MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr04.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr04.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q15361|TTF1_HUMAN	Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.02	49.0	1	1	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null		0.20	48.0	9	1	0
PRT	sp|Q0VD83|APOBR_HUMAN	Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	637-UNIMOD:21	0.05	46.0	5	3	2
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	1800-UNIMOD:21,1803-UNIMOD:21,1805-UNIMOD:21	0.01	46.0	6	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	5	1	0
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	44.0	2	1	0
PRT	sp|Q6NZI2-3|CAVN1_HUMAN	Isoform 3 of Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	149-UNIMOD:35	0.10	44.0	5	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	538-UNIMOD:35	0.02	44.0	2	1	0
PRT	sp|Q7Z2X4|PCLI1_HUMAN	PTB-containing, cubilin and LRP1-interacting protein OS=Homo sapiens OX=9606 GN=PID1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	247-UNIMOD:21	0.08	44.0	2	1	0
PRT	sp|P50570-3|DYN2_HUMAN	Isoform 3 of Dynamin-2 OS=Homo sapiens OX=9606 GN=DNM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	641-UNIMOD:35	0.03	43.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	92-UNIMOD:35	0.10	43.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.01	43.0	3	1	0
PRT	sp|O95551|TYDP2_HUMAN	Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	182-UNIMOD:21	0.06	43.0	2	1	0
PRT	sp|Q96EZ8|MCRS1_HUMAN	Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	108-UNIMOD:21	0.04	43.0	3	1	0
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	695-UNIMOD:4	0.04	42.0	2	2	2
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	2	1	0
PRT	sp|Q9BQY9-2|DBND2_HUMAN	Isoform 2 of Dysbindin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DBNDD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	115-UNIMOD:21	0.23	42.0	1	1	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	2	1	0
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	231-UNIMOD:35	0.01	41.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	4346-UNIMOD:35,4348-UNIMOD:35	0.00	41.0	1	1	1
PRT	sp|P12110|CO6A2_HUMAN	Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	219-UNIMOD:35	0.02	41.0	3	1	0
PRT	sp|O00505|IMA4_HUMAN	Importin subunit alpha-4 OS=Homo sapiens OX=9606 GN=KPNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|Q9HBB8-2|CDHR5_HUMAN	Isoform 2 of Cadherin-related family member 5 OS=Homo sapiens OX=9606 GN=CDHR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	549-UNIMOD:35,560-UNIMOD:21	0.05	41.0	2	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	282-UNIMOD:21,285-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	766-UNIMOD:35	0.00	41.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	116-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	72-UNIMOD:35,75-UNIMOD:35	0.09	40.0	4	1	0
PRT	sp|P98095|FBLN2_HUMAN	Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	502-UNIMOD:4,510-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	825-UNIMOD:35	0.02	40.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	2	2
PRT	sp|P23142-2|FBLN1_HUMAN	Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	2	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	242-UNIMOD:21,246-UNIMOD:21,244-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	3	3	3
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	3	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	4	1	0
PRT	sp|Q9UI10|EI2BD_HUMAN	Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	465-UNIMOD:4	0.04	40.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q8TB37|NUBPL_HUMAN	Iron-sulfur protein NUBPL OS=Homo sapiens OX=9606 GN=NUBPL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	209-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	123-UNIMOD:21	0.10	39.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	2	2
PRT	sp|P02774|VTDB_HUMAN	Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	74-UNIMOD:4,75-UNIMOD:4,83-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	57-UNIMOD:21	0.15	39.0	1	1	1
PRT	sp|O95359-6|TACC2_HUMAN	Isoform 6 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	395-UNIMOD:21,399-UNIMOD:21	0.02	39.0	3	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	267-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	360-UNIMOD:21,364-UNIMOD:21	0.01	39.0	4	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1090-UNIMOD:35	0.01	39.0	1	1	1
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	101-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	2	1	0
PRT	sp|Q86US8|EST1A_HUMAN	Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.01	39.0	1	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	39.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1065-UNIMOD:35,1071-UNIMOD:21	0.02	39.0	1	1	0
PRT	sp|Q96EZ8-3|MCRS1_HUMAN	Isoform 3 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	95-UNIMOD:21	0.04	38.0	1	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	2	1	0
PRT	sp|P02675|FIBB_HUMAN	Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q86YS3-2|RFIP4_HUMAN	Isoform 2 of Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1679-UNIMOD:21,1681-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|O95251-3|KAT7_HUMAN	Isoform 3 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	10-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	113-UNIMOD:21,116-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q8WVV9-3|HNRLL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|Q969V6|MRTFA_HUMAN	Myocardin-related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	781-UNIMOD:21,783-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	106-UNIMOD:21	0.17	38.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,12-UNIMOD:21,18-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	2	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	427-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1074-UNIMOD:35	0.01	37.0	1	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	330-UNIMOD:4,337-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	17	1	0
PRT	sp|Q5QJE6|TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P28289|TMOD1_HUMAN	Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	154-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|P35443|TSP4_HUMAN	Thrombospondin-4 OS=Homo sapiens OX=9606 GN=THBS4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	477-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	2	1	0
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q9UIC8-3|LCMT1_HUMAN	Isoform 3 of Leucine carboxyl methyltransferase 1 OS=Homo sapiens OX=9606 GN=LCMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	13-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:4	0.08	37.0	2	1	0
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	1	0
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	4	1	0
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	13-UNIMOD:35,17-UNIMOD:35,24-UNIMOD:4	0.26	37.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	688-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	141-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	560-UNIMOD:21,563-UNIMOD:21,557-UNIMOD:21,564-UNIMOD:21	0.05	37.0	4	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	1575-UNIMOD:28,1591-UNIMOD:35,1594-UNIMOD:35,1698-UNIMOD:21	0.02	37.0	4	2	0
PRT	sp|Q5TCZ1|SPD2A_HUMAN	SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	638-UNIMOD:21,639-UNIMOD:21,644-UNIMOD:21,647-UNIMOD:21,648-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	263-UNIMOD:35,266-UNIMOD:4	0.05	36.0	2	1	0
PRT	sp|Q9UMD9-2|COHA1_HUMAN	Isoform 2 of Collagen alpha-1(XVII) chain OS=Homo sapiens OX=9606 GN=COL17A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	85-UNIMOD:21,93-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9BYD6|RM01_HUMAN	39S ribosomal protein L1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	78-UNIMOD:35	0.05	36.0	1	1	1
PRT	sp|P35226|BMI1_HUMAN	Polycomb complex protein BMI-1 OS=Homo sapiens OX=9606 GN=BMI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	328-UNIMOD:4	0.02	36.0	2	1	0
PRT	sp|Q8TCU4-3|ALMS1_HUMAN	Isoform 3 of Alstrom syndrome protein 1 OS=Homo sapiens OX=9606 GN=ALMS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.00	36.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	262-UNIMOD:35	0.05	36.0	1	1	1
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	296-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	589-UNIMOD:35,592-UNIMOD:35,161-UNIMOD:21	0.06	36.0	3	2	1
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	4011-UNIMOD:35,4013-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q7Z2X4-3|PCLI1_HUMAN	Isoform 3 of PTB-containing, cubilin and LRP1-interacting protein OS=Homo sapiens OX=9606 GN=PID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	165-UNIMOD:21	0.12	36.0	2	1	0
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q9UP95-3|S12A4_HUMAN	Isoform 3 of Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P15923|TFE2_HUMAN	Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	311-UNIMOD:21,315-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	16-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	63-UNIMOD:21	0.10	36.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	284-UNIMOD:28,287-UNIMOD:35,296-UNIMOD:35	0.02	36.0	2	1	0
