MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000100-2 -- main-final
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\130804miao_13_Bacillus_HAM_2_1_2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220608\20220608145545137229^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\130804miao_13_Bacillus_HAM_2_1_2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M),Phospho (H),Phospho (D),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=50
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_bacsu_20200403
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Phospho (D),Phospho (H),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=25
MTD	software[2]-setting	TOL(+)=25
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=100
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.uniprot_bacsu_20200403
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M),Phospho (D),Phospho (H),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=25
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	H
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	D
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	S
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	T
MTD	variable_mod[6]-position	Anywhere
MTD	variable_mod[7]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[7]-site	Y
MTD	variable_mod[7]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49786|BCCP_BACSU	Biotin carboxyl carrier protein of acetyl-CoA carboxylase OS=Bacillus subtilis (strain 168) OX=224308 GN=accB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	44-UNIMOD:35	0.31	43.0	11	3	1
PRT	sp|P02968|FLA_BACSU	Flagellin OS=Bacillus subtilis (strain 168) OX=224308 GN=hag PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null		0.24	40.0	3	3	3
PRT	sp|P16263|ODO2_BACSU	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Bacillus subtilis (strain 168) OX=224308 GN=odhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.12	40.0	3	2	1
PRT	sp|P80698|TIG_BACSU	Trigger factor OS=Bacillus subtilis (strain 168) OX=224308 GN=tig PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.16	38.0	3	3	3
PRT	sp|O34824|GLMM_BACSU	Phosphoglucosamine mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=glmM PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	null	89-UNIMOD:35,96-UNIMOD:35,100-UNIMOD:21	0.09	37.0	3	2	1
PRT	sp|P42409|RSBRA_BACSU	RsbT co-antagonist protein RsbRA OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	171-UNIMOD:21,163-UNIMOD:35	0.12	37.0	6	2	0
PRT	sp|P39773|GPMI_BACSU	2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Bacillus subtilis (strain 168) OX=224308 GN=gpmI PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	null	424-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|P09124|G3P1_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	3	2	1
PRT	sp|P17820|DNAK_BACSU	Chaperone protein DnaK OS=Bacillus subtilis (strain 168) OX=224308 GN=dnaK PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P14577|RL16_BACSU	50S ribosomal protein L16 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.17	35.0	1	1	1
PRT	sp|P33166|EFTU_BACSU	Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	139-UNIMOD:385,139-UNIMOD:4,141-UNIMOD:35,153-UNIMOD:35,93-UNIMOD:35,100-UNIMOD:35,114-UNIMOD:35,83-UNIMOD:4,46-UNIMOD:35	0.43	35.0	30	11	7
PRT	sp|P80868|EFG_BACSU	Elongation factor G OS=Bacillus subtilis (strain 168) OX=224308 GN=fusA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	219-UNIMOD:4,226-UNIMOD:35	0.03	34.0	5	1	0
PRT	sp|P21880|DLDH1_BACSU	Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	null	74-UNIMOD:35,291-UNIMOD:35	0.08	33.0	4	2	0
PRT	sp|P51777|CSPD_BACSU	Cold shock protein CspD OS=Bacillus subtilis (strain 168) OX=224308 GN=cspD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.27	33.0	2	1	0
PRT	sp|P37455|SSBA_BACSU	Single-stranded DNA-binding protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=ssbA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null		0.23	33.0	108	1	0
PRT	sp|P37871|RPOC_BACSU	DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	4	4	4
PRT	sp|P46318|PTJB_BACSU	Lichenan-specific phosphotransferase enzyme IIB component OS=Bacillus subtilis (strain 168) OX=224308 GN=licB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	1	1	1
PRT	sp|P39126|IDH_BACSU	Isocitrate dehydrogenase [NADP] OS=Bacillus subtilis (strain 168) OX=224308 GN=icd PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	null	104-UNIMOD:21,95-UNIMOD:21	0.08	31.0	6	3	1
PRT	sp|P17903|RSBV_BACSU	Anti-sigma-B factor antagonist OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbV PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	54-UNIMOD:35,56-UNIMOD:21,55-UNIMOD:21,57-UNIMOD:21,53-UNIMOD:21,52-UNIMOD:21	0.17	30.0	14	1	0
PRT	sp|C0SP85|YUKE_BACSU	Protein YukE OS=Bacillus subtilis (strain 168) OX=224308 GN=yukE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	66-UNIMOD:35	0.34	30.0	4	2	0
PRT	sp|O34860|RSBRB_BACSU	RsbT co-antagonist protein RsbRB OS=Bacillus subtilis (strain 168) OX=224308 GN=rsbRB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	186-UNIMOD:21,183-UNIMOD:21	0.06	30.0	19	2	0
PRT	sp|P32081|CSPB_BACSU	Cold shock protein CspB OS=Bacillus subtilis (strain 168) OX=224308 GN=cspB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.27	30.0	6	1	0
PRT	sp|P50848|CBP1_BACSU	Carboxypeptidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ypwA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	2	1	0
PRT	sp|P80239|AHPC_BACSU	Alkyl hydroperoxide reductase C OS=Bacillus subtilis (strain 168) OX=224308 GN=ahpC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.26	29.0	6	3	1
PRT	sp|P11998|RISB_BACSU	6,7-dimethyl-8-ribityllumazine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=ribH PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.19	29.0	1	1	1
PRT	sp|P18159|PGCA_BACSU	Phosphoglucomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgcA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	146-UNIMOD:21,144-UNIMOD:21,134-UNIMOD:28,152-UNIMOD:21	0.04	29.0	5	1	0
PRT	sp|P94425|YCNE_BACSU	Putative monooxygenase YcnE OS=Bacillus subtilis (strain 168) OX=224308 GN=ycnE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	null	24-UNIMOD:21	0.18	29.0	1	1	1
PRT	sp|P08821|DBH1_BACSU	DNA-binding protein HU 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=hupA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.35	28.0	2	2	2
PRT	sp|P12425|GLN1A_BACSU	Glutamine synthetase OS=Bacillus subtilis (strain 168) OX=224308 GN=glnA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	null	307-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P08838|PT1_BACSU	Phosphoenolpyruvate-protein phosphotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P40924|PGK_BACSU	Phosphoglycerate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgk PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	3	3	3
PRT	sp|P70974|RL13_BACSU	50S ribosomal protein L13 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplM PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|P80860|G6PI_BACSU	Glucose-6-phosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgi PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	242-UNIMOD:21,247-UNIMOD:21	0.15	27.0	6	3	1
PRT	sp|P21468|RS6_BACSU	30S ribosomal protein S6 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsF PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.23	26.0	2	1	0
PRT	sp|P08874|ABRB_BACSU	Transition state regulatory protein AbrB OS=Bacillus subtilis (strain 168) OX=224308 GN=abrB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null	86-UNIMOD:21	0.32	26.0	4	2	1
PRT	sp|O34425|G3P2_BACSU	Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=gapB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	152-UNIMOD:4,156-UNIMOD:4,132-UNIMOD:35	0.11	26.0	2	2	2
PRT	sp|P08164|NADE_BACSU	NH(3)-dependent NAD(+) synthetase OS=Bacillus subtilis (strain 168) OX=224308 GN=nadE PE=1 SV=5	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P20429|RPOA_BACSU	DNA-directed RNA polymerase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	2	1	0
PRT	sp|P12877|RL5_BACSU	50S ribosomal protein L5 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplE PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	152-UNIMOD:35	0.10	25.0	1	1	1
PRT	sp|P38494|RS1H_BACSU	30S ribosomal protein S1 homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=ypfD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P39779|CODY_BACSU	GTP-sensing transcriptional pleiotropic repressor CodY OS=Bacillus subtilis (strain 168) OX=224308 GN=codY PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P46353|DEOB_BACSU	Phosphopentomutase OS=Bacillus subtilis (strain 168) OX=224308 GN=drm PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	318-UNIMOD:35,78-UNIMOD:35,82-UNIMOD:21,88-UNIMOD:35,91-UNIMOD:21,95-UNIMOD:35,87-UNIMOD:21,86-UNIMOD:21	0.13	25.0	21	2	0
PRT	sp|P08877|PTHP_BACSU	Phosphocarrier protein HPr OS=Bacillus subtilis (strain 168) OX=224308 GN=ptsH PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	46-UNIMOD:21,48-UNIMOD:35,51-UNIMOD:35,52-UNIMOD:21	0.15	25.0	3	1	0
PRT	sp|P42920|RL3_BACSU	50S ribosomal protein L3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	null	164-UNIMOD:35	0.25	25.0	4	4	4
PRT	sp|P28598|CH60_BACSU	60 kDa chaperonin OS=Bacillus subtilis (strain 168) OX=224308 GN=groL PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P23452|FLIL_BACSU	Flagellar protein FliL OS=Bacillus subtilis (strain 168) OX=224308 GN=fliL PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|Q04747|SRFAB_BACSU	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	3	2	1
PRT	sp|P54464|YQEY_BACSU	Uncharacterized protein YqeY OS=Bacillus subtilis (strain 168) OX=224308 GN=yqeY PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P37869|ENO_BACSU	Enolase OS=Bacillus subtilis (strain 168) OX=224308 GN=eno PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	369-UNIMOD:21,355-UNIMOD:35	0.26	24.0	7	5	4
PRT	sp|P80875|G16U_BACSU	General stress protein 16U OS=Bacillus subtilis (strain 168) OX=224308 GN=yceD PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	null	119-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|O34788|BDHA_BACSU	(R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=bdhA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.19	24.0	3	3	3
