGIRSLNVALR	222	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:21	ms_run[2]:scan=22712	60.064	3	1957.051	1957.0510	K	Q	92	111
PSM	KQPVQSNTTNFDILK	223	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=17082	49.926	3	1811.8819	1811.8819	K	R	68	83
PSM	MGGEQITVQNLEIVK	224	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=20056	55.28	2	1673.8658	1673.8658	R	V	164	179
PSM	NEDVTIVMGVNEDQFDAER	225	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22253	59.234	3	2179.9692	2179.9692	K	H	125	144
PSM	NFDVLDEETGLADR	226	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22200	59.134	2	1592.7318	1592.7318	R	G	107	121
PSM	NMSIEQQAEQVDK	227	sp|P21879|IMDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=10529	37.991	2	1534.6933	1534.6933	K	V	75	88
PSM	SPVILGVSEGAGR	228	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=16751	49.342	2	1320.6439	1320.6439	K	Y	43	56
PSM	SQNFGQVSNAFVR	229	sp|P80875|G16U_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:21	ms_run[2]:scan=19897	54.987	2	1532.6773	1532.6773	R	I	119	132
PSM	TDDVVAEIAER	230	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16969	49.732	2	1216.5935	1216.5935	K	T	222	233
PSM	TPDNTVTVFAGQDK	231	sp|P54170|YPHP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13879	44.164	2	1491.7205	1491.7205	K	E	74	88
PSM	QALQDAGLSASEIDK	232	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=19540	54.315941	2	1527.7426	1527.7411	R	V	292	307
PSM	RPNTDELGLEQVGIEMTDR	233	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21860	58.509509	3	2172.049564	2172.048096	R	G	276	295
PSM	RPNTDELGLEQVGIEMTDR	234	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:35	ms_run[1]:scan=17449	50.607601	3	2188.044496	2188.043011	R	G	276	295
PSM	NNEHLDILSNIAIICSEEENIER	235	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=31809	77.185356	3	2804.277986	2804.268805	K	L	103	126
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	236	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=24838	63.946365	3	3677.473957	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	237	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21386	57.653806	4	3677.479398	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	238	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19701	54.621888	4	3677.478157	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	239	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=27044	68.046857	3	3677.476833	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	240	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23149	60.849803	3	3677.477128	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	241	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=28659	71.125061	3	3676.478483	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	242	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=32409	78.348851	3	3677.475195	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	243	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20037	55.242473	3	3677.477036	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	244	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20768	56.550444	4	3677.478157	3676.493232	K	R	107	145
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	245	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=27829	69.541326	3	2753.278926	2752.289994	K	M	38	63
PSM	QLNAYGGIVVTASHNPPEYNGYK	246	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=19239	53.778558	3	2571.175343	2571.179519	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	247	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=23412	61.332977	3	2554.1555	2554.1524	R	V	134	157
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	248	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	28-UNIMOD:21	ms_run[1]:scan=35293	83.85364	4	3358.758979	3358.749934	K	A	144	174
PSM	GYDEDEVNEFLAQVR	249	sp|P71021|DIV4A_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=26898	67.769191	2	1782.808022	1782.806058	R	K	19	34
PSM	SGGGVRPGFEGGQMPLFQR	250	sp|P19946|RL15_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:35	ms_run[1]:scan=15603	47.295497	3	1991.960622	1991.963579	R	L	42	61
PSM	SLLGNMVEGVSK	251	sp|P46898|RL6_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=22205	59.144415	2	1232.644339	1232.643473	R	G	71	83
PSM	MQEASNGKDTMTGHWEIMGLYIDK	252	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,12-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=17202	50.140365	4	2965.233996	2962.162565	K	P	78	102
PSM	DALEIYVDDEK	253	sp|P08874|ABRB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18521	52.519	2	1308.6085	1308.6085	K	I	34	45