PRT	sp|Q4KMQ1|TPRN_HUMAN	Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	264-UNIMOD:21,274-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.09	35.0	1	1	1
PRT	sp|Q96JK2-2|DCAF5_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 5 OS=Homo sapiens OX=9606 GN=DCAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9C0B7|TNG6_HUMAN	Transport and Golgi organization protein 6 homolog OS=Homo sapiens OX=9606 GN=TANGO6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P53396-2|ACLY_HUMAN	Isoform 2 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	610-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O14936-5|CSKP_HUMAN	Isoform 5 of Peripheral plasma membrane protein CASK OS=Homo sapiens OX=9606 GN=CASK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	33-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q9Y6R4-2|M3K4_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	988-UNIMOD:35,994-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	247-UNIMOD:35,252-UNIMOD:4,253-UNIMOD:21	0.02	35.0	3	1	0
PRT	sp|Q96QG7-2|MTMR9_HUMAN	Isoform 2 of Myotubularin-related protein 9 OS=Homo sapiens OX=9606 GN=MTMR9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	460-UNIMOD:35,463-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9BYB0-3|SHAN3_HUMAN	Isoform 2 of SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1517-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O15119-3|TBX3_HUMAN	Isoform III of T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	93-UNIMOD:35	0.02	35.0	2	1	0
PRT	sp|Q5T5P2-4|SKT_HUMAN	Isoform 4 of Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	197-UNIMOD:35	0.04	35.0	2	1	0
PRT	sp|Q99707|METH_HUMAN	Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1125-UNIMOD:35	0.01	35.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	145-UNIMOD:21,175-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	76-UNIMOD:28	0.10	35.0	1	1	1
PRT	sp|Q8IUW5|RELL1_HUMAN	RELT-like protein 1 OS=Homo sapiens OX=9606 GN=RELL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	88-UNIMOD:385,88-UNIMOD:4	0.06	35.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	145-UNIMOD:28,155-UNIMOD:21,162-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	3	1	0
PRT	sp|Q15771|RAB30_HUMAN	Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	146-UNIMOD:35	0.09	34.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1002-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q12824-2|SNF5_HUMAN	Isoform B of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9H4E7|DEFI6_HUMAN	Differentially expressed in FDCP 6 homolog OS=Homo sapiens OX=9606 GN=DEF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	69-UNIMOD:35	0.03	34.0	3	1	0
PRT	sp|Q6UXT9|ABH15_HUMAN	Protein ABHD15 OS=Homo sapiens OX=9606 GN=ABHD15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	2	2
PRT	sp|Q9BRK4|LZTS2_HUMAN	Leucine zipper putative tumor suppressor 2 OS=Homo sapiens OX=9606 GN=LZTS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	354-UNIMOD:35,355-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q96A26|F162A_HUMAN	Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	91-UNIMOD:35	0.12	34.0	1	1	1
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	125-UNIMOD:21,126-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	30	1	0
PRT	sp|Q9UMS6-5|SYNP2_HUMAN	Isoform 5 of Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	209-UNIMOD:21,214-UNIMOD:35,231-UNIMOD:21	0.06	34.0	2	2	1
PRT	sp|Q8WVV4|POF1B_HUMAN	Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q9Y4E1-3|WAC2C_HUMAN	Isoform 3 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	276-UNIMOD:21,278-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	174-UNIMOD:35	0.02	34.0	2	1	0
PRT	sp|P02768-3|ALBU_HUMAN	Isoform 3 of Serum albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:4,86-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	347-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|P63165|SUMO1_HUMAN	Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.16	34.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	229-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|O76094|SRP72_HUMAN	Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	621-UNIMOD:21,625-UNIMOD:21	0.04	34.0	1	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	67-UNIMOD:4,74-UNIMOD:4,77-UNIMOD:4	0.08	34.0	1	1	1
PRT	sp|O43164-2|PJA2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|O60271-3|JIP4_HUMAN	Isoform 3 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9BRL6-2|SRSF8_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 8 OS=Homo sapiens OX=9606 GN=SRSF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	75-UNIMOD:35	0.07	33.0	1	1	1
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	121-UNIMOD:35,126-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q7Z406-4|MYH14_HUMAN	Isoform 4 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1514-UNIMOD:35,30-UNIMOD:21	0.02	33.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	188-UNIMOD:35,91-UNIMOD:4	0.14	33.0	2	2	2
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	15	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.08	33.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	766-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	518-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q6ZVM7-4|TM1L2_HUMAN	Isoform 4 of TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	420-UNIMOD:35,430-UNIMOD:21,435-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q15746-9|MYLK_HUMAN	Isoform 7 of Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	574-UNIMOD:21,578-UNIMOD:21,238-UNIMOD:21	0.05	33.0	2	2	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	204-UNIMOD:21,214-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	402-UNIMOD:35	0.06	33.0	1	1	1
PRT	sp|P0DJD0|RGPD1_HUMAN	RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RGPD1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P49716|CEBPD_HUMAN	CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	256-UNIMOD:21,268-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q6ZNJ1-2|NBEL2_HUMAN	Isoform 2 of Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2555-UNIMOD:21,2558-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1416-UNIMOD:4	0.02	33.0	2	2	2
PRT	sp|O15075-3|DCLK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	23-UNIMOD:21,30-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	386-UNIMOD:21,397-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	377-UNIMOD:21,395-UNIMOD:21,2130-UNIMOD:385,2130-UNIMOD:4,2132-UNIMOD:21,2135-UNIMOD:35	0.02	33.0	3	2	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,2-UNIMOD:21	0.08	33.0	1	1	1
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	79-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1549-UNIMOD:4	0.01	33.0	1	1	1
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	287-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1550-UNIMOD:21,1554-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q9NYH9|UTP6_HUMAN	U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens OX=9606 GN=UTP6 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	205-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	4	1	0
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	12-UNIMOD:35	0.04	32.0	4	1	0
PRT	sp|P06213-2|INSR_HUMAN	Isoform Short of Insulin receptor OS=Homo sapiens OX=9606 GN=INSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	182-UNIMOD:4,186-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q92844|TANK_HUMAN	TRAF family member-associated NF-kappa-B activator OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9NVV4|PAPD1_HUMAN	Poly(A) RNA polymerase, mitochondrial OS=Homo sapiens OX=9606 GN=MTPAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|P49747-2|COMP_HUMAN	Isoform 2 of Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	451-UNIMOD:4,354-UNIMOD:4,357-UNIMOD:4	0.05	32.0	2	2	2
PRT	sp|Q7Z6I6-3|RHG30_HUMAN	Isoform 3 of Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	246-UNIMOD:35	0.05	32.0	1	1	1
PRT	sp|Q96AC1|FERM2_HUMAN	Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	671-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q8NBR6-2|MINY2_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase MINDY-2 OS=Homo sapiens OX=9606 GN=MINDY2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	515-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	86-UNIMOD:21,88-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	263-UNIMOD:21,279-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	99-UNIMOD:35,101-UNIMOD:21,113-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|Q13228-3|SBP1_HUMAN	Isoform 3 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P49768-4|PSN1_HUMAN	Isoform 4 of Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	2	1	0
PRT	sp|O14745-2|NHRF1_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	132-UNIMOD:21	0.09	32.0	1	1	1