PRT	sp|C0H3V2|PTMA_BACSU	Mannitol-specific phosphotransferase enzyme IIA component OS=Bacillus subtilis (strain 168) OX=224308 GN=mtlF PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	117-UNIMOD:4,118-UNIMOD:21	0.17	24.0	2	1	0
PRT	sp|P46336|IOLS_BACSU	Aldo-keto reductase IolS OS=Bacillus subtilis (strain 168) OX=224308 GN=iolS PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q03224|GLPX_BACSU	Fructose-1,6-bisphosphatase class 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=glpX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P94428|GABD_BACSU	Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Bacillus subtilis (strain 168) OX=224308 GN=gabD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P34957|QOX2_BACSU	Quinol oxidase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=qoxA PE=3 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P80700|EFTS_BACSU	Elongation factor Ts OS=Bacillus subtilis (strain 168) OX=224308 GN=tsf PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	288-UNIMOD:35	0.11	23.0	3	2	1
PRT	sp|P18255|SYT1_BACSU	Threonine--tRNA ligase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=thrS PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P20458|IF1_BACSU	Translation initiation factor IF-1 OS=Bacillus subtilis (strain 168) OX=224308 GN=infA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	null	61-UNIMOD:21	0.18	23.0	2	1	0
PRT	sp|P21881|ODPA_BACSU	Pyruvate dehydrogenase E1 component subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	134-UNIMOD:35,354-UNIMOD:35	0.13	23.0	2	2	2
PRT	sp|P21465|RS3_BACSU	30S ribosomal protein S3 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsC PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	2	2	2
PRT	sp|P27876|TPIS_BACSU	Triosephosphate isomerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tpiA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	91-UNIMOD:4	0.06	22.0	2	1	0
PRT	sp|O32165|SUFD_BACSU	FeS cluster assembly protein SufD OS=Bacillus subtilis (strain 168) OX=224308 GN=sufD PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P21469|RS7_BACSU	30S ribosomal protein S7 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsG PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|P0CI74|GPSB_BACSU	Cell cycle protein GpsB OS=Bacillus subtilis (strain 168) OX=224308 GN=gpsB PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	75-UNIMOD:21	0.16	22.0	2	1	0
PRT	sp|P37810|ATPG_BACSU	ATP synthase gamma chain OS=Bacillus subtilis (strain 168) OX=224308 GN=atpG PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|O05239|YUGJ_BACSU	Probable NADH-dependent butanol dehydrogenase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=yugJ PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O32163|SUFU_BACSU	Zinc-dependent sulfurtransferase SufU OS=Bacillus subtilis (strain 168) OX=224308 GN=sufU PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|O31404|ACOA_BACSU	Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha OS=Bacillus subtilis (strain 168) OX=224308 GN=acoA PE=2 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P36949|RBSB_BACSU	Ribose import binding protein RbsB OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P54375|SODM_BACSU	Superoxide dismutase [Mn] OS=Bacillus subtilis (strain 168) OX=224308 GN=sodA PE=1 SV=5	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|P39120|CISY2_BACSU	Citrate synthase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=citZ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	334-UNIMOD:35	0.05	21.0	2	1	0
PRT	sp|P09339|ACNA_BACSU	Aconitate/2-methylaconitate hydratase OS=Bacillus subtilis (strain 168) OX=224308 GN=citB PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|O34334|YJOA_BACSU	Uncharacterized protein YjoA OS=Bacillus subtilis (strain 168) OX=224308 GN=yjoA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|P39808|YVYG_BACSU	Uncharacterized protein YvyG OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyG PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	null	49-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P02394|RL7_BACSU	50S ribosomal protein L7/L12 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplL PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.20	20.0	2	2	2
PRT	sp|P42175|NARG_BACSU	Nitrate reductase alpha chain OS=Bacillus subtilis (strain 168) OX=224308 GN=narG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	1130-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P37870|RPOB_BACSU	DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=rpoB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	625-UNIMOD:4	0.03	20.0	2	2	2
PRT	sp|P45694|TKT_BACSU	Transketolase OS=Bacillus subtilis (strain 168) OX=224308 GN=tkt PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P54419|METK_BACSU	S-adenosylmethionine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=metK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P36947|RBSA_BACSU	Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) OX=224308 GN=rbsA PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null	356-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P0CI78|RL24_BACSU	50S ribosomal protein L24 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplX PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.31	20.0	1	1	1
PRT	sp|P80643|ACP_BACSU	Acyl carrier protein OS=Bacillus subtilis (strain 168) OX=224308 GN=acpA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.21	20.0	1	1	1
PRT	sp|P27206|SRFAA_BACSU	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|P19946|RL15_BACSU	50S ribosomal protein L15 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplO PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	null	55-UNIMOD:35	0.14	20.0	1	1	1
PRT	sp|O31645|PTN3B_BACSU	PTS system mannose-specific EIIBCA component OS=Bacillus subtilis (strain 168) OX=224308 GN=manP PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	473-UNIMOD:21,541-UNIMOD:21,477-UNIMOD:21	0.06	19.0	3	2	1
PRT	sp|Q08352|DHA_BACSU	Alanine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ald PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|O31605|PEPF_BACSU	Oligoendopeptidase F homolog OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbG PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P37877|ACKA_BACSU	Acetate kinase OS=Bacillus subtilis (strain 168) OX=224308 GN=ackA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P13714|LDH_BACSU	L-lactate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ldh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	78-UNIMOD:4,80-UNIMOD:4,208-UNIMOD:28	0.10	18.0	2	2	2
PRT	sp|P54941|YXEB_BACSU	Iron(3+)-hydroxamate-binding protein YxeB OS=Bacillus subtilis (strain 168) OX=224308 GN=yxeB PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O32119|YUTI_BACSU	Putative nitrogen fixation protein YutI OS=Bacillus subtilis (strain 168) OX=224308 GN=yutI PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	61-UNIMOD:4	0.15	18.0	1	1	1
PRT	sp|P21882|ODPB_BACSU	Pyruvate dehydrogenase E1 component subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=pdhB PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	2	2	2
PRT	sp|P80870|GS13_BACSU	General stress protein 13 OS=Bacillus subtilis (strain 168) OX=224308 GN=yugI PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	121-UNIMOD:35	0.10	18.0	1	1	1
PRT	sp|Q796Y8|BCP_BACSU	Peroxiredoxin Bcp OS=Bacillus subtilis (strain 168) OX=224308 GN=ygaF PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.15	18.0	1	1	1
PRT	sp|P38021|OAT_BACSU	Ornithine aminotransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=rocD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	140-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|P49814|MDH_BACSU	Malate dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdh PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P54471|TRMK_BACSU	tRNA (adenine(22)-N(1))-methyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=trmK PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.11	18.0	1	1	1
PRT	sp|P46320|LICH_BACSU	Probable 6-phospho-beta-glucosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=licH PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	320-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|P28368|HPF_BACSU	Ribosome hibernation promotion factor OS=Bacillus subtilis (strain 168) OX=224308 GN=yvyD PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	73-UNIMOD:35	0.10	18.0	2	1	0
PRT	sp|O06491|GATA_BACSU	Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=gatA PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P13243|ALF_BACSU	Probable fructose-bisphosphate aldolase OS=Bacillus subtilis (strain 168) OX=224308 GN=fbaA PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	null	88-UNIMOD:21,93-UNIMOD:4	0.12	18.0	2	2	2
PRT	sp|O07513|HIT_BACSU	Protein hit OS=Bacillus subtilis (strain 168) OX=224308 GN=hit PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	null		0.14	18.0	1	1	1
PRT	sp|O32139|PUCJ_BACSU	Uric acid permease PucJ OS=Bacillus subtilis (strain 168) OX=224308 GN=pucJ PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	null	306-UNIMOD:21	0.08	18.0	1	1	1
PRT	sp|O34597|YFKL_BACSU	Uncharacterized MFS-type transporter YfkL OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkL PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	null	58-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|O32210|GR_BACSU	Glyoxal reductase OS=Bacillus subtilis (strain 168) OX=224308 GN=yvgN PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null	160-UNIMOD:35	0.06	17.0	1	1	1
PRT	sp|Q45477|SYI_BACSU	Isoleucine--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=ileS PE=3 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|O31777|BIOF1_BACSU	8-amino-7-oxononanoate synthase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=kbl PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P14949|THIO_BACSU	Thioredoxin OS=Bacillus subtilis (strain 168) OX=224308 GN=trxA PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.14	17.0	1	1	1
PRT	sp|P20277|RL17_BACSU	50S ribosomal protein L17 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplQ PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|P0CI73|GLMS_BACSU	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) OX=224308 GN=glmS PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|O07636|YLAL_BACSU	Uncharacterized protein YlaL OS=Bacillus subtilis (strain 168) OX=224308 GN=ylaL PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.14	17.0	1	1	1