PSM	DATFGIYENTDK	254	sp|P54941|YXEB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16163	48.285	2	1372.6147	1372.6147	K	G	185	197
PSM	DDVYTSIHIEEYESEAR	255	sp|P37870|RPOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19351	53.979	3	2054.9069	2054.9069	K	D	784	801
PSM	DGDVLVLENVR	256	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19860	54.913	2	1227.6459	1227.6459	K	F	108	119
PSM	DLTTDLIINER	257	sp|P20277|RL17_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22238	59.205	2	1301.6827	1301.6827	R	I	19	30
PSM	DQTPAHLSLSQELK	258	sp|O32165|SUFD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15123	46.439	2	1565.8049	1565.8049	R	D	97	111
PSM	ELEAFAQFGSDLDQATQAK	259	sp|P37808|ATPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=26906	67.784	3	2067.9749	2067.9749	R	L	391	410
PSM	GILGYSEEPLVSGDYNGNK	260	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21405	57.688	3	2010.9535	2010.9535	K	N	271	290
PSM	HVIISNASCTTNCLAPVVK	261	sp|O34425|G3P2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=14900	46.034	3	2083.0554	2083.0554	R	V	144	163
PSM	IATVGDAVNYIQNQQ	262	sp|P80643|ACP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21998	58.774	2	1632.8107	1632.8107	K	-	63	78
PSM	NPNTVSEVQELSESR	263	sp|P23129|ODO1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15913	47.847	2	1687.8013	1687.8013	R	F	791	806
PSM	NSLIEAVCELDEELMDK	264	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=34800	82.998	3	2022.9126	2022.9126	R	Y	212	229
PSM	QLVSPAGNQGFGLNAEEENK	265	sp|P09339|ACNA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17174	50.09	3	2101.0076	2101.0076	K	E	404	424
PSM	RGALLSESGFK	266	sp|O31645|PTN3B_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:21	ms_run[2]:scan=15774	47.597	2	1243.5962	1243.5962	R	Q	534	545
PSM	RQENFAEEVMNQVK	267	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21238	57.392	2	1720.8203	1720.8203	K	K	279	293
PSM	SEVHNEDMYNAIDLATNK	268	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18004	51.587	3	2062.9266	2062.9266	R	L	66	84
PSM	SFNANLDTLYR	269	sp|O32163|SUFU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:21	ms_run[2]:scan=22080	58.919	2	1392.6075	1392.6075	M	Q	2	13
PSM	SGGGVRPGFEGGQMPLFQR	270	sp|P19946|RL15_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:35	ms_run[2]:scan=15546	47.19	3	1991.9636	1991.9636	R	L	42	61
PSM	TLEEGQAVSFEIVEGNR	271	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21116	57.178	3	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	272	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22628	59.909	2	1876.9167	1876.9167	K	G	40	57
PSM	VLFEISGVSEEVAR	273	sp|P14577|RL16_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23258	61.059	2	1533.8039	1533.8039	K	E	102	116
PSM	YDAANHDVISNASCTTNCLAPFAK	274	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=18699	52.83	3	2639.1744	2639.1744	K	V	139	163
PSM	YDADVNLEYNGK	275	sp|P08877|PTHP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13492	43.447	2	1399.6256	1399.6256	K	T	29	41
PSM	YTGLEGDVLGIDR	276	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21591	58.027	2	1406.7042	1406.7042	K	F	624	637
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	277	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=13851	44.105315	4	4285.171093	4285.166202	K	Q	35	77
PSM	SQEEHNHEELNDQLQVR	278	sp|P37477|SYK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=10918	38.717508	3	2183.9227	2183.9228	M	R	2	19
PSM	NGEFIDVTNEDLK	279	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20629	56.304839	2	1493.689904	1492.704553	K	G	18	31
PSM	DGFYQIVNVQSDAAAVQEFDR	280	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=29113	72.01931	3	2373.108545	2371.108054	R	L	57	78
PSM	DILAVYQAAEEAIER	281	sp|O31404|ACOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=33060	79.600594	2	1689.861548	1689.857366	K	A	217	232
PSM	NGGNNDTGWENPEFK	282	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16823	49.472399	2	1678.687625	1677.701927	K	K	464	479
PSM	AIRDEFEPIGLNTLNNNGEK	283	sp|O07513|HIT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21202	57.330928	3	2244.104402	2243.118225	R	A	74	94