PRT	sp|Q01831|XPC_HUMAN	DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	883-UNIMOD:21,884-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	285-UNIMOD:21,295-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	604-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q12805|FBLN3_HUMAN	EGF-containing fibulin-like extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=EFEMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	48-UNIMOD:4,55-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q6UXY1|BI2L2_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	465-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	53-UNIMOD:4,64-UNIMOD:4	0.00	32.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	462-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q86US8-3|EST1A_HUMAN	Isoform 3 of Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	0
PRT	sp|Q6UX04|CWC27_HUMAN	Spliceosome-associated protein CWC27 homolog OS=Homo sapiens OX=9606 GN=CWC27 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	438-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q14BN4-5|SLMAP_HUMAN	Isoform 5 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	970-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|P09619|PGFRB_HUMAN	Platelet-derived growth factor receptor beta OS=Homo sapiens OX=9606 GN=PDGFRB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	754-UNIMOD:35,757-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q12959-4|DLG1_HUMAN	Isoform 4 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	665-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q14766-3|LTBP1_HUMAN	Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1198-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	494-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q8NHU6-2|TDRD7_HUMAN	Isoform 2 of Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	420-UNIMOD:35,424-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P05060|SCG1_HUMAN	Secretogranin-1 OS=Homo sapiens OX=9606 GN=CHGB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	83-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	139-UNIMOD:4,146-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q8IWE2-2|NXP20_HUMAN	Isoform 2 of Protein NOXP20 OS=Homo sapiens OX=9606 GN=FAM114A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	377-UNIMOD:35,388-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q13555-10|KCC2G_HUMAN	Isoform 10 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	351-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1956-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|O95140|MFN2_HUMAN	Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P12111-3|CO6A3_HUMAN	Isoform 3 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	334-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	315-UNIMOD:21,323-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q13555-9|KCC2G_HUMAN	Isoform 9 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	344-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q15746|MYLK_HUMAN	Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1773-UNIMOD:21,1779-UNIMOD:21	0.01	31.0	1	1	0
PRT	sp|Q9UHW9|S12A6_HUMAN	Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96A00|PP14A_HUMAN	Protein phosphatase 1 regulatory subunit 14A OS=Homo sapiens OX=9606 GN=PPP1R14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	126-UNIMOD:28,128-UNIMOD:21	0.12	31.0	1	1	1
PRT	sp|Q9H2K8|TAOK3_HUMAN	Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	324-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	YLSADSGDADDSDADLGSAVK	1	sp|Q15361|TTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=8779	60.164	2	2070.8866	2070.8866	R	Q	476	497
PSM	VDNALQSGNSQESVTEQDSK	2	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=4034	31.787	2	2134.9614	2134.9614	K	D	43	63
PSM	GNTQEDAADGEQREEEETAGGQTLAAEAEGDR	3	sp|Q0VD83|APOBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=10207	68.986	3	3413.3765	3413.3765	R	E	635	667
PSM	TLSSPSLQTDGIAATPVPPPPPPK	4	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=13198	88.501	2	2447.2349	2447.2349	R	S	1800	1824
PSM	VDNALQSGNSQESVTEQDSK	5	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=3764	30.236	2	2134.9614	2134.9614	K	D	43	63
PSM	TTTTNTQVEGDDEAAFLER	6	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11096	74.719	2	2096.9498	2096.9498	K	L	75	94
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	7	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=10198	68.934	3	2789.2772	2789.2772	R	T	112	140
PSM	ATEMVEVGADDDEGGAER	8	sp|Q6NZI2-3|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:35	ms_run[2]:scan=4015	31.677	2	1865.7585	1865.7585	K	G	146	164
PSM	SEQDQAENEGEDSAVLMER	9	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:35	ms_run[2]:scan=6664	47.58	2	2151.8862	2151.8862	K	L	522	541
PSM	IHSNSSSEEVSQELESDDG	10	sp|Q7Z2X4|PCLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	16-UNIMOD:21	ms_run[1]:scan=6721	47.903621666666666	2	2127.818885	2127.811748	R	-	232	251
PSM	DQAENEDGAQENTFSMDPQLER	11	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:35	ms_run[2]:scan=8411	57.976	3	2539.0405	2539.0405	K	Q	626	648
PSM	DQQEAALVDMVNDGVEDLR	12	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:35	ms_run[2]:scan=12716	85.217	2	2131.9692	2131.9692	K	C	83	102
PSM	SVPVTVDDDDDDNDPENR	13	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5618	41.303	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TYVDLTNEETTDSTTSK	14	sp|O95551|TYDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7276	51.228	2	1903.8535	1903.8535	K	I	83	100
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	15	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	8-UNIMOD:21	ms_run[1]:scan=10075	68.15343666666666	3	2539.256295	2539.247205	R	D	175	200
PSM	APSTPVPPSPAPAPGLTK	16	sp|Q96EZ8|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	9-UNIMOD:21	ms_run[1]:scan=8344	57.549375	2	1763.892316	1763.885903	K	R	100	118
PSM	ATEMVEVGADDDEGGAER	17	sp|Q6NZI2-3|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:35	ms_run[2]:scan=3841	30.668	2	1865.7585	1865.7585	K	G	146	164
PSM	DAQDVQASQAEADQQQTR	18	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=2345	20.735	2	1987.8831	1987.8831	R	L	538	556
PSM	DLGLSESGEDVNAAILDESGK	19	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14877	100.1	2	2117.9964	2117.9964	K	K	464	485
PSM	DQAENEDGAQENTFSMDPQLER	20	sp|P50570-3|DYN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:35	ms_run[2]:scan=8421	58.031	2	2539.0405	2539.0405	K	Q	626	648
PSM	GNTQEDAADGEQREEEETAGGQTLAAEAEGDR	21	sp|Q0VD83|APOBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=9981	67.556	3	3413.3765	3413.3765	R	E	635	667
PSM	LSEGSQPAEEEEDQETPSR	22	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=3598	29.259	2	2116.9033	2116.9033	K	N	239	258
PSM	TSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEER	23	sp|Q9BQY9-2|DBND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=8472	58.33	3	3815.5039	3815.5039	R	G	115	151
PSM	WSLEDDDDDEDDPAEAEK	24	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10331	69.8	2	2092.7869	2092.7869	K	E	198	216
PSM	TLSSPSLQTDGIAATPVPPPPPPK	25	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:21	ms_run[1]:scan=13136	88.05013833333334	3	2447.243657	2447.234909	R	S	1800	1824
PSM	AAAASAAEAGIATTGTEDSDDALLK	26	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11897	79.822	2	2319.1078	2319.1078	R	M	238	263
PSM	DVDDGLQAAEEVGYPVMIK	27	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:35	ms_run[2]:scan=15251	102.79	2	2063.9721	2063.9721	K	A	215	234
PSM	GNTQEDAADGEQREEEETAGGQTLAAEAEGDR	28	sp|Q0VD83|APOBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10390	70.168	3	3413.3765	3413.3765	R	E	635	667
PSM	MQMLEDEDDLAYAETEK	29	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=9792	66.345	2	2061.8395	2061.8395	K	K	4346	4363
PSM	NDYATMLPDSTEIDQDTINR	30	sp|P12110|CO6A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:35	ms_run[2]:scan=12288	82.32	2	2327.0223	2327.0223	R	I	214	234
PSM	NVPQEESLEDSDVDADFK	31	sp|O00505|IMA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11492	77.321	2	2035.8858	2035.8858	R	A	50	68
PSM	PAEAPMPAEPAPPGPASPGGAPEPPAAAR	32	sp|Q9HBB8-2|CDHR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=8236	56.899	3	2753.252	2753.2520	K	A	544	573
PSM	SRTSVQTEDDQLIAGQSAR	33	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=7820	54.398	2	2220.9413	2220.9413	R	A	282	301
PSM	SVLDQDDVDTSMEESLK	34	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:35	ms_run[2]:scan=9026	61.605	2	1925.8412	1925.8412	K	H	755	772
PSM	TTTTNTQVEGDDEAAFLER	35	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10785	72.693	2	2096.9498	2096.9498	K	L	75	94
PSM	TTTTNTQVEGDDEAAFLER	36	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10944	73.708	2	2096.9498	2096.9498	K	L	75	94
PSM	VNEASGDGDGEDAVVILEK	37	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11062	74.481	2	1915.9011	1915.9011	K	T	68	87
PSM	VDNALQSGNSQESVTEQDSK	38	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=4116	32.287328333333335	2	2135.952784	2134.961449	K	D	43	63
PSM	ASVCAEAYNPDEEEDDAESR	39	sp|P31323|KAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:4	ms_run[1]:scan=7026	49.661595	2	2255.882928	2255.876065	R	I	113	133