PRT	sp|P24141|OPPA_BACSU	Oligopeptide-binding protein OppA OS=Bacillus subtilis (strain 168) OX=224308 GN=oppA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|P24072|CHEY_BACSU	Chemotaxis protein CheY OS=Bacillus subtilis (strain 168) OX=224308 GN=cheY PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	null		0.16	17.0	1	1	1
PRT	sp|P12045|PURK_BACSU	N5-carboxyaminoimidazole ribonucleotide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=purK PE=3 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|O31755|SYP_BACSU	Proline--tRNA ligase OS=Bacillus subtilis (strain 168) OX=224308 GN=proS PE=3 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P42435|NASD_BACSU	Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) OX=224308 GN=nasD PE=2 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P14193|KPRS_BACSU	Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) OX=224308 GN=prs PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P45913|YQAP_BACSU	Uncharacterized protein YqaP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqaP PE=4 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P21464|RS2_BACSU	30S ribosomal protein S2 OS=Bacillus subtilis (strain 168) OX=224308 GN=rpsB PE=1 SV=3	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P39789|YPOC_BACSU	Uncharacterized protein YpoC OS=Bacillus subtilis (strain 168) OX=224308 GN=ypoC PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null	117-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P39148|GLYA_BACSU	Serine hydroxymethyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=glyA PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P80886|SUCC_BACSU	Succinate--CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis (strain 168) OX=224308 GN=sucC PE=1 SV=2	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	null	193-UNIMOD:4,210-UNIMOD:35	0.06	16.0	1	1	1
PRT	sp|P42921|RL4_BACSU	50S ribosomal protein L4 OS=Bacillus subtilis (strain 168) OX=224308 GN=rplD PE=1 SV=1	null	null	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	1	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=13345	43.983193	4	4270.160973	4269.171287	K	Q	35	77
PSM	ATDLQSIQDEISALTDEIDGISNR	2	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=34268	83.389	3	2603.2562	2603.2562	K	T	106	130
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	3	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=26756	68.743	3	2901.3727	2901.3727	K	T	61	91
PSM	EEGAVEEGNTVVLDFEGFVDGEAFEGGK	4	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=34161	83.201	3	2929.3141	2929.3141	K	A	156	184
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	5	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:35	ms_run[1]:scan=11523	40.560893	4	4286.156024	4285.166202	K	Q	35	77
PSM	AMDAEAGVMISASHNPVQDNGIK	6	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35,9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14526	46.137	3	2466.0556	2466.0556	K	F	88	111
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	7	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	37.0	28-UNIMOD:21	ms_run[2]:scan=34316	83.471	4	3557.882	3557.8820	K	R	144	176
PSM	AIEAVDECLGEVVDAILAK	8	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=34207	83.281	3	2014.0293	2014.0293	K	G	417	436
PSM	VPTPNVSLVDLVAELNQEVTAEEVNAALK	9	sp|P09124|G3P1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=34293	83.431	3	3061.6183	3061.6183	R	E	234	263
PSM	ADDNVVDAEYEEVNDDQNKK	10	sp|P17820|DNAK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13332	43.958	3	2308.9931	2308.9931	K	-	592	612
PSM	GGTEVHFGEFGIQALEASWITNR	11	sp|P14577|RL16_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=29497	74.054	3	2518.2241	2518.2241	K	Q	23	46
PSM	CDMVDDEELLELVEMEVR	12	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35	ms_run[1]:scan=34391	83.601291	2	2221.9458	2221.9424	K	D	139	157
PSM	CDMVDDEELLELVEMEVR	13	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4	ms_run[2]:scan=34080	83.062	2	2222.9745	2222.9745	K	D	139	157
PSM	GILGYSEEPLVSGDYNGNK	14	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20548	57.089	2	2010.9535	2010.9535	K	N	271	290
PSM	NSLIEAVCELDEELMDK	15	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=34179	83.234	2	2006.9177	2006.9177	R	Y	212	229
PSM	CDMVDDEELLELVEMEVR	16	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=32046	79.058	3	2254.9644	2254.9644	K	D	139	157
PSM	CDMVDDEELLELVEMEVR	17	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4	ms_run[2]:scan=34070	83.044	3	2222.9745	2222.9745	K	D	139	157
PSM	HSDDMGITAENVTVDFTK	18	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35	ms_run[2]:scan=16723	50.125	3	1994.8891	1994.8891	K	V	70	88
PSM	SLEEGQEVSFEIVEGNR	19	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20518	57.036	2	1920.9065	1920.9065	K	G	40	57
PSM	CDMVDDEELLELVEMEVR	20	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=34312	83.465144	2	2237.9387	2237.9373	K	D	139	157
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	21	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=17691	51.879741	3	3677.479928	3676.493232	K	R	107	145
PSM	DLLSEYDFPGDDVPVVK	22	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=27192	69.573	2	1906.92	1906.9200	R	G	157	174
PSM	CDMVDDEELLELVEMEVR	23	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=34536	83.855785	2	2206.9502	2205.9472	K	D	139	157
PSM	ALEEVIYFASYVVTDPANTPLEK	24	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=34053	83.013	3	2568.2999	2568.2999	R	K	124	147
PSM	DYTIWAVSGDSVQNHIDK	25	sp|P46318|PTJB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20479	56.963	3	2046.9647	2046.9647	K	A	30	48
PSM	GPLTTPVGGGIRSLNVALR	26	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=21685	59.197	3	1957.051	1957.0510	K	Q	92	111
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	27	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=34170	83.218	4	3573.8769	3573.8769	K	R	144	176
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	28	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=20245	56.532	3	2762.3037	2762.3037	K	E	92	119
PSM	NSLIEAVCELDEELMDK	29	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=34160	83.2	3	2006.9177	2006.9177	R	Y	212	229
PSM	RPNTDELGLEQVGIEMTDR	30	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:35	ms_run[2]:scan=16609	49.917	3	2188.043	2188.0430	R	G	276	295
PSM	RPNTDELGLEQVGIEMTDR	31	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20989	57.911	3	2172.0481	2172.0481	R	G	276	295
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	32	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=11062	39.678844	6	4285.168865	4285.166202	K	Q	35	77
PSM	DVSYMDSTGLGVFVGTFK	33	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=30427	75.853	3	2017.8744	2017.8744	K	M	50	68
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	34	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=34042	82.993	4	3532.6587	3532.6587	K	G	66	97
PSM	STALLPLVGDIDTER	35	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=27638	70.449	2	1678.8179	1678.8179	K	A	174	189
PSM	TLEEGQAVSFEIVEGNR	36	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20511	57.022	2	1876.9167	1876.9167	K	G	40	57
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	37	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=16297	49.334825	4	3677.483798	3676.493232	K	R	107	145
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	38	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=24826	65.043594	3	2753.296921	2752.289994	K	M	38	63
PSM	AIEAVDECLGEVVDAILAK	39	sp|P39773|GPMI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=34203	83.275	2	2014.0293	2014.0293	K	G	417	436
PSM	ELGVEVYSVSTDTHFVHK	40	sp|P80239|AHPC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16949	50.524	3	2046.0058	2046.0058	K	G	63	81
PSM	GIAQAANTTGVPVIFGIVTTENIEQAIER	41	sp|P11998|RISB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=34081	83.063	3	3011.5928	3011.5928	K	A	99	128
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIRG	42	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=34094	83.085	3	3589.6802	3589.6802	K	-	66	98
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	43	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16022	48.826	4	3676.4932	3676.4932	K	R	107	145
PSM	QLNAYGGIVVTASHNPPEYNGYK	44	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=18110	52.643	3	2571.1795	2571.1795	R	V	134	157
PSM	REEFLSEAQSLVQHSR	45	sp|P94425|YCNE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=20864	57.687	3	1994.9211	1994.9211	K	A	15	31
PSM	STALLPLVGDIDTER	46	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=27631	70.436	3	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTERAK	47	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=23553	62.634	2	1877.95	1877.9500	K	F	174	191
PSM	AVDSVFDTILDALK	48	sp|P08821|DBH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=34282	83.412	2	1505.7977	1505.7977	K	N	24	38
PSM	HYAHVDCPGHADYVK	49	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4	ms_run[2]:scan=6653	30.548	4	1767.7787	1767.7787	R	N	77	92
PSM	LEHTINNLSASGENLTAAESR	50	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13507	44.282	3	2226.0877	2226.0877	R	I	242	263
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIR	51	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35	ms_run[2]:scan=34029	82.971	3	3532.6587	3532.6587	K	G	66	97
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	52	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=20214	56.478	3	2762.3037	2762.3037	K	E	92	119
PSM	RLVPGYEAPCYVAWSAQNR	53	sp|P12425|GLN1A_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=18736	53.776	3	2236.0848	2236.0848	K	S	298	317
PSM	STALLPLVGDIDTER	54	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=27900	70.956	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTERAK	55	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=23543	62.613	3	1877.95	1877.9500	K	F	174	191
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	56	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=17972	52.387254	3	3678.470150	3676.493232	K	R	107	145
PSM	AMDAEAGVMISASHNPVQDNGIK	57	sp|O34824|GLMM_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=16514	49.729	3	2450.0607	2450.0607	K	F	88	111
PSM	DGHHVELAANIGTPDDVK	58	sp|P08838|PT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12130	41.707	3	1886.9123	1886.9123	K	G	265	283
PSM	DTYSVIGGGDSAAAVEK	59	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13614	44.476	2	1638.7737	1638.7737	K	F	343	360