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	284	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=29447	72.667735	3	3677.477013	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	285	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21953	58.689355	4	3677.479398	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	286	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=34170	81.820278	4	3677.477231	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	287	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21178	57.286473	3	3677.476885	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	288	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=35855	85.021639	3	3677.475683	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	289	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=25674	65.487245	3	3677.477573	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	290	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24563	63.431161	3	3677.473957	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	291	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=33160	79.80187	4	3677.477702	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	292	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24762	63.813947	4	3676.479982	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	293	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19426	54.113212	4	3678.470808	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	294	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20475	56.030809	4	3677.478157	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	295	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22235	59.201191	4	3677.478061	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	296	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=31341	76.284629	3	3678.477042	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	297	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20896	56.781098	3	3678.469440	3676.493232	K	R	107	145
PSM	MSGWLAHILEQYDNNR	298	sp|P39120|CISY2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35	ms_run[1]:scan=27139	68.224626	3	1961.906071	1961.905396	R	L	334	350
PSM	GPLTTPVGGGIRSLNVALR	299	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=23002	60.581955	3	1957.052429	1957.051011	K	Q	92	111
PSM	DAVISLLADTNADQIEGDK	300	sp|P23452|FLIL_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25693	65.517	3	1986.9746	1986.9746	K	G	89	108
PSM	DDAPVTVVEFGDYK	301	sp|O32218|BDBD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21674	58.179	2	1553.725	1553.7250	K	C	55	69
PSM	DDQPIGVIPIDSIYTPVSR	302	sp|P20429|RPOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=27674	69.257	3	2084.079	2084.0790	R	V	157	176
PSM	DLDEEDPKEIEASK	303	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10157	37.297	3	1616.7417	1616.7417	R	Y	234	248
PSM	EISEHIPSAALIEDIK	304	sp|P21470|RS9_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21929	58.645	3	1763.9305	1763.9305	R	Q	34	50
PSM	GITISTAHVEYETETR	305	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14436	45.195	2	1805.8796	1805.8796	R	H	61	77
PSM	HSKPTQANPQGGISNQEAPIHVSNVMPLDPK	306	sp|P0CI78|RL24_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16010	48.02	4	3290.6466	3290.6466	K	T	44	75
PSM	KGDSQDTYLQSAGDESDLDPER	307	sp|O07636|YLAL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14455	45.229	3	2425.0517	2425.0517	R	V	33	55
PSM	KQPVQSNTTNFDILK	308	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=17696	51.049	3	1811.8819	1811.8819	K	R	68	83
PSM	KVQLVGDDLFVTNTK	309	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19441	54.138	3	1675.9145	1675.9145	K	K	308	323
PSM	MQEASNGKDTMTGHWEIMGLYIDK	310	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=24233	62.823	4	2866.2013	2866.2013	K	P	78	102
PSM	QIVEAVGGAENIAAATHCVTR	311	sp|P39794|PTTBC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	18-UNIMOD:4	ms_run[2]:scan=17886	51.385	3	2166.0851	2166.0852	R	L	10	31
PSM	RDVLPDPIYNSK	312	sp|P21469|RS7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14829	45.905	3	1415.7409	1415.7409	K	L	10	22
PSM	STALLPLVGDIDTERAK	313	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:21	ms_run[2]:scan=24958	64.163	2	1877.95	1877.9500	K	F	174	191
PSM	SVEELVADLDSVPENIR	314	sp|P54375|SODM_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:21	ms_run[2]:scan=29102	71.997	2	1963.914	1963.9140	K	T	53	70
PSM	TASGIVLPDSAK	315	sp|P28599|CH10_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=14673	45.634	2	1237.5955	1237.5955	K	E	20	32
PSM	VGDDHYGTAILNNLK	316	sp|P36945|RBSK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18779	52.971	3	1628.8158	1628.8158	K	A	61	76
PSM	VNQIGTLTETFDAIEMAK	317	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=28996	71.79	3	1979.9874	1979.9874	K	R	340	358
PSM	CDMVDDEELLELVEMEVR	318	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=34533	82.519908	3	2238.968899	2238.969437	K	D	139	157
PSM	NGEFIDVTNEDLK	319	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19768	54.74456	2	1493.691991	1492.704553	K	G	18	31