PSM	AAAASAAEAGIATTGTEDSDDALLK	40	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=11879	79.71669833333333	3	2319.115766	2319.107779	R	M	238	263
PSM	DAEDAMDAMDGAVLDGR	41	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=6462	46.458	2	1782.7036	1782.7036	R	E	67	84
PSM	EAEETQSTLQAECDQYR	42	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4	ms_run[2]:scan=6954	49.284	2	2056.8644	2056.8644	R	S	683	700
PSM	EGETCGAEDNDSCGISLYK	43	sp|P98095|FBLN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8494	58.478	2	2103.8361	2103.8361	K	Q	498	517
PSM	ETADTDTADQVMASFK	44	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:35	ms_run[2]:scan=8263	57.057	2	1744.7462	1744.7462	R	I	814	830
PSM	IDEAESLNDEELEEK	45	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8563	58.879	2	1761.7792	1761.7792	K	E	820	835
PSM	SQETGDLDVGGLQETDK	46	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8619	59.204	2	1790.817	1790.8170	K	I	147	164
PSM	SVPVTVDDDDDDNDPENR	47	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5446	40.297	2	2015.8192	2015.8192	K	I	1185	1203
PSM	THSTSSSLGSGESPFSR	48	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7787	54.231	2	1882.7136	1882.7136	R	S	240	257
PSM	TQLEELEDELQATEDAK	49	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11171	75.212	2	1960.9113	1960.9113	K	L	1546	1563
PSM	VVDYSQFQESDDADEDYGR	50	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10029	67.865	2	2236.9033	2236.9033	K	D	10	29
PSM	VDNALQSGNSQESVTEQDSK	51	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=4292	33.365625	2	2135.951379	2134.961449	K	D	43	63
PSM	SAEIDSDDTGGSAAQK	52	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1173	11.614108333333332	2	1550.675083	1550.669624	K	Q	814	830
PSM	VQTDAFVSNELDDPDDLQCK	53	sp|Q9UI10|EI2BD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	19-UNIMOD:4	ms_run[1]:scan=13243	88.80254666666667	2	2309.026549	2308.016522	R	R	447	467
PSM	AIEDEGGNPDEIEITSEGNK	54	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9036	61.664	2	2115.9444	2115.9444	K	K	64	84
PSM	ATEMVEVGADDDEGGAER	55	sp|Q6NZI2-3|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:35	ms_run[2]:scan=4183	32.691	2	1865.7585	1865.7585	K	G	146	164
PSM	DAEDAMDAMDGAVLDGR	56	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5450	40.325	2	1782.7036	1782.7036	R	E	67	84
PSM	EASDTGQPIVFSQPESDEAK	57	sp|Q8TB37|NUBPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9169	62.516	2	2133.9702	2133.9702	R	A	282	302
PSM	EDEEESLNEVGYDDIGGCR	58	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:4	ms_run[2]:scan=11439	76.983	2	2184.8753	2184.8753	R	K	192	211
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	59	sp|P54725-2|RD23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=6249	45.202	3	3001.2673	3001.2673	R	E	120	150
PSM	EEDGSLSLDGADSTGVVAK	60	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9440	64.309	2	1848.8589	1848.8589	K	L	595	614
PSM	EEETEAAIGAPPTATEGPETK	61	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7227	50.899	2	2126.9855	2126.9855	K	P	473	494
PSM	EVVSLTEACCAEGADPDCYDTR	62	sp|P02774|VTDB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:4,10-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=11183	75.293	2	2517.0094	2517.0094	K	T	66	88
PSM	GDQPAASGDSDDDEPPPLPR	63	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=7563	52.941	2	2114.843	2114.8430	R	L	48	68
PSM	LDNTPASPPRSPAEPNDIPIAK	64	sp|O95359-6|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=9740	66.058	2	2459.1135	2459.1135	K	G	389	411
PSM	NDYATMLPDSTEIDQDTINR	65	sp|P12110|CO6A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:35	ms_run[2]:scan=12222	81.901	3	2327.0223	2327.0223	R	I	214	234
PSM	SDAEEDGGTVSQEEEDR	66	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=2479	21.725	2	1851.7242	1851.7242	K	K	446	463
PSM	SQETGDLDVGGLQETDK	67	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8395	57.873	2	1790.817	1790.8170	K	I	147	164
PSM	SSEEVDGQHPAQEEVPESPQTSGPEAENR	68	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=6616	47.33	3	3199.3215	3199.3215	R	C	267	296
PSM	TGSTSSKEDDYESDAATIVQK	69	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=9403	64.079	3	2310.9741	2310.9741	R	C	360	381
PSM	TQTAIASEDMPNTLTEAEK	70	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:35	ms_run[2]:scan=7388	51.881	2	2064.9521	2064.9521	R	L	1081	1100
PSM	VEEVLEEEEEEYVVEK	71	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13077	87.687	2	1979.9099	1979.9099	K	V	10	26
PSM	VSVCAETYNPDEEEEDTDPR	72	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=8219	56.794	2	2353.9492	2353.9492	R	V	98	118
PSM	VVDYSQFQESDDADEDYGR	73	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9986	67.584	2	2236.9033	2236.9033	K	D	10	29
PSM	VVDYSQFQESDDADEDYGR	74	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9988	67.595	3	2236.9033	2236.9033	K	D	10	29
PSM	TTTTNTQVEGDDEAAFLER	75	sp|Q05682|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=11716	78.74070833333333	2	2097.941002	2096.949822	K	L	81	100
PSM	AQLSSPEDQDDQDDIK	76	sp|Q86US8|EST1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=4921	37.060473333333334	2	1802.786582	1802.780631	K	V	996	1012
PSM	SETAPAAPAAPAPAEKTPVK	77	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5965	43.391555	2	2024.9878	2024.9815	M	K	2	22
PSM	PAAMISQPPTPPTGQPVR	78	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=7733	53.93544166666666	2	1939.928379	1939.922699	R	E	1062	1080
PSM	APSTPVPPSPAPAPGLTK	79	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=8851	60.581	2	1763.8859	1763.8859	K	R	87	105
PSM	ATEMVEVGADDDEGGAER	80	sp|Q6NZI2-3|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:35	ms_run[2]:scan=3665	29.662	2	1865.7585	1865.7585	K	G	146	164
PSM	DEENNPLETEYGLSVYK	81	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14510	97.586	2	1998.9058	1998.9058	K	D	178	195
PSM	DLDEDELLGNLSETELK	82	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17482	118.96	2	1931.9211	1931.9211	K	Q	14	31
PSM	DNENVVNEYSSELEK	83	sp|P02675|FIBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11935	80.066	2	1767.7799	1767.7799	K	H	164	179
PSM	DQETTAEQALEEEAR	84	sp|Q86YS3-2|RFIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10818	72.873	2	1718.7595	1718.7595	K	R	286	301
PSM	DSAAFEDNEVQDEFLEK	85	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13980	93.905	2	1984.8538	1984.8538	K	L	711	728
PSM	DYEPPSPSPAPGAPPPPPQR	86	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=7138	50.387	2	2132.9568	2132.9568	R	N	1674	1694
PSM	EEAGGGISEEEAAQYDR	87	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6859	48.701	2	1809.7653	1809.7653	K	Q	5	22
PSM	LGIYDADGDGDFDVDDAK	88	sp|Q12797-7|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13298	89.166	2	1899.801	1899.8010	K	V	102	120
PSM	NAGSSSDGTEDSDFSTDLEHTDSSESDGTSR	89	sp|O95251-3|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=9247	63.031	3	3272.2022	3272.2022	R	R	7	38
PSM	NDYATMLPDSTEIDQDTINR	90	sp|P12110|CO6A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:35	ms_run[2]:scan=12225	81.921	2	2327.0223	2327.0223	R	I	214	234
PSM	RSSQPSPTAVPASDSPPTK	91	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3839	30.655	2	2068.8868	2068.8868	R	Q	111	130
PSM	TEEGEIDYSAEEGENR	92	sp|Q8WVV9-3|HNRLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5807	42.423	2	1826.7442	1826.7442	K	R	22	38
PSM	TGSTSSKEDDYESDAATIVQK	93	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=8518	58.617	2	2310.9741	2310.9741	R	C	360	381
PSM	TLSSPSLQTDGIAATPVPPPPPPK	94	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=13049	87.462	2	2447.2349	2447.2349	R	S	1800	1824
PSM	TVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGR	95	sp|Q969V6|MRTFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[2]:scan=13200	88.514	3	3270.5744	3270.5744	K	L	781	814
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	96	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	28-UNIMOD:21	ms_run[2]:scan=14377	96.686	3	4103.5812	4103.5812	K	R	79	117
PSM	SAEIDSDDTGGSAAQK	97	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1298	12.618393333333334	2	1550.675151	1550.669624	K	Q	814	830
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	98	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=9916	67.142995	3	2539.256637	2539.247205	R	D	175	200
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	99	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=7637	53.393235	3	3261.3752	3261.3652	R	G	54	87
PSM	SSDASQGVITTPPPPSMPHK	100	sp|Q9UEY8|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,11-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=6048	43.86929833333333	2	2170.9669	2170.9601	M	E	2	22
PSM	AADSDDGAVSAPAASDGGVSK	101	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2882	24.536	2	1846.8181	1846.8181	M	S	2	23
PSM	AETECQNTEYQQLLDIK	102	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=14116	94.87	2	2081.9575	2081.9575	R	I	423	440
PSM	AYEDDGDDYSSIMVK	103	sp|Q99707-2|METH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35	ms_run[2]:scan=7746	54.002	2	1722.6931	1722.6931	K	A	1062	1077