PSM	GSEHPHEAQKPEVYELR	60	sp|P70974|RL13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7967	33.544	3	2004.9654	2004.9654	R	G	128	145
PSM	HELTIEEADNDLDGLNYLAGK	61	sp|P80860|G6PI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23991	63.487	3	2329.1074	2329.1074	K	T	336	357
PSM	NFDVLDEETGLADR	62	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21090	58.093	2	1592.7318	1592.7318	R	G	107	121
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	63	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16011	48.807	3	3676.4932	3676.4932	K	R	107	145
PSM	STALLPLVGDIDTERAK	64	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=23806	63.141	2	1877.95	1877.9500	K	F	174	191
PSM	CDMVDDEELLELVEMEVR	65	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=34321	83.481413	3	2237.9415	2237.9373	K	D	139	157
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	66	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=11550	40.613908	5	4286.157630	4285.166202	K	Q	35	77
PSM	DGFYQIVNVQSDAAAVQEFDR	67	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=28109	71.375	3	2371.1081	2371.1081	R	L	57	78
PSM	DVSYMDSTGLGVFVGTFK	68	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30483	75.961	2	2017.8744	2017.8744	K	M	50	68
PSM	EGAEQIISEIQNQLQNLK	69	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=33637	82.254	3	2054.0644	2054.0644	K	-	79	97
PSM	HVIISNASCTTNCLAPVVK	70	sp|O34425|G3P2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=13934	45.047	3	2083.0554	2083.0554	R	V	144	163
PSM	LAQLAVESIREEGGDAQFIAVR	71	sp|P08164|NADE_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21508	58.862	3	2371.2496	2371.2496	R	L	58	80
PSM	RDDQPIGVIPIDSIYTPVSR	72	sp|P20429|RPOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23610	62.742	3	2240.1801	2240.1801	K	V	156	176
PSM	STALLPLVGDIDTERAK	73	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=23795	63.122	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	74	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=24064	63.628	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	75	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=24332	64.129	3	1877.95	1877.9500	K	F	174	191
PSM	CDMVDDEELLELVEMEVR	76	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=33681	82.342	3	2238.9694	2238.9694	K	D	139	157
PSM	EGAEQIISEIQNQLQNLK	77	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:21	ms_run[2]:scan=34319	83.479	3	2134.0307	2134.0307	K	-	79	97
PSM	GMDIVIVTTANTDEEAR	78	sp|P12877|RL5_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:35	ms_run[2]:scan=14416	45.938	2	1849.8728	1849.8728	R	E	151	168
PSM	HSDDMGITAENVTVDFTK	79	sp|P21880|DLDH1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19301	54.829	3	1978.8942	1978.8942	K	V	70	88
PSM	KQELLQSLEVGSVLDGK	80	sp|P38494|RS1H_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22177	60.096	3	1842.0098	1842.0098	K	V	178	195
PSM	LLGYSINQQIENDR	81	sp|P39779|CODY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18004	52.443	2	1661.8373	1661.8373	K	M	48	62
PSM	MREDDLLIITADHGNDPIHHGTDHTR	82	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:35	ms_run[2]:scan=13659	44.553	5	2994.4002	2994.4002	K	E	318	344
PSM	SIMGVMSLGIAK	83	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:21,3-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=16601	49.899	2	1317.6074	1317.6074	K	G	46	58
PSM	STALLPLVGDIDTER	84	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=27384	69.936	2	1678.8179	1678.8179	K	A	174	189
PSM	TAENDGYEAIQLGFDDKR	85	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18220	52.837	3	2040.9389	2040.9389	K	E	40	58
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	86	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=11926	41.31866	5	5133.5832	5133.5797	K	I	35	84
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	87	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18541	53.419641	3	3678.470150	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	88	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17700	51.896077	4	3677.481290	3676.493232	K	R	107	145
PSM	AAVEEGIVSGGGTALVNVYNK	89	sp|P28598|CH60_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19740	55.629	3	2047.0586	2047.0586	R	V	403	424
PSM	ASLETDSFLSAASFQETTR	90	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23464	62.46	3	2059.9698	2059.9698	K	V	1126	1145
PSM	DAVISLLADTNADQIEGDK	91	sp|P23452|FLIL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24895	65.171	2	1986.9746	1986.9746	K	G	89	108
PSM	DRPAVTYNGQSWTYGELNAK	92	sp|Q04747|SRFAB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17409	51.356	3	2269.0764	2269.0764	K	A	2556	2576
PSM	DSGDTVQVGEIIGTISEGAGESSAPAPTEK	93	sp|P16263|ODO2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=27023	69.25	3	2901.3727	2901.3727	K	T	61	91
PSM	DSLTEDEELTVLSR	94	sp|P54464|YQEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20647	57.271	2	1605.7734	1605.7734	K	E	43	57
PSM	DVEVTFPEEYHAEDLAGK	95	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19281	54.794	3	2047.9375	2047.9375	K	P	214	232
PSM	DVSYMDSTGLGVFVGTFK	96	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:21	ms_run[2]:scan=33164	81.305	2	2001.8795	2001.8795	K	M	50	68
PSM	GLNTAVGDEGGFAPNLGSNEEALQTIVEAIEK	97	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=34038	82.988	3	3242.5943	3242.5943	K	A	197	229
PSM	NGEFIDVTNEDLK	98	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17532	51.588	2	1492.7046	1492.7046	K	G	18	31
PSM	QLNAYGGIVVTASHNPPEYNGYK	99	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:21	ms_run[2]:scan=17836	52.134	3	2571.1795	2571.1795	R	V	134	157
PSM	SQNFGQVSNAFVR	100	sp|P80875|G16U_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=19087	54.441	2	1532.6773	1532.6773	R	I	119	132
PSM	TLEEGQAVSFEIVEGNR	101	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20233	56.512	2	1876.9167	1876.9167	K	G	40	57
PSM	TLEEGQAVSFEIVEGNR	102	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20789	57.545	2	1876.9167	1876.9167	K	G	40	57
PSM	VGDEVEIIGLQEENK	103	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18497	53.34	3	1670.8363	1670.8363	K	K	240	255
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	104	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	24.0	10-UNIMOD:35	ms_run[1]:scan=10401	38.402898	6	5149.5803	5149.5747	K	I	35	84
PSM	PHPLTNETAPVTMGHEFSGEVVEVGEGVENYK	105	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=22404	60.518037	4	3454.619248	3452.619450	K	V	56	88
PSM	MSDLLQDVNQQLDQTANTLESTDQDIANQIRG	106	sp|C0SP85|YUKE_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35	ms_run[1]:scan=34096	83.08782	4	3589.688272	3589.680213	K	-	66	98
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	107	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=38003	94.634429	3	3677.476598	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	108	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19086	54.439288	3	3676.478054	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	109	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18260	52.907885	3	3678.470150	3676.493232	K	R	107	145
PSM	NNEHLDILSNIAIICSEEENIER	110	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=29031	73.173994	3	2805.284541	2804.268805	K	L	103	126
PSM	DAAFADIFTAVQQHAVEAER	111	sp|Q04747|SRFAB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=29034	73.178	3	2188.0549	2188.0549	R	Y	308	328
PSM	DGLVDVLQGEYNLLNR	112	sp|P46336|IOLS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=32081	79.126	2	1816.9319	1816.9319	K	E	168	184
PSM	DRPAVTYNGQSWTYGELNAK	113	sp|Q04747|SRFAB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17437	51.41	3	2269.0764	2269.0764	K	A	2556	2576
PSM	DVEDVVATILNR	114	sp|Q03224|GLPX_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=31581	78.11	2	1342.7092	1342.7092	K	E	153	165
PSM	DVLQVVIGDGEEIGNVFTSSPK	115	sp|P94428|GABD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=34234	83.33	3	2302.1693	2302.1693	K	I	181	203
PSM	DVSYMDSTGLGVFVGTFK	116	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30215	75.447	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	117	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30750	76.478	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	118	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:21	ms_run[2]:scan=34244	83.348	2	2001.8795	2001.8795	K	M	50	68
PSM	MQEASNGKDTMTGHWEIMGLYIDK	119	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=23036	61.673	4	2866.2013	2866.2013	K	P	78	102
PSM	NANFTGEHFADQEFDVNAVTEK	120	sp|P34957|QOX2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19065	54.395	3	2482.1037	2482.1037	R	D	211	233
PSM	RQENFAEEVMNQVK	121	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:35	ms_run[2]:scan=14330	45.781	3	1736.8152	1736.8152	K	K	279	293
PSM	STALLPLVGDIDTER	122	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:21	ms_run[2]:scan=27896	70.946	3	1678.8179	1678.8179	K	A	174	189
PSM	TPINEDGTVEIITEGSEEGLQIMR	123	sp|P18255|SYT1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=28870	72.866	3	2630.2745	2630.2745	R	H	52	76
PSM	VGDEVEIIGLQEENK	124	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18444	53.24	2	1670.8363	1670.8363	K	K	240	255
PSM	VTVELSPYDLTR	125	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:21	ms_run[2]:scan=20887	57.73	2	1471.696	1471.6960	K	G	53	65
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	126	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13378	44.040497	5	4270.161962	4269.171287	K	Q	35	77
PSM	NSLIEAVCELDEELMDK	127	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=34315	83.469389	2	2023.897382	2022.912574	R	Y	212	229
PSM	GNQMPDDVNALSPQIIIGAQYIQTAGVALGLK	128	sp|P21881|ODPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:35	ms_run[1]:scan=34086	83.069999	3	3310.724810	3310.723128	R	K	131	163
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	129	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=22432	60.568267	3	3677.476147	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	130	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=33802	82.57114	3	3677.476401	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	131	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=17983	52.4063	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	132	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16286	49.312043	3	3677.483494	3676.493232	K	R	107	145
PSM	ADIDYATSEADTTYGK	133	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11993	41.447	2	1719.7475	1719.7475	R	L	179	195