PSM	MQEASNGKDTMTGHWEIMGLYIDK	320	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=21058	57.078193	4	2883.182453	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	321	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20779	56.569486	4	2883.182453	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	322	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,9-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=22495	59.66697	4	2867.187142	2866.201319	K	P	78	102
PSM	AMDAEAGVMISASHNPVQDNGIK	323	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=16983	49.754725	3	2450.062407	2450.060726	K	F	88	111
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	324	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26784	67.529279	3	3677.476833	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	325	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=38825	94.727809	3	3677.476277	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	326	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34494	82.446316	3	3676.477037	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	327	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21046	57.057727	4	3677.478157	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	328	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22795	60.214025	4	3677.478678	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	329	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=20059	55.284225	4	3677.478157	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	330	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25396	64.972766	3	3676.476490	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	331	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21669	58.168554	4	3677.479398	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	332	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=35459	84.173252	4	3676.478208	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	333	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24282	62.913214	3	3677.473957	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	334	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33460	80.399162	3	3678.475637	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	335	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=31878	77.316031	3	3677.478078	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	336	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33714	80.903861	3	3678.483509	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	337	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22584	59.83287	3	3677.476976	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	338	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24492	63.294455	4	3676.478231	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	339	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23434	61.37114	3	3677.477128	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	340	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23081	60.725576	4	3677.477545	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	341	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34434	82.336233	4	3677.477231	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	342	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22864	60.33662	3	3677.476976	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	343	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18040	51.652059	3	3678.472769	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	344	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34787	82.975745	3	3676.477037	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	345	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34717	82.855527	4	3677.477231	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	346	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=30252	74.203864	3	3677.477013	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	347	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33203	79.88471	3	3678.483509	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	348	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33918	81.317631	4	3677.477231	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	349	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22294	59.313196	3	3677.476976	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	350	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34773	82.952438	3	3678.476019	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	351	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=35369	83.996738	3	3678.477197	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	352	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=33999	81.472536	3	2001.880873	2001.879497	K	M	50	68