PSM	CEEEDVEMSEDAYTVLTR	104	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=12571	84.298	2	2190.8933	2190.8933	R	I	330	348
PSM	DASDDLDDLNFFNQK	105	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17593	119.82	2	1755.7588	1755.7588	K	K	65	80
PSM	DLDEDANGITDEGK	106	sp|Q5QJE6|TDIF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6902	48.944	2	1490.6373	1490.6373	K	E	298	312
PSM	DLDEDEILGALTEEELR	107	sp|P28289|TMOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19955	138.65	2	1958.932	1958.9320	R	T	12	29
PSM	DSHSSEEDEASSQTDLSQTISK	108	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=7342	51.595	3	2459.9813	2459.9813	R	K	153	175
PSM	DVDIDSYPDEELPCSAR	109	sp|P35443|TSP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=11866	79.632	2	1979.8419	1979.8419	K	N	464	481
PSM	DVQGTDASLDEELDR	110	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9630	65.419	2	1661.738	1661.7380	R	V	293	308
PSM	EEEEENDDDNSLEGETFPLER	111	sp|Q5VSL9-3|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12694	85.095	2	2495.0096	2495.0096	R	D	116	137
PSM	EEEETAGGQTLAAEAEGDR	112	sp|Q0VD83|APOBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7582	53.057	2	1961.845	1961.8450	R	E	648	667
PSM	EIDDTYIEDAADVDAR	113	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12774	85.613	2	1809.7905	1809.7905	R	K	506	522
PSM	ESSITSCCSTSSCDADDEGVR	114	sp|Q9UIC8-3|LCMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4535	34.839	2	2321.8682	2321.8682	R	G	7	28
PSM	FDYDDEPEAVEESK	115	sp|O95104-2|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8886	60.755	2	1671.6788	1671.6788	R	K	265	279
PSM	GDSFPDDGVQDDDDR	116	sp|Q92932-2|PTPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5597	41.19	2	1651.6234	1651.6234	R	L	373	388
PSM	LDNTPASPPRSPAEPNDIPIAK	117	sp|O95359-6|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=9592	65.218	3	2459.1135	2459.1135	K	G	389	411
PSM	NADMSEEMQQDSVECATQALEK	118	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:35,8-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=10497	70.858	3	2545.0254	2545.0254	K	Y	10	32
PSM	PAEAPMPAEPAPPGPASPGGAPEPPAAAR	119	sp|Q9HBB8-2|CDHR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=8422	58.035	3	2753.252	2753.2520	K	A	544	573
PSM	PSPQPLAETPIPSLPEFPR	120	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=16873	114.6	2	2152.0606	2152.0606	R	A	680	699
PSM	SLDSDESEDEEDDYQQK	121	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4097	32.175	2	2030.7712	2030.7712	K	R	57	74
PSM	TEDESLVENNDNIDETEGSEEDDKENDK	122	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=7301	51.367	3	3291.2584	3291.2584	K	T	123	151
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	123	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=11204	75.422	3	2894.3576	2894.3576	K	H	557	585
PSM	SPDEEDYDYESYEK	124	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=7749	54.02002333333333	2	1767.668949	1767.663536	R	T	1881	1895
PSM	QKDEDDEEEEDDDVDTMLIMQR	125	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,17-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=9341	63.67519	3	2712.0631	2712.0533	K	L	1575	1597
PSM	QKDEDDEEEEDDDVDTMLIMQR	126	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,17-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=10031	67.87755	3	2712.0622	2712.0533	K	L	1575	1597
PSM	VDNALQSGNSQESVTEQDSK	127	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=3949	31.283301666666667	2	2135.952729	2134.961449	K	D	43	63
PSM	GSSGDSDSPGSSSLSLTRK	128	sp|Q5TCZ1|SPD2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	2-UNIMOD:21,3-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=17012	115.61797333333334	2	2223.686727	2223.681369	R	N	637	656
PSM	AAAPAPEEEMDECEQALAAEPK	129	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=8852	60.585	2	2372.0148	2372.0148	K	A	254	276
PSM	AHSPASTLPNSPGSTFER	130	sp|Q9UMD9-2|COHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=8831	60.465	2	2014.8187	2014.8187	R	K	83	101
PSM	AYPYMEGEPEDDVYLK	131	sp|Q9BYD6|RM01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35	ms_run[2]:scan=11460	77.115	2	1933.8292	1933.8292	K	R	74	90
PSM	DASDDLDDLNFFNQK	132	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17189	116.8	2	1755.7588	1755.7588	K	K	65	80
PSM	DGLTNAGELESDSGSDK	133	sp|P35226|BMI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6640	47.461	2	1693.7279	1693.7279	R	A	241	258
PSM	DPEEADYCIQTLDGR	134	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=10908	73.467	2	1780.7574	1780.7574	R	W	321	336
PSM	DVGSEEIQDAENSAK	135	sp|Q8TCU4-3|ALMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8590	59.041	2	1590.7009	1590.7009	R	T	2243	2258
PSM	DYPDFSPSVDAEAIQK	136	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12744	85.4	2	1780.8156	1780.8156	R	A	14	30
PSM	EAGVEMGDEDDLSTPNEK	137	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35	ms_run[2]:scan=5436	40.233	2	1950.8	1950.8000	R	L	257	275
PSM	EEVSGSSAAVTENADSDR	138	sp|P28290-2|ITPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3275	27.122	2	1822.7817	1822.7817	K	I	208	226
PSM	ETVYCLNDDDETEVLK	139	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=11943	80.111	2	1941.8514	1941.8514	K	E	292	308
PSM	EVEGDDVPESIMLEMK	140	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=10441	70.532	2	1851.8118	1851.8118	K	A	578	594
PSM	GISTSAASPAVGTVGMDMDEDDDFSK	141	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9957	67.4	2	2634.0949	2634.0949	K	W	3996	4022
PSM	GTEASSGTEAATGLEGEEK	142	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5105	38.176	2	1822.8068	1822.8068	K	D	594	613
PSM	IHSNSSSEEVSQELESDDG	143	sp|Q7Z2X4-3|PCLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=6522	46.799	2	2127.8117	2127.8117	R	-	150	169
PSM	LEEGTEETSETLEK	144	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4786	36.275	2	1593.7257	1593.7257	R	L	799	813
PSM	LESLYSDEEDESAVGADK	145	sp|Q9UP95-3|S12A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9126	62.225	2	1955.8484	1955.8484	R	I	962	980
PSM	SEQDQAENEGEDSAVLMER	146	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:35	ms_run[2]:scan=6653	47.524	3	2151.8862	2151.8862	K	L	522	541
PSM	TEQEEDEELLTESSK	147	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8076	55.981	2	1765.7741	1765.7741	R	A	146	161
PSM	TSPDEDEDDLLPPEQK	148	sp|P15923|TFE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8658	59.415	2	1826.8058	1826.8058	R	A	528	544
PSM	TSSAFVGKTPEASPEPK	149	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5202	38.783	2	1891.8006	1891.8006	K	D	303	320
PSM	TTTTNTQVEGDDEAAFLER	150	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10941	73.693	3	2096.9498	2096.9498	K	L	75	94
PSM	VDENFDCVEADDVEGK	151	sp|O14929-2|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=9397	64.041	2	1839.7469	1839.7469	K	I	10	26
PSM	DYEPPSPSPAPGAPPPPPQR	152	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=6970	49.367421666666665	2	2132.963766	2132.956836	R	N	1691	1711
PSM	EEDEEGEDVVTSTGR	153	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=4327	33.551565000000004	2	1650.691535	1650.685668	K	G	1862	1877
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	154	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=6021	43.701883333333335	3	3062.345955	3061.351348	K	G	56	88
PSM	QEEMNSQQEEEEMETDAR	155	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,4-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=3229	26.813601666666667	2	2226.8229	2226.8160	R	S	284	302
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	156	sp|Q4KMQ1|TPRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=7996	55.470778333333335	3	3337.481236	3336.470097	K	Q	252	285
PSM	AAAPAPEEEMDECEQALAAEPK	157	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=9053	61.779	2	2372.0148	2372.0148	K	A	254	276
PSM	AADEEAFEDNSEEYIR	158	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11118	74.865	2	1886.7806	1886.7806	R	R	300	316
PSM	AEDEALLSEEDDPIDR	159	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11524	77.511	2	1815.801	1815.8010	K	R	1771	1787
PSM	DASDDLDDLNFFNQK	160	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15865	107.25	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	161	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16808	114.13	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	162	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17513	119.18	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	163	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17724	120.82	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	164	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18113	123.88	2	1755.7588	1755.7588	K	K	65	80
PSM	DCDLQEDEACYNCGR	165	sp|P62633-8|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6332	45.662	2	1903.6771	1903.6771	K	G	59	74
PSM	DGETSLVTGEADEGR	166	sp|Q96JK2-2|DCAF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6359	45.841	2	1534.6747	1534.6747	K	A	597	612
PSM	DLDEDELLGNLSETELK	167	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17338	117.89	2	1931.9211	1931.9211	K	Q	14	31
PSM	EAISDEDEDEALYQK	168	sp|Q9C0B7|TNG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7745	53.999	2	1753.753	1753.7530	K	V	553	568