PSM	DFATSELEDNPAYQYAVVR	134	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:21	ms_run[2]:scan=27690	70.552	2	2266.9784	2266.9784	K	N	239	258
PSM	DLGVDYCVIGHSER	135	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:4	ms_run[2]:scan=15793	48.413	2	1618.741	1618.7410	K	R	85	99
PSM	DQTPAHLSLSQELK	136	sp|O32165|SUFD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14134	45.415	3	1565.8049	1565.8049	R	D	97	111
PSM	DYADFLHEDLK	137	sp|P21465|RS3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20212	56.475	2	1364.6248	1364.6248	K	I	27	38
PSM	EGAEQIISEIQNQLQNLK	138	sp|P08874|ABRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:21	ms_run[2]:scan=34314	83.468	2	2134.0307	2134.0307	K	-	79	97
PSM	ERTGNDAMEVFEQALK	139	sp|P21469|RS7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23183	61.948	3	1836.8676	1836.8676	K	N	52	68
PSM	GITISTAHVEYETETR	140	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13633	44.509	3	1805.8796	1805.8796	R	H	61	77
PSM	GRNPQTGEEIEIPASK	141	sp|P08821|DBH1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9830	37.317	3	1724.8693	1724.8693	K	V	60	76
PSM	KQPVQSNTTNFDILK	142	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:21	ms_run[2]:scan=16096	48.958	3	1811.8819	1811.8819	K	R	68	83
PSM	LISFLQNELNVNK	143	sp|P39126|IDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23622	62.767	2	1530.8406	1530.8406	K	I	166	179
PSM	MQEASNGKDTMTGHWEIMGLYIDK	144	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=18989	54.256	4	2882.1962	2882.1962	K	P	78	102
PSM	QAAITQEITEIVGGAAALE	145	sp|P37810|ATPG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=34107	83.107	2	1883.984	1883.9840	R	-	269	288
PSM	RSGLYDQVIEQLNK	146	sp|O05239|YUGJ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20169	56.4	3	1661.8737	1661.8737	K	A	44	58
PSM	SFNANLDTLYR	147	sp|O32163|SUFU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:21	ms_run[2]:scan=21264	58.424	2	1392.6075	1392.6075	M	Q	2	13
PSM	STALLPLVGDIDTERAK	148	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:21	ms_run[2]:scan=24611	64.646	3	1877.95	1877.9500	K	F	174	191
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	149	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,9-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=20178	56.416318	3	2762.305914	2762.303737	K	E	92	119
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	150	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=11253	40.042126	4	4285.170296	4285.166202	K	Q	35	77
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	151	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=27299	69.775995	3	3677.476800	3676.493232	K	R	107	145
PSM	SLEEGQEVSFEIVEGNR	152	sp|P51777|CSPD_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=20866	57.689574	2	1920.909244	1920.906501	K	G	40	57
PSM	QLNAYGGIVVTASHNPPEYNGYK	153	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=22307	60.333853	3	2554.1556	2554.1524	R	V	134	157
PSM	AENLEVSDEEVDAELTK	154	sp|P80698|TIG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17645	51.793	2	1889.8742	1889.8742	K	M	369	386
PSM	DFATSELEDNPAYQYAVVR	155	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24974	65.311	3	2187.012	2187.0120	K	N	239	258
PSM	DILAVYQAAEEAIER	156	sp|O31404|ACOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=32084	79.13	2	1689.8574	1689.8574	K	A	217	232
PSM	DILVIGFDGNK	157	sp|P36949|RBSB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22299	60.319	2	1189.6343	1189.6343	K	D	242	253
PSM	DLGVDYCVIGHSER	158	sp|P27876|TPIS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=15808	48.437	3	1618.741	1618.7410	K	R	85	99
PSM	LEITSTPNQDSPLSEGK	159	sp|P54375|SODM_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14193	45.528	2	1814.8898	1814.8898	K	T	141	158
PSM	MQEASNGKDTMTGHWEIMGLYIDK	160	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=19266	54.769	4	2882.1962	2882.1962	K	P	78	102
PSM	MSGWLAHILEQYDNNR	161	sp|P39120|CISY2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=26161	67.587	3	1961.9054	1961.9054	R	L	334	350
PSM	NDLLITSVLSGNR	162	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24201	63.879	2	1400.7623	1400.7623	K	N	537	550
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	163	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15737	48.309	4	3676.4932	3676.4932	K	R	107	145
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	164	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=22236	60.201	3	2746.3088	2746.3088	K	E	92	119
PSM	RDDQPIGVIPIDSIYTPVSR	165	sp|P20429|RPOA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23551	62.627	3	2240.1801	2240.1801	K	V	156	176
PSM	TDDVVAEIAER	166	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16061	48.899	2	1216.5935	1216.5935	K	T	222	233
PSM	TVAILEQLTEEQLDR	167	sp|O34334|YJOA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=26246	67.747	2	1756.9207	1756.9207	K	E	89	104
PSM	YIQAITQTEDDRIK	168	sp|P39808|YVYG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:21	ms_run[2]:scan=12485	42.375	3	1772.8346	1772.8346	K	T	49	63
PSM	YPIISIEDGLDENDWEGHK	169	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23814	63.156	3	2229.0226	2229.0226	K	L	281	300
PSM	NGEFIDVTNEDLK	170	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19814	55.762671	2	1493.689847	1492.704553	K	G	18	31
PSM	NSQDGISLIQTAEGALTETHAILQR	171	sp|P02968|FLA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=33949	82.82968	3	2666.353165	2665.367122	K	V	65	90
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	172	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21309	58.505459	4	3677.478234	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	173	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18272	52.928269	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	174	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18550	53.43589	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	175	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18820	53.930343	3	3678.470150	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	176	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20084	56.251351	4	3676.475890	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	177	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=22987	61.586267	3	3677.475129	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	178	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19101	54.467688	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	179	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19520	55.224334	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	180	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16847	50.347275	3	3677.479013	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	181	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=34385	83.592912	3	3677.476401	3676.493232	K	R	107	145
PSM	ALNIEEIIASVK	182	sp|P02394|RL7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=29388	73.844	2	1298.7446	1298.7446	M	E	2	14
PSM	DALEIYVDDEK	183	sp|P08874|ABRB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17667	51.835	2	1308.6085	1308.6085	K	I	34	45
PSM	DDAEDTDIKDNDWIECFNR	184	sp|P42175|NARG_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	16-UNIMOD:4	ms_run[2]:scan=22472	60.642	3	2369.9706	2369.9706	K	N	1115	1134
PSM	DDVYTSIHIEEYESEAR	185	sp|P37870|RPOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18521	53.381	3	2054.9069	2054.9069	K	D	784	801
PSM	DWDQEVPVYEK	186	sp|P45694|TKT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17398	51.337	2	1406.6354	1406.6354	K	G	340	351
PSM	EATVLELNDLVK	187	sp|P02394|RL7_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22613	60.901	2	1342.7344	1342.7344	K	A	14	26
PSM	EHVINPVVPEELIDEETK	188	sp|P54419|METK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21337	58.556	3	2089.0579	2089.0579	K	Y	219	237
PSM	ENIALPNLSSFSPK	189	sp|P36947|RBSA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21	ms_run[2]:scan=25887	67.038	2	1595.7596	1595.7596	R	G	348	362
PSM	HSKPTQANPQGGISNQEAPIHVSNVMPLDPK	190	sp|P0CI78|RL24_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15041	47.067	4	3290.6466	3290.6466	K	T	44	75
PSM	IATVGDAVNYIQNQQ	191	sp|P80643|ACP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21181	58.265	2	1632.8107	1632.8107	K	-	63	78
PSM	MSGWLAHILEQYDNNR	192	sp|P39120|CISY2_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=27385	69.938	3	1945.9105	1945.9105	R	L	334	350
PSM	NFDVLDEETGLADR	193	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21415	58.691	2	1592.7318	1592.7318	R	G	107	121
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	194	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:35	ms_run[2]:scan=24469	64.377	3	2730.3139	2730.3139	K	E	92	119
PSM	SGETEDSTIADIAVATNAGQIK	195	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21020	57.965	3	2190.0652	2190.0652	R	T	369	391
PSM	TAENDGYEAIQLGFDDK	196	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20683	57.345	2	1884.8378	1884.8378	K	R	40	57
PSM	TLEEGQAVSFEIVEGNR	197	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20502	57.006	3	1876.9167	1876.9167	K	G	40	57
PSM	CDMVDDEELLELVEMEVR	198	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:35	ms_run[1]:scan=34388	83.597085	3	2221.9455	2221.9424	K	D	139	157
PSM	DRPAVTYNGQSWTYGELNAK	199	sp|P27206|SRFAA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17727	51.94482	3	2270.061937	2269.076360	K	A	2560	2580
PSM	MQEASNGKDTMTGHWEIMGLYIDK	200	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=19549	55.279727	4	2882.185263	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	201	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20121	56.318059	4	2883.182739	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	202	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=23584	62.695363	4	2867.189226	2866.201319	K	P	78	102