PSM	HDHMINTESANIIYNEVETDDK	353	sp|O32232|EST_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19257	53.807254	3	2588.155671	2587.149661	R	Q	191	213
PSM	QAAITQEITEIVGGAAALE	354	sp|P37810|ATPG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34902	83.173959	2	1884.990706	1883.984023	R	-	269	288
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	355	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=25487	65.144805	3	2765.249882	2762.303737	K	E	92	119
PSM	MQEASNGKDTMTGHWEIMGLYIDK	356	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21,14-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=17758	51.158112	4	2965.228721	2962.162565	K	P	78	102
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	357	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=34950	83.259569	3	3573.882095	3573.876926	K	R	144	176
PSM	DDQNVGVIVLAGAGDK	358	sp|P23966|MENB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19909	55.007	2	1569.7999	1569.7999	R	A	52	68
PSM	DFNNEQNYSDQIAYEIDQEIQR	359	sp|P37476|FTSH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=29736	73.219	3	2731.1998	2731.1998	R	I	538	560
PSM	DILAVYQAAEEAIER	360	sp|O31404|ACOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=32926	79.349	3	1689.8574	1689.8574	K	A	217	232
PSM	DINEHLSVGDEVQVK	361	sp|P80870|GS13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14806	45.866	3	1680.8319	1680.8319	K	V	47	62
PSM	DLGYEYVPAEK	362	sp|Q08352|DHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15544	47.187	2	1282.6081	1282.6081	R	A	357	368
PSM	DQLEWDGIEDK	363	sp|O06476|YFMR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18645	52.736	2	1346.599	1346.5990	K	I	561	572
PSM	DRLVESVQDVLK	364	sp|P05649|DPO3B_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20583	56.226	2	1399.7671	1399.7671	K	A	8	20
PSM	DSLQEFSNANR	365	sp|P54464|YQEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12109	40.91	2	1279.5793	1279.5793	K	L	63	74
PSM	DTSSVLCELTAEDTK	366	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=22088	58.934	2	1667.756	1667.7560	K	H	3336	3351
PSM	DVSYMDSTGLGVFVGTFK	367	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=31725	77.027	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	368	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21	ms_run[2]:scan=34257	81.988	2	2001.8795	2001.8795	K	M	50	68
PSM	EADAIIIAADRSVNK	369	sp|O31645|PTN3B_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:21	ms_run[2]:scan=15167	46.523	3	1664.8135	1664.8135	R	D	55	70
PSM	EAEAAGADFVGDTDYINK	370	sp|Q06797|RL1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17839	51.297	3	1884.8378	1884.8378	K	I	86	104
PSM	FDLTYIGEDGK	371	sp|P18255|SYT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20444	55.973	2	1256.5925	1256.5925	R	Q	501	512
PSM	HGYFVPQQFNNPSNPEIHR	372	sp|P37887|CYSK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15536	47.172	3	2280.0824	2280.0824	K	Q	137	156
PSM	HLHEEGANLIVTDINK	373	sp|P54531|DHLE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14639	45.576	2	1801.9323	1801.9323	R	Q	191	207
PSM	MSGWLAHILEQYDNNR	374	sp|P39120|CISY2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=27169	68.287	2	1961.9054	1961.9054	R	L	334	350
PSM	NADIDWGQVSDQLDK	375	sp|P31847|YPUA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21163	57.258	2	1702.7798	1702.7798	K	A	239	254
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	376	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	23-UNIMOD:35	ms_run[2]:scan=27148	68.245	3	2730.3139	2730.3139	K	E	92	119
PSM	NSLIEAVCELDEELMDK	377	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=34473	82.41	2	2022.9126	2022.9126	R	Y	212	229
PSM	NVGVPYIVVFLNK	378	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=29813	73.373	2	1460.8391	1460.8391	K	C	126	139
PSM	PGSVIVDVAIDQGGIVETVDHITTHDQPTYEK	379	sp|Q08352|DHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=28033	69.932	4	3432.7049	3432.7049	K	H	258	290
PSM	QGEEEAEVAEETAPETETTTA	380	sp|P21464|RS2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13436	43.347	3	2220.9394	2220.9394	K	-	226	247
PSM	REEFLSEAQSLVQHSR	381	sp|P94425|YCNE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19826	54.851	3	1914.9548	1914.9548	K	A	15	31
PSM	RIEEIETTVQTIEENISR	382	sp|O05519|YDIF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27799	69.488	3	2159.107	2159.1070	R	N	579	597
PSM	RLQEQSLQSEPHQYVPLYDIQSQADQPK	383	sp|Q08787|SRFAC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18187	51.916	4	3324.6375	3324.6375	K	L	320	348
PSM	SEVHNEDMYNAIDLATNK	384	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:35	ms_run[2]:scan=14227	44.811	3	2078.9215	2078.9215	R	L	66	84