PSM	EAYPEEAYIADLDAK	169	sp|P53396-2|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14625	98.341	2	1696.7832	1696.7832	R	S	245	260
PSM	EDLPNLESSEETEQINK	170	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10329	69.788	2	1973.9066	1973.9066	R	H	752	769
PSM	EGPEPPEEVPPPTTPPVPK	171	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=10055	68.03	2	2072.9708	2072.9708	K	V	597	616
PSM	ESSITSCCSTSSCDADDEGVR	172	sp|Q9UIC8-3|LCMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4531	34.816	3	2321.8682	2321.8682	R	G	7	28
PSM	EVLEEISCYPENNDAK	173	sp|O14936-5|CSKP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=10723	72.337	2	1908.8411	1908.8411	K	E	26	42
PSM	GDSFPDDGVQDDDDR	174	sp|Q92932-2|PTPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5425	40.174	2	1651.6234	1651.6234	R	L	373	388
PSM	GEGEDEVEEESTALQK	175	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7791	54.254	2	1748.7588	1748.7588	R	T	549	565
PSM	GNEPEYEGDDTEGELK	176	sp|Q9Y6R4-2|M3K4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5889	42.912	2	1780.7275	1780.7275	K	E	437	453
PSM	PAAMISQPPTPPTGQPVR	177	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=7560	52.925	2	1939.9227	1939.9227	R	E	985	1003
PSM	PQMPPGPCSPGPLAQLQSR	178	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=11416	76.857	3	2112.9486	2112.9486	K	Q	245	264
PSM	RQLAELETEDGMQESP	179	sp|Q96QG7-2|MTMR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=7558	52.913	2	1927.7871	1927.7871	R	-	449	465
PSM	SPSPSPLPSPASGPGPGAPGPR	180	sp|Q9BYB0-3|SHAN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=8930	61.022	2	2045.9572	2045.9572	R	R	1517	1539
PSM	TELEDTLDSTATQQELR	181	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10269	69.398	2	1948.9225	1948.9225	K	A	1153	1170
PSM	TMEPEEEVEDDPK	182	sp|O15119-3|TBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35	ms_run[2]:scan=3556	28.979	2	1562.6294	1562.6294	K	V	92	105
PSM	TSPDEDEDDLLPPEQK	183	sp|P15923|TFE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8824	60.43	2	1826.8058	1826.8058	R	A	528	544
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	184	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=10895	73.383	3	2894.3576	2894.3576	K	H	557	585
PSM	VELSEDSPNSEQDLEK	185	sp|Q5T5P2-4|SKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6714	47.87	2	1817.8167	1817.8167	K	L	707	723
PSM	VDNALQSGNSQESVTEQDSK	186	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=4847	36.60249833333334	2	2135.952522	2134.961449	K	D	43	63
PSM	DIVVQETMEDIDK	187	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:35	ms_run[1]:scan=8869	60.66648166666666	2	1549.723113	1549.718155	K	N	190	203
PSM	AYEDDGDDYSSIMVK	188	sp|Q99707|METH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:35	ms_run[1]:scan=7920	55.010396666666665	2	1722.698770	1722.693062	K	A	1113	1128
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	189	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21,34-UNIMOD:35	ms_run[1]:scan=7160	50.51909666666667	3	4214.411428	4214.396954	K	A	142	177
PSM	QEAGISEGQGTAGEEEEK	190	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=4833	36.51476666666667	2	1830.7811	1830.7750	K	K	76	94
PSM	CTTEAEQDIEEEKVEK	191	sp|Q8IUW5|RELL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=10208	68.99016666666667	2	1919.8369	1919.8301	R	I	88	104
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	192	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=3982	31.476390000000002	3	3087.3053	3087.2954	K	S	145	174
PSM	SAEIDSDDTGGSAAQK	193	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1462	13.966605	2	1551.661576	1550.669624	K	Q	814	830
PSM	AADEEAFEDNSEEYIR	194	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10772	72.612	2	1886.7806	1886.7806	R	R	300	316
PSM	AADSDDGAVSAPAASDGGVSK	195	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3360	27.717	2	1846.8181	1846.8181	M	S	2	23
PSM	AEDGSVIDYELIDQDAR	196	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14092	94.7	2	1907.8749	1907.8749	R	D	180	197
PSM	AEEFSEAQDMYYLETSAK	197	sp|Q15771|RAB30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:35	ms_run[2]:scan=11969	80.263	2	2126.899	2126.8990	R	E	137	155
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	198	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=8389	57.826	3	3173.2435	3173.2435	R	-	502	532
PSM	AGGTALLPGPPAPSPLPATPLSAK	199	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	22-UNIMOD:21	ms_run[2]:scan=15721	106.2	2	2260.1868	2260.1868	K	E	981	1005
PSM	ASEVEEILDGNDEK	200	sp|Q12824-2|SNF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10424	70.43	2	1546.6999	1546.6999	K	Y	84	98
PSM	DASDDLDDLNFFNQK	201	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17326	117.8	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	202	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17856	121.83	2	1755.7588	1755.7588	K	K	65	80
PSM	DDDDGPVSSQGYMPYLNK	203	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:35	ms_run[2]:scan=9587	65.186	2	2015.8419	2015.8419	R	Y	57	75
PSM	DDGEEADGGGPADQFSDGR	204	sp|Q6UXT9|ABH15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5877	42.83	2	1893.7249	1893.7249	R	E	45	64
PSM	DDNFGEGNDGGILDDK	205	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9922	67.173	2	1679.6911	1679.6911	K	L	217	233
PSM	DDPVTNLNNAFEVAEK	206	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15070	101.47	2	1774.8374	1774.8374	K	Y	218	234
PSM	DPEEADYCIQTLDGR	207	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=9859	66.791	2	1780.7574	1780.7574	R	W	321	336
PSM	DSLDENEATMCQAYEER	208	sp|Q9BRK4|LZTS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=6690	47.725	2	2075.8048	2075.8048	R	Q	345	362
PSM	DVDDGLQAAEEVGYPVMIK	209	sp|Q13085-3|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:35	ms_run[2]:scan=15196	102.39	2	2063.9721	2063.9721	K	A	215	234
PSM	EDEIPETVSLEMLDAAK	210	sp|Q96A26|F162A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:35	ms_run[2]:scan=14363	96.611	2	1904.8925	1904.8925	K	N	80	97
PSM	EEDGVDTIEEDLTR	211	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14367	96.631	2	1619.7162	1619.7162	R	A	271	285
PSM	EEEEENDDDNSLEGETFPLER	212	sp|Q5VSL9-3|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12688	85.05	3	2495.0096	2495.0096	R	D	116	137
PSM	ETENDDVTNVIQK	213	sp|O15397-2|IPO8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6271	45.33	2	1503.7053	1503.7053	R	M	348	361
PSM	GGEEPIEESNILSPVQDGTK	214	sp|Q14571|ITPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12607	84.562	2	2098.0066	2098.0066	K	K	1148	1168
PSM	GNAEGSSDEEGKLVIDEPAK	215	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8551	58.816	2	2203.8923	2203.8923	K	E	120	140
PSM	LDETDDPDDYGDR	216	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4113	32.273	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	217	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4278	33.281	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	218	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4618	35.314	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	219	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5128	38.347	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	220	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5293	39.356	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	221	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5632	41.382	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	222	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5801	42.389	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	223	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8459	58.249	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	224	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4965	37.333	2	1524.5852	1524.5852	R	E	401	414
PSM	PFPGSVNQPATPFSPTR	225	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=12378	82.941	2	1878.8666	1878.8666	K	N	196	213
PSM	QDFESTDESEDIESLIPK	226	sp|Q8WVV4|POF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16974	115.34	2	2080.9324	2080.9324	K	G	287	305
PSM	QGEDNSTAQDTEELEK	227	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3680	29.735	2	1792.7599	1792.7599	K	E	452	468
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	228	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15493	104.56	3	2887.2308	2887.2308	K	M	127	152
PSM	RTPSDDEEDNLFAPPK	229	sp|Q9Y4E1-3|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=11278	75.913	2	1989.7758	1989.7758	R	L	275	291
PSM	SVPVTVDDDDDDNDPENR	230	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5793	42.337	2	2015.8192	2015.8192	K	I	1185	1203
PSM	SYEDDDDMDLQPNK	231	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=3594	29.234	2	1699.6519	1699.6519	R	Q	167	181
PSM	SYEDDDDMDLQPNK	232	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=3898	31	2	1699.6519	1699.6519	R	Q	167	181
PSM	TCVADESAENCDK	233	sp|P02768-3|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=882	9.1928	2	1497.5712	1497.5712	K	S	76	89
PSM	THSTSSSLGSGESPFSR	234	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7804	54.322	3	1882.7136	1882.7136	R	S	240	257
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	235	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=11354	76.431	3	2894.3576	2894.3576	K	H	557	585