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	203	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17415	51.368058	3	3677.479928	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	204	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=28856	72.838507	3	3677.474764	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	205	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19929	55.971389	3	3677.476272	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	206	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19647	55.457244	3	3678.482429	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	207	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24061	63.619532	3	3677.475427	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	208	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=34088	83.076556	3	3677.476401	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	209	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22158	60.058517	3	3678.476390	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	210	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21042	58.00755	3	3678.476071	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	211	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=33542	82.059937	3	3677.475536	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	212	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19369	54.954238	3	3678.470150	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	213	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=33567	82.113399	4	3677.477487	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	214	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20219	56.488572	3	3677.476272	3676.493232	K	R	107	145
PSM	NGSEDRAESIGQLSTDIFNIQTSDR	215	sp|P50848|CBP1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=26987	69.18093	3	2753.278125	2752.289994	K	M	38	63
PSM	SGGGVRPGFEGGQMPLFQR	216	sp|P19946|RL15_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:35	ms_run[1]:scan=14568	46.214105	3	1991.962831	1991.963579	R	L	42	61
PSM	QLNAYGGIVVTASHNPPEYNGYK	217	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=18402	53.162395	3	2571.175409	2571.179519	R	V	134	157
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	218	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	28-UNIMOD:21	ms_run[1]:scan=34311	83.463729	3	3557.884605	3557.882011	K	R	144	176
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	219	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=31761	78.467946	3	3679.477027	3676.493232	K	R	107	145
PSM	IALQELSAPLIPVFENITVMPLVGTIDTERAK	220	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	20.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=34183	83.239735	3	3573.880998	3573.876926	K	R	144	176
PSM	ALEGDAEWEAK	221	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11478	40.475	2	1217.5564	1217.5564	K	I	179	190
PSM	DFATSELEDNPAYQYAVVR	222	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:21	ms_run[2]:scan=27641	70.457	3	2266.9784	2266.9784	K	N	239	258
PSM	DITASPVLSETAPTSAPSEAAAANEIK	223	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	14-UNIMOD:21	ms_run[2]:scan=20538	57.071	3	2720.2794	2720.2794	K	Q	460	487
PSM	DVSYMDSTGLGVFVGTFK	224	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21	ms_run[2]:scan=34222	83.309	3	2001.8795	2001.8795	K	M	50	68
PSM	HEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	225	sp|P49786|BCCP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14107	45.365	5	4141.0763	4141.0763	K	Q	36	77
PSM	KVQLVGDDLFVTNTK	226	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18446	53.243	3	1675.9145	1675.9145	K	K	308	323
PSM	MQEASNGKDTMTGHWEIMGLYIDK	227	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=23024	61.653	3	2866.2013	2866.2013	K	P	78	102
PSM	PGSVIVDVAIDQGGIVETVDHITTHDQPTYEK	228	sp|Q08352|DHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=27093	69.382	4	3432.7049	3432.7049	K	H	258	290
PSM	QITHGNFINFLESENR	229	sp|O31605|PEPF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21951	59.686	3	1917.9333	1917.9333	K	E	262	278
PSM	SGETEDSTIADIAVATNAGQIK	230	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:21	ms_run[2]:scan=23596	62.716	2	2270.0315	2270.0315	R	T	369	391
PSM	TGQTADEVLNTLNK	231	sp|P37877|ACKA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16118	48.996	2	1502.7577	1502.7577	K	K	255	269
PSM	VTVELSPYDLTR	232	sp|P20458|IF1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:21	ms_run[2]:scan=20620	57.222	2	1471.696	1471.6960	K	G	53	65
PSM	GIYPSSANYSTDLHSLGQYVQEGR	233	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22242	60.213009	3	2641.243931	2641.240859	K	R	298	322
PSM	RQENFAEEVMNQVK	234	sp|P80700|EFTS_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=14693	46.440845	3	1736.816426	1736.815184	K	K	279	293
PSM	MQEASNGKDTMTGHWEIMGLYIDK	235	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20120	56.31667	3	2883.182915	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	236	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=24116	63.718743	4	2867.187186	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	237	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,5-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=23572	62.671333	3	2867.190952	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	238	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,10-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=21600	59.048913	4	2867.187421	2866.201319	K	P	78	102
PSM	NEDVTIVMGVNEDQFDAER	239	sp|O34425|G3P2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:35	ms_run[1]:scan=17961	52.368196	3	2195.971913	2195.964092	K	H	125	144
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	240	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21597	59.040992	3	3678.476390	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	241	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22423	60.551995	4	3677.478101	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	242	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33829	82.620249	4	3676.478521	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	243	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19800	55.735559	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	244	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21881	59.554403	3	3678.483362	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	245	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25970	67.205944	3	3678.475537	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	246	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26236	67.729709	3	3678.475537	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	247	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18824	53.939657	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	248	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=28328	71.809616	3	3677.474828	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	249	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27034	69.269249	3	3677.476800	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	250	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34121	83.133946	4	3676.478521	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	251	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27207	69.601673	4	3676.478464	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	252	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16858	50.366421	4	3677.481076	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	253	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23256	62.083377	4	3678.481069	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	254	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21038	57.99817	4	3677.478234	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	255	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22150	60.043612	4	3677.478101	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	256	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26298	67.851463	4	3676.477965	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	257	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=29931	74.902283	3	3677.477818	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	258	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27474	70.10362	4	3676.478464	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	259	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22714	61.083739	3	3677.476147	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	260	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34418	83.650214	4	3676.478521	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	261	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25158	65.666605	3	3677.476377	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	262	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23792	63.113493	3	3677.475427	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	263	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21866	59.525848	4	3677.478101	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	264	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16566	49.827519	3	3677.483494	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	265	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=34663	84.10199	3	3677.477603	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	266	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=28591	72.31937	3	3677.474828	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	267	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=30462	75.920346	3	3677.478392	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	268	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=33311	81.602121	4	3677.477487	3676.493232	K	R	107	145
PSM	KQPVQSNTTNFDILK	269	sp|P0CI74|GPSB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=16753	50.178173	3	1811.884205	1811.881880	K	R	68	83
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	270	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=31240	77.436351	3	3679.477027	3676.493232	K	R	107	145
PSM	STALLPLVGDIDTER	271	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=28158	71.470206	2	1679.814738	1678.817883	K	A	174	189
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	272	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	19.0	28-UNIMOD:21	ms_run[1]:scan=34533	83.851613	4	3358.758345	3358.749934	K	A	144	174
PSM	DADIVCICAGANQKPGETR	273	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=12313	42.048	3	2073.9572	2073.9572	K	L	73	92
PSM	DATFGIYENTDK	274	sp|P54941|YXEB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15298	47.527	2	1372.6147	1372.6147	K	G	185	197
PSM	DGGDCELVDVDEGIVK	275	sp|O32119|YUTI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=19506	55.201	2	1718.7669	1718.7669	R	L	57	73
PSM	DGISAEVVDLR	276	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18047	52.525	2	1172.6037	1172.6037	K	T	227	238
PSM	DKLEEWIEMSNR	277	sp|P80870|GS13_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:35	ms_run[2]:scan=18933	54.148	3	1564.7192	1564.7192	K	K	113	125