PSM	SIMGVMSLGIAK	385	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:35,6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=17160	50.067	2	1317.6074	1317.6074	K	G	46	58
PSM	STALLPLVGDIDTER	386	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=35597	84.461	2	1678.8179	1678.8179	K	A	174	189
PSM	VNQIGTLTETFDAIEMAK	387	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	16-UNIMOD:35	ms_run[2]:scan=28303	70.438	3	1995.9823	1995.9823	K	R	340	358
PSM	VNVGEETLQIVCGAPNVDQGQK	388	sp|O34943|YTPR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:4	ms_run[2]:scan=22631	59.913	3	2354.1536	2354.1536	K	V	118	140
PSM	YIQAITQTEDDRIK	389	sp|P39808|YVYG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:21	ms_run[2]:scan=13421	43.315	3	1772.8346	1772.8346	K	T	49	63
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	390	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=29821	73.388082	3	2746.335268	2746.308822	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	391	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=26121	66.302074	3	2746.333598	2746.308822	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	392	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=29290	72.35954	3	2747.332187	2746.308822	K	E	92	119
PSM	CDMVDDEELLELVEMEVR	393	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35	ms_run[1]:scan=35169	83.639861	3	2221.9461	2221.9424	K	D	139	157
PSM	NSLIEAVCELDEELMDK	394	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=35091	83.505036	3	2023.897559	2022.912574	R	Y	212	229
PSM	NGEFIDVTNEDLK	395	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=19726	54.667664	2	1493.691991	1492.704553	K	G	18	31
PSM	MQEASNGKDTMTGHWEIMGLYIDK	396	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=22462	59.606543	3	2867.188524	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	397	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=20052	55.270732	3	2948.2532	2946.1672	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	398	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20486	56.049855	4	2882.184620	2882.196234	K	P	78	102
PSM	FNNVLTSNGAEITGTK	399	sp|P21468|RS6_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17036	49.846803	2	1665.822406	1664.836964	R	D	26	42
PSM	QFETFQILNEK	400	sp|P21881|ODPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=29109	72.010039	2	1378.6764	1378.6764	K	G	22	33
PSM	NGGNNDTGWENPEFK	401	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17120	49.993189	2	1678.687625	1677.701927	K	K	464	479
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	402	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=22014	58.804144	3	3677.477730	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	403	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=28919	71.641279	3	3677.477570	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	404	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=28236	70.310543	2	1678.819135	1678.817883	K	A	174	189
PSM	STALLPLVGDIDTER	405	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=29559	72.874353	2	1678.819135	1678.817883	K	A	174	189
PSM	EAIQRYMGEHVNIISSGDETAR	406	sp|P94556|MURI1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35	ms_run[1]:scan=35096	83.512005	3	2492.209505	2491.176151	K	E	193	215
PSM	TITKDKLSGSIHSVGEK	407	sp|P94524|ARAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	3-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=22333	59.378631	2	2038.8522	2038.8772	K	A	229	246
PSM	NGGNNDTGWENPEFK	408	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17400	50.513657	2	1679.676323	1677.701927	K	K	464	479
PSM	REEDGIVLVDQNACR	409	sp|P42176|NARH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4	ms_run[1]:scan=13421	43.314981	3	1772.837469	1772.847546	K	S	201	216
PSM	QLNAYGGIVVTASHNPPEYNGYK	410	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=19521	54.282188	3	2571.175343	2571.179519	R	V	134	157
PSM	MQEASNGKDTMTGHWEIMGLYIDK	411	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,5-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=16907	49.619292	4	2965.236439	2962.162565	K	P	78	102
PSM	ASENAEIDVPQAMVDTELDR	412	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23281	61.098	3	2202.011	2202.0110	K	M	296	316
PSM	DELDQALDVIEK	413	sp|O31777|BIOF1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25813	65.737	2	1386.6878	1386.6878	K	T	373	385
PSM	DILVIGFDGNK	414	sp|P36949|RBSB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23180	60.908	2	1189.6343	1189.6343	K	D	242	253
PSM	DVLEMEVDER	415	sp|P80866|SUFC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35	ms_run[2]:scan=13349	43.185	2	1249.5496	1249.5496	K	A	70	80