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	236	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=8800	60.299	3	3040.1249	3040.1249	R	E	92	118
PSM	YLTESYGTGQDIDDR	237	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7896	54.864	2	1731.7588	1731.7588	R	I	167	182
PSM	DASDDLDDLNFFNQK	238	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=17368	118.126395	2	1755.754720	1755.758774	K	K	65	80
PSM	LDETDDPDDYGDR	239	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=4797	36.324308333333335	2	1524.590640	1524.585226	R	E	401	414
PSM	LDETDDPDDYGDR	240	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=10832	72.96634833333333	2	1524.597603	1524.585226	R	E	401	414
PSM	AYEDDGDDYSSIMVK	241	sp|Q99707|METH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:35	ms_run[1]:scan=8086	56.04416833333333	2	1722.698421	1722.693062	K	A	1113	1128
PSM	EMEENFAVEAANYQDTIGR	242	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:35	ms_run[1]:scan=12134	81.32514833333333	2	2202.9452	2201.9532	R	L	346	365
PSM	SDQEAKPSTEDLGDK	243	sp|P63165|SUMO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=3494	28.561759999999996	2	1660.7456	1660.7423	M	K	2	17
PSM	VEDYDAADDVQLSK	244	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7780	54.19799166666666	2	1566.710223	1566.704947	R	T	339	353
PSM	APSTPVPPSPAPAPGLTK	245	sp|Q96EZ8|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=8507	58.55481166666667	2	1763.892316	1763.885903	K	R	100	118
PSM	GGEEPIEESNILSPVQDGTK	246	sp|Q14571|ITPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12332	82.63073166666666	2	2099.018968	2098.006609	K	K	1148	1168
PSM	TLSSPSLQTDGIAATPVPPPPPPK	247	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=13281	89.05702	3	2447.243877	2447.234909	R	S	1800	1824
PSM	TVFPGAVPVLPASPPPK	248	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=14800	99.58069166666667	2	1752.927888	1752.921560	K	D	217	234
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	249	sp|O76094|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=11051	74.398565	3	2894.367413	2894.357634	K	H	618	646
PSM	QVSASELHTSGILGPETLR	250	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=16027	108.42150500000001	2	2056.9896	2056.9825	R	D	2716	2735
PSM	DCDLQEDACYNCGR	251	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=5691	41.70755833333333	2	1775.625040	1774.634519	K	G	66	80
PSM	AGDDYEVLELDDVPK	252	sp|O43164-2|PJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14431	97.042	2	1676.7781	1676.7781	R	E	59	74
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	253	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=10358	69.998	3	2789.2772	2789.2772	R	T	112	140
PSM	AVEQEDELSDVSQGGSK	254	sp|O60271-3|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5874	42.814	2	1776.8014	1776.8014	K	A	257	274
PSM	DAQDAEAAMDGAELDGR	255	sp|Q9BRL6-2|SRSF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35	ms_run[2]:scan=5396	39.986	2	1749.7112	1749.7112	R	E	67	84
PSM	DASDDLDDLNFFNQK	256	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17461	118.81	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	257	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17034	115.78	2	1755.7588	1755.7588	K	K	65	80
PSM	DDMIFEDCGDVPSEPK	258	sp|P05026-2|AT1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=10438	70.517	2	1868.7444	1868.7444	R	E	119	135
PSM	DEMADEVANGNLSK	259	sp|Q7Z406-4|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35	ms_run[2]:scan=3696	29.834	2	1507.6461	1507.6461	R	A	1512	1526
PSM	DGDSVMVLPTIPEEEAK	260	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35	ms_run[2]:scan=12626	84.681	2	1844.8714	1844.8714	K	K	183	200
PSM	DLDDIEDENEQLK	261	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12306	82.447	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLGLSESGEDVNAAILDESGK	262	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14888	100.18	3	2117.9964	2117.9964	K	K	464	485
PSM	DSAIPVESDTDDEGAPR	263	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6379	45.962	2	1772.7701	1772.7701	R	I	461	478
PSM	DTDIVDEAIYYFK	264	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20267	141.21	2	1590.7454	1590.7454	K	A	38	51
PSM	DTSENADGQSDENKDDYTIPDEYR	265	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=9356	63.769	3	2856.0883	2856.0883	K	I	757	781
PSM	EDAQVAAEILEIADTPSGDK	266	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17751	121.02	2	2070.9957	2070.9957	R	T	489	509
PSM	EELMSSDLEETAGSTSIPK	267	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35	ms_run[2]:scan=10347	69.921	2	2038.9252	2038.9252	K	R	515	534
PSM	ETTDTDTADQVIASFK	268	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14189	95.384	2	1740.8054	1740.8054	R	V	838	854
PSM	FDYDDEPEAVEESK	269	sp|O95104-2|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8719	59.748	2	1671.6788	1671.6788	R	K	265	279
PSM	GDDLEEGVTSEEFDK	270	sp|Q6ZVM7-4|TM1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10183	68.831	2	1668.7003	1668.7003	K	F	181	196
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	271	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,13-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=6579	47.115	3	2838.0253	2838.0253	R	E	418	442
PSM	IYEFPETDDEEENK	272	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9189	62.637	2	1756.7316	1756.7316	K	L	221	235
PSM	KSSTGSPTSPLNAEK	273	sp|Q15746-9|MYLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3041	25.582	2	1662.6903	1662.6903	R	L	571	586
PSM	LAPVPSPEPQKPAPVSPESVK	274	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=9106	62.106	2	2313.1059	2313.1059	K	A	199	220
PSM	LDETDDPDDYGDR	275	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4446	34.296	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	276	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5458	40.367	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	277	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6134	44.422	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	278	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6287	45.424	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	279	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7167	50.555	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	280	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7501	52.587	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	281	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7950	55.193	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	282	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9719	65.926	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	283	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10714	72.275	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	284	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11505	77.387	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	285	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8120	56.22	2	1524.5852	1524.5852	R	E	401	414
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	286	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:35	ms_run[2]:scan=15815	106.88	3	2755.2494	2755.2494	R	T	383	408
PSM	LNQSGTSVGTDEESDVTQEEER	287	sp|P0DJD0|RGPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6641	47.464	3	2409.0415	2409.0415	K	D	1293	1315
PSM	NMTSPIADFPAPPPYSAVTPPPDAFSR	288	sp|Q9UMS6-5|SYNP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=17420	118.49	3	2938.3249	2938.3249	R	G	213	240
PSM	PQMPPGPCSPGPLAQLQSR	289	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=11494	77.333	2	2112.9486	2112.9486	K	Q	245	264
PSM	QLPSPPFLPAAGTADCR	290	sp|P49716|CEBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=14982	100.86	2	1876.8543	1876.8543	K	-	253	270
PSM	RISQVSSGETEYNPTEAR	291	sp|Q6ZNJ1-2|NBEL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=7435	52.177	2	2182.8933	2182.8933	R	-	2553	2571
PSM	SAEIDSDDTGGSAAQK	292	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1437	13.744	2	1550.6696	1550.6696	K	Q	814	830
PSM	SDEVDEQVACQEVK	293	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:4	ms_run[2]:scan=5647	41.469	2	1634.7094	1634.7094	K	V	1407	1421
PSM	SGKSPSPSPTSPGSLR	294	sp|O15075-3|DCLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4109	32.253	2	1700.7172	1700.7172	R	K	20	36
PSM	SVKEDSVPTGAEENVVCESPVEIIK	295	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14427	97.018	3	2794.2984	2794.2984	K	S	381	406
PSM	TGEDEDEEDNDALLK	296	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6316	45.58	2	1691.701	1691.7010	K	E	542	557
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	297	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=11515	77.457	3	2894.3576	2894.3576	K	H	557	585
PSM	VIENADGSEEETDTR	298	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1947	17.754	2	1663.7173	1663.7173	R	D	1947	1962
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	299	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=11486	77.28079	3	3011.354337	3011.342712	R	D	374	402
PSM	TTTTNTQVEGDDEAAFLER	300	sp|Q05682|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=11388	76.67639	2	2097.942039	2096.949822	K	L	81	100