PSM	DLLSEYDFPGDDVPVVK	278	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27215	69.617	3	1906.92	1906.9200	R	G	157	174
PSM	DSHESFAELDAVIIGVSPDSQEK	279	sp|Q796Y8|BCP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26839	68.897	3	2472.1656	2472.1656	R	H	54	77
PSM	GPLTTPVGGGIRSLNVALR	280	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=21969	59.719	3	1957.051	1957.0510	K	Q	92	111
PSM	GQATITEIDGTVVEINEVR	281	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21711	59.245	2	2043.0484	2043.0484	K	D	967	986
PSM	GVADNQAEIIACVGNFHGR	282	sp|P38021|OAT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:4	ms_run[2]:scan=19774	55.688	3	2026.9643	2026.9643	K	T	129	148
PSM	HPETGEVLVNENELIDEDK	283	sp|P37871|RPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16581	49.86	3	2179.0281	2179.0281	K	A	854	873
PSM	ITGTSNYEDTAGSDIVVITAGIAR	284	sp|P49814|MDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=25391	66.102	3	2423.218	2423.2180	K	K	64	88
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPK	285	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13065	43.461	4	4269.1713	4269.1713	K	Q	35	77
PSM	KWTQELQHTQSIYEQISQAADTEQNK	286	sp|P54471|TRMK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21129	58.166	4	3103.4847	3103.4847	K	Q	193	219
PSM	MPHNLEEQFEIYTQK	287	sp|P21881|ODPA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=18734	53.774	3	1921.888	1921.8880	K	E	354	369
PSM	NADLGLAFDGDGDR	288	sp|O34824|GLMM_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17569	51.654	2	1434.6375	1434.6375	K	L	232	246
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	289	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=23008	61.623	3	2746.3088	2746.3088	K	E	92	119
PSM	QAEPAAQEVSEEAQSEAK	290	sp|P16263|ODO2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11113	39.772	3	1900.865	1900.8650	K	S	102	120
PSM	QAGIAANVVAEINDR	291	sp|P21882|ODPB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20054	56.198	2	1539.8005	1539.8005	K	A	266	281
PSM	RGALLSESGFK	292	sp|O31645|PTN3B_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:21	ms_run[2]:scan=14717	46.486	2	1243.5962	1243.5962	R	Q	534	545
PSM	RGGAYYSDAACNLISSIYNDK	293	sp|P46320|LICH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=24798	64.989	3	2337.0696	2337.0696	K	H	310	331
PSM	SEVHNEDMYNAIDLATNK	294	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17124	50.832	3	2062.9266	2062.9266	R	L	66	84
PSM	SIMGVMSLGIAK	295	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:35,6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=16324	49.383	2	1317.6074	1317.6074	K	G	46	58
PSM	STALLPLVGDIDTER	296	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=36625	89.769	2	1678.8179	1678.8179	K	A	174	189
PSM	TDNADNLIDLYK	297	sp|O06491|GATA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19875	55.874	2	1393.6725	1393.6725	R	Q	333	345
PSM	TLEEGQAVSFEIVEGNR	298	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21679	59.189	2	1876.9167	1876.9167	K	G	40	57
PSM	VTVPVAIHLDHGSSFESCAK	299	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=18150	52.714	3	2233.0239	2233.0239	K	A	76	96
PSM	VNQIGTLTETFDAIEMAK	300	sp|P37869|ENO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:35	ms_run[1]:scan=27345	69.862919	3	1995.983974	1995.982309	K	R	340	358
PSM	SGETEDSTIADIAVATNAGQIK	301	sp|P37869|ENO_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=23520	62.564509	3	2270.032881	2270.031517	R	T	369	391
PSM	NFDVLDEETGLADR	302	sp|P80239|AHPC_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=22916	61.453344	2	1593.719227	1592.731831	R	G	107	121
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	303	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17424	51.388176	4	3677.481290	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	304	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=30720	76.424735	3	3677.478392	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	305	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=34200	83.271121	2	2018.876997	2017.874412	K	M	50	68
PSM	AIRDEFEPIGLNTLNNNGEK	306	sp|O07513|HIT_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20382	56.779359	3	2244.104125	2243.118225	R	A	74	94
PSM	AEGIAILIGGLFNAFPYNTFAQNAGLLQLTKVK	307	sp|O32139|PUCJ_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	18.0	30-UNIMOD:21	ms_run[1]:scan=34183	83.239735	3	3573.8812	3571.8842	R	T	277	310
PSM	IALQELSAPLIPVFENITVMPLVGTIDTER	308	sp|P42409|RSBRA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=34402	83.620412	3	3374.752745	3374.744849	K	A	144	174
PSM	LLTYGISGVLSDKIGR	309	sp|O34597|YFKL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=22464	60.627312	3	1773.929383	1770.928102	K	K	56	72
PSM	AFAELADVYVNDAFGAAHR	310	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26433	68.113	3	2035.9752	2035.9752	K	A	133	152
PSM	CDMVDDEELLELVEMEVR	311	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4,3-UNIMOD:35	ms_run[2]:scan=33033	81.043	3	2238.9694	2238.9694	K	D	139	157
PSM	DAEIKPMVNQVEFHPR	312	sp|O32210|GR_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:35	ms_run[2]:scan=12209	41.851	3	1924.9465	1924.9465	K	L	154	170
PSM	DDLVRPADLYLEGSDQYR	313	sp|Q45477|SYI_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20662	57.302	3	2124.0124	2124.0124	R	G	542	560
PSM	DELDQALDVIEK	314	sp|O31777|BIOF1_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24991	65.346	2	1386.6878	1386.6878	K	T	373	385
PSM	DGEVVETSVGFKPK	315	sp|P14949|THIO_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11717	40.925	2	1490.7617	1490.7617	K	E	80	94
PSM	DLTTDLIINER	316	sp|P20277|RL17_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21402	58.669	2	1301.6827	1301.6827	R	I	19	30
PSM	DVSYMDSTGLGVFVGTFK	317	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=30471	75.937	2	2017.8744	2017.8744	K	M	50	68
PSM	GPLTTPVGGGIRSLNVALR	318	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=21449	58.754	3	1957.051	1957.0510	K	Q	92	111
PSM	GSYAIALFDNDNR	319	sp|P0CI73|GLMS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21242	58.386	2	1454.679	1454.6790	K	E	154	167
PSM	GTAMAYDQIDGAPEER	320	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:35	ms_run[2]:scan=10582	38.736	2	1738.7468	1738.7468	K	E	43	59
PSM	KGDSQDTYLQSAGDESDLDPER	321	sp|O07636|YLAL_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13581	44.415	3	2425.0517	2425.0517	R	V	33	55
PSM	MGGEQITVQNLEIVK	322	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35	ms_run[2]:scan=19090	54.445	2	1673.8658	1673.8658	R	V	164	179
PSM	MQEASNGKDTMTGHWEIMGLYIDK	323	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=23316	62.19	4	2866.2013	2866.2013	K	P	78	102
PSM	NNEHLDILSNIAIICSEEENIER	324	sp|C0H3V2|PTMA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	15-UNIMOD:4	ms_run[2]:scan=28266	71.687	3	2724.3025	2724.3025	K	L	103	126
PSM	NSLIEAVCELDEELMDK	325	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=33571	82.123	2	2022.9126	2022.9126	R	Y	212	229
PSM	QAIQSTTIAGETVIVSIWEK	326	sp|O34788|BDHA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=28231	71.611	3	2173.163	2173.1630	R	G	252	272
PSM	SEVHNEDMYNAIDLATNK	327	sp|P28368|HPF_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:35	ms_run[2]:scan=13277	43.858	3	2078.9215	2078.9215	R	L	66	84
PSM	STALLPLVGDIDTER	328	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=28685	72.496	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTER	329	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	10-UNIMOD:21	ms_run[2]:scan=27707	70.583	2	1678.8179	1678.8179	K	A	174	189
PSM	STALLPLVGDIDTERAK	330	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=24887	65.155	3	1877.95	1877.9500	K	F	174	191
PSM	STALLPLVGDIDTERAK	331	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=25159	65.668	3	1877.95	1877.9500	K	F	174	191
PSM	VEIFSAGEIVDVTGVSK	332	sp|P42920|RL3_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24479	64.398	2	1748.9196	1748.9196	K	G	99	116
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	333	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,23-UNIMOD:35	ms_run[1]:scan=27159	69.511782	3	2746.326742	2746.308822	K	E	92	119
PSM	MQEASNGKDTMTGHWEIMGLYIDK	334	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,9-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=20616	57.212828	4	2866.199793	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	335	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=19102	54.469067	4	2946.112337	2946.167650	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	336	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=20405	56.826564	4	2883.182739	2882.196234	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	337	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=24107	63.702399	3	2867.187644	2866.201319	K	P	78	102
PSM	MQEASNGKDTMTGHWEIMGLYIDK	338	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=25446	66.20458	4	2851.192636	2850.206404	K	P	78	102
PSM	QEELDQIVDDVK	339	sp|P13714|LDH_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=25698	66.678241	2	1412.6668	1412.6666	K	N	208	220
PSM	NGGNNDTGWENPEFK	340	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16266	49.273098	2	1678.687518	1677.701927	K	K	464	479
PSM	NGGNNDTGWENPEFK	341	sp|P24141|OPPA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16821	50.299683	2	1679.675196	1677.701927	K	K	464	479
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	342	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20754	57.480857	4	3677.478915	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	343	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=21585	59.019292	4	3677.478101	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	344	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=21320	58.524655	3	3678.476071	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	345	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16576	49.848863	4	3677.483798	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	346	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=29168	73.434268	4	3677.477011	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	347	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=32801	80.583168	4	3677.477626	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	348	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=32545	80.071977	4	3677.477626	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	349	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=22984	61.578275	4	3677.477616	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	350	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=38172	95.136851	3	3677.476598	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	351	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=27721	70.610502	4	3676.477480	3676.493232	K	R	107	145