PSM	DVLEMEVDER	416	sp|P80866|SUFC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16991	49.77	2	1233.5547	1233.5547	K	A	70	80
PSM	DVSYMDSTGLGVFVGTFK	417	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:21	ms_run[2]:scan=34517	82.49	2	2001.8795	2001.8795	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	418	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:21	ms_run[2]:scan=34806	83.01	2	2001.8795	2001.8795	K	M	50	68
PSM	EAVDTLIVIPNDR	419	sp|P17865|FTSZ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21398	57.674	2	1453.7777	1453.7777	K	I	156	169
PSM	EETSTGFQLGDLIGDK	420	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=27908	69.693	2	1788.7819	1788.7819	K	L	362	378
PSM	EIELEDAFENMGAK	421	sp|P28598|CH60_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24880	64.02	3	1594.7185	1594.7185	K	L	58	72
PSM	ENTEDDSYDEFLEEYR	422	sp|P46208|HTPG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23330	61.189	2	2052.8072	2052.8072	K	L	175	191
PSM	EQFIEIFDVNR	423	sp|P22250|SYE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26508	67.01	2	1408.6987	1408.6987	K	L	298	309
PSM	ERTGNDAMEVFEQALK	424	sp|P21469|RS7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24133	62.635	3	1836.8676	1836.8676	K	N	52	68
PSM	GRNEEIVGDAIQNR	425	sp|P54569|YQKF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11343	39.495	3	1569.7859	1569.7859	R	R	54	68
PSM	HYGGEPANFLDVGGGATAEK	426	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17318	50.363	3	1988.9228	1988.9228	K	V	278	298
PSM	INHNIAALNTLNR	427	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13835	44.076	3	1462.8005	1462.8005	R	L	3	16
PSM	IRFPETSGIGIKPVSEEGTSR	428	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17102	49.961	4	2259.1859	2259.1859	K	L	179	200
PSM	ITGTSNYEDTAGSDIVVITAGIAR	429	sp|P49814|MDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26040	66.155	3	2423.218	2423.2180	K	K	64	88
PSM	IVLMASEEGGTEIEEVAEK	430	sp|P80886|SUCC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21239	57.394	3	2032.9875	2032.9875	R	T	121	140
PSM	LNFDSNALYR	431	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=20119	55.39	2	1291.5598	1291.5598	K	Q	216	226
PSM	MQEASNGKDTMTGHWEIMGLYIDK	432	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=25420	65.017	3	2850.2064	2850.2064	K	P	78	102
PSM	MTDEEIEQLQNS	433	sp|P19670|MURA2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=13437	43.348	2	1451.6086	1451.6086	R	-	418	430
PSM	NEDVTIVMGVNEDQFDAER	434	sp|O34425|G3P2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22220	59.173	2	2179.9692	2179.9692	K	H	125	144
PSM	NSLIEAVCELDEELMDK	435	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=34814	83.021	2	2022.9126	2022.9126	R	Y	212	229
PSM	SERLEALMDEGGLADCGNSQNCVQSCPK	436	sp|P08066|SDHB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	16-UNIMOD:4,22-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=18791	52.991	3	3124.3318	3124.3318	K	G	197	225
PSM	STALLPLVGDIDTERAK	437	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=25648	65.44	3	1877.95	1877.9500	K	F	174	191
PSM	SYPAKPINWAER	438	sp|P39789|YPOC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:21	ms_run[2]:scan=15335	46.814	3	1510.697	1510.6970	K	V	117	129
PSM	TTLTAAITTVLHK	439	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22787	60.199	2	1368.7977	1368.7977	K	K	26	39
PSM	VLNPIVIGNENEIQAK	440	sp|P39646|PTAS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19595	54.422	2	1749.9625	1749.9625	K	A	41	57
PSM	VTVPVAIHLDHGSSFESCAK	441	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=19038	53.428	3	2233.0239	2233.0239	K	A	76	96
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	442	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=26150	66.353652	3	2746.333598	2746.308822	K	E	92	119
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	443	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=30123	73.961089	3	2748.269541	2746.308822	K	E	92	119
PSM	CDMVDDEELLELVEMEVR	444	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=34587	82.621543	3	2257.007940	2254.964352	K	D	139	157
PSM	DFATSELEDNPAYQYAVVR	445	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=25811	65.734535	3	2189.019952	2187.012028	K	N	239	258
PSM	IVLMASEEGGTEIEEVAEK	446	sp|P80886|SUCC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35	ms_run[1]:scan=18907	53.193476	3	2048.985773	2048.982368	R	T	121	140
PSM	EIELEDAFENMGAK	447	sp|P28598|CH60_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:35	ms_run[1]:scan=20458	55.995983	3	1610.714734	1610.713404	K	L	58	72