PSM	TLEEGQAVSFEIVEGNR	352	sp|P32081|CSPB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20668	57.314366	3	1878.926052	1876.916671	K	G	40	57
PSM	QLNAYGGIVVTASHNPPEYNGYK	353	sp|P18159|PGCA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=22586	60.852288	3	2555.1432	2554.1522	R	V	134	157
PSM	NGFEVVAEAENGAQAVEK	354	sp|P24072|CHEY_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23922	63.356653	2	1861.873030	1860.885371	K	Y	25	43
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	355	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=31500	77.951905	3	3679.477027	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	356	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19441	55.080787	4	3679.479631	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	357	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=29397	73.864529	3	3679.480541	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	358	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20641	57.258597	4	3679.483191	3676.493232	K	R	107	145
PSM	MQEASNGKDTMTGHWEIMGLYIDK	359	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,5-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=20032	56.160022	4	2949.240697	2946.167650	K	P	78	102
PSM	DDSSAFGAYLHMGGR	360	sp|P80700|EFTS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20661	57.301	3	1582.6834	1582.6834	K	I	147	162
PSM	DGDVLVLENVR	361	sp|P40924|PGK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18957	54.197	2	1227.6459	1227.6459	K	F	108	119
PSM	DGFYQIVNVQSDAAAVQEFDR	362	sp|P21468|RS6_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=27847	70.852	3	2371.1081	2371.1081	R	L	57	78
PSM	DHAYLPQGSELLLITQNR	363	sp|P12045|PURK_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23231	62.033	3	2067.0749	2067.0749	K	E	91	109
PSM	DVSYMDSTGLGVFVGTFK	364	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=31794	78.533	2	2017.8744	2017.8744	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	365	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=32974	80.911	3	2001.8795	2001.8795	K	M	50	68
PSM	EFALGATHEEVITSLVR	366	sp|O31755|SYP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21922	59.634	3	1870.9789	1870.9789	R	D	103	120
PSM	GILGYSEEPLVSGDYNGNK	367	sp|P09124|G3P1_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20522	57.041	3	2010.9535	2010.9535	K	N	271	290
PSM	GIYPSSANYSTDLHSLGQYVQEGR	368	sp|P80860|G6PI_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22246	60.219	3	2641.2409	2641.2409	K	R	298	322
PSM	GNQIVGAVLFGDSSEGNR	369	sp|P42435|NASD_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21670	59.173	2	1818.886	1818.8860	R	L	359	377
PSM	LLDYAEAGDNIGALLR	370	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26550	68.333	2	1702.889	1702.8890	K	G	267	283
PSM	MQEASNGKDTMTGHWEIMGLYIDK	371	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=18988	54.255	3	2882.1962	2882.1962	K	P	78	102
PSM	NDLLITSVLSGNR	372	sp|P09339|ACNA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24475	64.389	2	1400.7623	1400.7623	K	N	537	550
PSM	NLEDIVIVSPDHGGVTR	373	sp|P14193|KPRS_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18602	53.531	3	1819.9428	1819.9428	K	A	165	182
PSM	NLEEPQQLLETLADNLPEQE	374	sp|P45913|YQAP_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=34127	83.142	3	2322.1227	2322.1227	K	-	290	310
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	375	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=22108	59.966	3	2746.3088	2746.3088	K	E	92	119
PSM	QGEEEAEVAEETAPETETTTA	376	sp|P21464|RS2_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12691	42.752	3	2220.9394	2220.9394	K	-	226	247
PSM	QVVSAATACIPFLENDDSNR	377	sp|P37870|RPOB_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:4	ms_run[2]:scan=23463	62.458	3	2206.0324	2206.0324	K	A	617	637
PSM	SIMGVMSLGIAK	378	sp|P08877|PTHP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=22113	59.977	2	1301.6124	1301.6124	K	G	46	58
PSM	SLNVALR	379	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21	ms_run[2]:scan=13183	43.686	2	851.42662	851.4266	R	Q	104	111
PSM	SLNVALR	380	sp|P39126|IDH_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21	ms_run[2]:scan=13464	44.203	2	851.42662	851.4266	R	Q	104	111
PSM	SPVILGVSEGAGR	381	sp|P13243|ALF_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14152	45.447	2	1240.6776	1240.6776	K	Y	43	56
PSM	STALLPLVGDIDTER	382	sp|O34860|RSBRB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	13-UNIMOD:21	ms_run[2]:scan=29225	73.537	2	1678.8179	1678.8179	K	A	174	189
PSM	SYPAKPINWAER	383	sp|P39789|YPOC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21	ms_run[2]:scan=14404	45.914	2	1510.697	1510.6970	K	V	117	129
PSM	TTLTAAITTVLHK	384	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21744	59.307	2	1368.7977	1368.7977	K	K	26	39
PSM	VAEHVLDEIGITSNK	385	sp|P39148|GLYA_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16725	50.128	3	1623.8468	1623.8468	K	N	326	341
PSM	VGDEVEIIGLQEENKK	386	sp|P33166|EFTU_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15734	48.305	3	1798.9313	1798.9313	K	T	240	256
PSM	NMITGAAQMDGAILVVSAADGPMPQTR	387	sp|P33166|EFTU_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	23-UNIMOD:35	ms_run[1]:scan=26283	67.823046	3	2730.315176	2730.313907	K	E	92	119
PSM	KHEAGTVQVMQQAPAAPVQAQAPQAVQPQAQQAAAPAQEAPKQDENLHK	388	sp|P49786|BCCP_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=11915	41.299528	6	5133.5843	5133.5797	K	I	35	84
PSM	NSLIEAVCELDEELMDK	389	sp|P80868|EFG_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=34232	83.326992	3	2023.898888	2022.912574	R	Y	212	229
PSM	MREDDLLIITADHGNDPIHHGTDHTR	390	sp|P46353|DEOB_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35	ms_run[1]:scan=13582	44.416441	4	2994.402158	2994.400231	K	E	318	344
PSM	DCSIAEINPLVVTGDGNVMALDAK	391	sp|P80886|SUCC_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=26055	67.394874	3	2517.211041	2517.209091	K	L	192	216
PSM	DITASPVLSETAPTSAPSEAAAANEIK	392	sp|O31645|PTN3B_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=20257	56.552741	3	2720.282526	2720.279352	K	Q	460	487
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	393	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=33029	81.033524	3	3677.475536	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	394	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23542	62.611264	3	3677.475427	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	395	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26568	68.369141	4	3676.477965	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	396	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=17138	50.859178	3	3677.479928	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	397	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=33055	81.092653	4	3677.477487	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	398	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=20765	57.499865	3	3677.476920	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	399	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=30760	76.49601	4	3677.478075	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	400	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=33286	81.552014	3	3677.475536	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	401	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26757	68.744896	3	3677.476800	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	402	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=25706	66.693202	3	3678.475537	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	403	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=24383	64.223028	4	3676.478674	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	404	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23783	63.097193	4	3677.479151	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	405	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=22703	61.064576	4	3677.477616	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	406	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=31795	78.534457	4	3677.477626	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	407	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=34695	84.171226	4	3676.478727	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	408	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=19105	54.473194	4	3678.472744	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	409	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26941	69.089354	4	3676.478464	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	410	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=30982	76.931166	3	3677.478392	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	411	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32006	78.983641	3	3677.476481	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	412	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32295	79.567383	4	3677.477891	3676.493232	K	R	107	145
PSM	DVSYMDSTGLGVFVGTFK	413	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=31536	78.021049	2	2018.879398	2017.874412	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	414	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=33222	81.420752	3	2001.880929	2001.879497	K	M	50	68
PSM	DVSYMDSTGLGVFVGTFK	415	sp|P17903|RSBV_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=32092	79.145327	2	2018.879398	2017.874412	K	M	50	68
PSM	NIPGVTVVEANGINVLDVVNHEK	416	sp|P42921|RL4_BACSU	1	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=25624	66.540975	3	2430.281426	2429.291438	R	L	169	192
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	417	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=20478	56.961648	4	3679.479631	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	418	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=32510	80.002567	3	3679.481091	3676.493232	K	R	107	145
PSM	NGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQR	419	sp|P37455|SSBA_BACSU	0	userFasta.uniprot_bacsu_20200403	userFasta.uniprot_bacsu_20200403	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=28398	71.954361	3	3679.473585	3676.493232	K	R	107	145