PSM	GPLTTPVGGGIRSLNVALR	448	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=23440	61.383287	3	1958.043981	1957.051011	K	Q	92	111
PSM	EDIDSFVNGGAQEAAPQETAAPQETAAK	449	sp|P21883|ODP2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18905	53.190684	3	2845.290542	2844.304976	K	P	172	200
PSM	NSLIEAVCELDEELMDK	450	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=34739	82.893755	3	2022.913189	2022.912574	R	Y	212	229
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	451	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=12153	40.990223	5	4285.169494	4285.166202	K	Q	35	77
PSM	QEELDQIVDDVK	452	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=26550	67.087669	2	1412.6674	1412.6666	K	N	208	220
PSM	RQENFAEEVMNQVK	453	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=15289	46.734711	3	1736.816640	1736.815184	K	K	279	293
PSM	MQEASNGKDTMTGHWEIMGLYIDK	454	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=21349	57.591477	4	2883.182453	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	455	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20194	55.524697	3	2882.197671	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	456	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,5-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=22486	59.65073	4	2867.187142	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	457	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=25345	64.879274	3	2867.187625	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	458	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=21503	57.860838	4	2866.199940	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	459	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=25336	64.863082	4	2867.187205	2866.201319	K	P	78	102
PSM	YKPHGVCLMTGEITSENK	460	sp|P39758|ABH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=11356	39.520151	3	2078.978390	2078.976512	K	E	48	66
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	461	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=35080	83.486086	3	3678.477197	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	462	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=29179	72.148625	3	3677.471256	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	463	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=31076	75.769477	3	3677.477657	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	464	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=31571	76.728299	4	3677.478077	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	465	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23646	61.752894	4	3677.477545	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	466	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=27196	68.339308	4	3677.480631	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	467	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=35628	84.515188	3	3678.477197	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	468	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=31607	76.793956	3	3678.477042	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	469	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=30531	74.728599	3	3677.474925	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	470	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=30237	74.175325	4	3678.477949	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	471	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=35709	84.681156	4	3676.478194	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	472	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=33669	80.814277	4	3677.477231	3676.493232	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	473	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=34346	82.162942	3	2572.176434	2571.179519	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	474	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=18452	52.396879	4	2571.174999	2571.179519	R	V	134	157
PSM	QLNAYGGIVVTASHNPPEYNGYK	475	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=18463	52.419723	4	2571.174999	2571.179519	R	V	134	157
PSM	NIPGVTVVEANGINVLDVVNHEK	476	sp|P42921|RL4_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=26539	67.064785	3	2430.280867	2429.291438	R	L	169	192
PSM	GALLSESGFK	477	sp|O31645|PTN3B_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=18779	52.971034	2	1087.496102	1087.495092	R	Q	535	545
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	478	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=27583	69.075733	3	3679.487547	3676.493232	K	R	107	145
PSM	MQEASNGKDTMTGHWEIMGLYIDK	479	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=20955	56.88966	4	2949.240582	2946.167650	K	P	78	102