PSM	VDNALQSGNSQESVTEQDSK	301	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=4646	35.479005	2	2135.952642	2134.961449	K	D	43	63
PSM	SETAPAETATPAPVEK	302	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=5897	42.95170666666667	2	1719.7669	1719.7599	M	S	2	18
PSM	SEAPETPMEEEAELVLTEK	303	sp|Q5JTH9|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:35	ms_run[1]:scan=13588	91.19073	3	2146.989883	2146.982762	K	S	72	91
PSM	GDNGDTACSNEIGVGVSK	304	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:4	ms_run[1]:scan=5576	41.07810666666666	2	1779.764229	1778.774106	R	A	1542	1560
PSM	SPGKAEAESDALPDDTVIESEALPSDIAAEAR	305	sp|Q9GZR7|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=17012	115.61797333333334	3	3335.530090	3333.513722	R	A	287	319
PSM	AEDGSVIDYELIDQDAR	306	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13948	93.692	2	1907.8749	1907.8749	R	D	180	197
PSM	AKPVVSDFDSDEEQDER	307	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7809	54.345	2	2124.7926	2124.7926	K	E	1545	1562
PSM	ASMDVENPDYSEEILK	308	sp|Q9NYH9|UTP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35	ms_run[2]:scan=10537	71.146	2	1854.8193	1854.8193	K	G	203	219
PSM	ATEMVEVGADDDEGGAER	309	sp|Q6NZI2-3|CAVN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35	ms_run[2]:scan=3978	31.456	3	1865.7585	1865.7585	K	G	146	164
PSM	DADDAVYELDGK	310	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7542	52.818	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	311	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9644	65.495	2	1309.5674	1309.5674	R	E	49	61
PSM	DAEDAMDAMDGAVLDGR	312	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5237	39.021	2	1782.7036	1782.7036	R	E	67	84
PSM	DAEDAMDAMDGAVLDGR	313	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5771	42.215	2	1782.7036	1782.7036	R	E	67	84
PSM	DASDDLDDLNFFNQK	314	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17986	122.86	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	315	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18391	126.1	2	1755.7588	1755.7588	K	K	65	80
PSM	DDDDGPVSSQGYMPYLNK	316	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12672	84.952	2	1999.8469	1999.8469	R	Y	57	75
PSM	DDGSTLMEIDGDK	317	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=7132	50.357	2	1410.5821	1410.5821	R	G	6	19
PSM	DDGSTLMEIDGDK	318	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=7300	51.363	2	1410.5821	1410.5821	R	G	6	19
PSM	DDNEECGDICPGTAK	319	sp|P06213-2|INSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=3065	25.735	2	1679.6403	1679.6403	K	G	177	192
PSM	DEEDTSFESLSK	320	sp|Q92844|TANK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7971	55.323	2	1385.5834	1385.5834	R	F	220	232
PSM	DEQPSGSVETGFEDK	321	sp|Q9NVV4|PAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6304	45.523	2	1623.69	1623.6900	R	I	43	58
PSM	DEVEVSDDDEKEPEVDYR	322	sp|Q15746-9|MYLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=7758	54.069	2	2246.874	2246.8740	K	T	233	251
PSM	DFVDDDDDDDLER	323	sp|Q9H9C1-2|SPE39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8704	59.675	2	1582.5907	1582.5907	R	V	44	57
PSM	DGVGDVCQDDFDADK	324	sp|P49747-2|COMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=8097	56.097	2	1654.6417	1654.6417	R	V	445	460
PSM	DLDDIEDENEQLK	325	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9509	64.711	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	326	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9680	65.719	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	327	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9850	66.731	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	328	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10009	67.739	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	329	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11039	74.318	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	330	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11498	77.351	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	331	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12155	81.44	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	332	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10484	70.769	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLEQGAQEDQVAEEK	333	sp|Q7Z6I6-3|RHG30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4664	35.571	2	1687.7537	1687.7537	R	W	620	635
PSM	DPDAQPGGELMLGGTDSK	334	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=7807	54.333	2	1802.7993	1802.7993	R	Y	236	254
PSM	DQNESLDEEMFYK	335	sp|Q96AC1|FERM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:35	ms_run[2]:scan=9383	63.949	2	1662.6719	1662.6719	K	L	662	675
PSM	DSDGVDGFEAEGK	336	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5849	42.655	2	1324.5419	1324.5419	R	K	1053	1066
PSM	EADAGETEEPGAEGAGK	337	sp|Q0VD83|APOBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1134	11.298	2	1616.6802	1616.6802	R	G	230	247
PSM	EDVQDYSEDLQEIK	338	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12359	82.824	2	1709.7632	1709.7632	K	K	574	588
PSM	EEEGEETAQVLAASK	339	sp|Q8NBR6-2|MINY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7289	51.294	2	1589.7421	1589.7421	K	E	220	235
PSM	EEFVATTESTTETK	340	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5418	40.137	2	1571.7203	1571.7203	K	E	713	727
PSM	EIEMSVDDDDINSSK	341	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35	ms_run[2]:scan=4879	36.812	2	1711.7094	1711.7094	R	V	512	527
PSM	EVEGDDVPESIMLEMK	342	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=10286	69.521	2	1851.8118	1851.8118	K	A	578	594
PSM	FTDKDQQPSGSEGEDDDAEAALK	343	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=7157	50.499	3	2611.984	2611.9840	K	K	78	101
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	344	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=15686	105.96	3	2431.1719	2431.1719	R	S	258	284
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	345	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,13-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=6407	46.113	3	2838.0253	2838.0253	R	E	418	442
PSM	GVVDSDDLPLNVSR	346	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11671	78.45	2	1484.7471	1484.7471	K	E	435	449
PSM	IHSNSSSEEVSQELESDDG	347	sp|Q7Z2X4-3|PCLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=6305	45.527	2	2127.8117	2127.8117	R	-	150	169
PSM	LDETDDPDDYGDR	348	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3134	26.211	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	349	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3487	28.531	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	350	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9882	66.937	2	1524.5852	1524.5852	R	E	401	414
PSM	LDNTPASPPRSPAEPNDIPIAK	351	sp|O95359-6|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=9772	66.231	3	2459.1135	2459.1135	K	G	389	411
PSM	LSEGSQPAEEEEDQETPSR	352	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3589	29.201	3	2116.9033	2116.9033	K	N	239	258
PSM	MASPPAPSPAPPAISPIIK	353	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=12948	86.79	2	1936.9733	1936.9733	R	N	99	118
PSM	MASPPAPSPAPPAISPIIK	354	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=13208	88.569	2	1936.9733	1936.9733	R	N	99	118
PSM	NTGTEAPDYLATVDVDPK	355	sp|Q13228-3|SBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12605	84.549	2	1904.9004	1904.9004	R	S	35	53
PSM	QEEMNSQQEEEEMETDAR	356	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=1727	16.048	3	2243.843	2243.8431	R	S	284	302
PSM	QVVEQDEEEDEELTLK	357	sp|P49768-4|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9508	64.707	3	1931.8848	1931.8848	R	Y	61	77
PSM	SASSDTSEELNSQDSPPK	358	sp|O14745-2|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=4423	34.134	2	1957.779	1957.7790	R	Q	132	150
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	359	sp|Q01831|XPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=6017	43.682	3	3047.1667	3047.1667	K	I	869	899
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	360	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=5386	39.934	3	2856.1094	2856.1094	R	S	161	188
PSM	SLDDDLDGVPLDATEDSK	361	sp|O15042-3|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12962	86.88	2	1903.8535	1903.8535	K	K	322	340
PSM	SRTASLTSAASVDGNR	362	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4880	36.815	2	1751.7241	1751.7241	R	S	285	301
PSM	TGSTSSKEDDYESDAATIVQK	363	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=9399	64.053	2	2310.9741	2310.9741	R	C	360	381
PSM	TMEPEEEVEDDPK	364	sp|O15119-3|TBX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35	ms_run[2]:scan=3387	27.896	2	1562.6294	1562.6294	K	V	92	105
PSM	VDNALQSGNSQESVTEQDSK	365	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4029	31.764	3	2134.9614	2134.9614	K	D	43	63
PSM	VEEVLEEEEEEYVVEK	366	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13092	87.786	3	1979.9099	1979.9099	K	V	10	26
PSM	CRSPGMLEPLGSSR	367	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=9197	62.68492833333333	2	1624.6780	1624.6734	R	T	2130	2144
PSM	PFPGSVNQPATPFSPTR	368	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=12521	83.952055	2	1879.875930	1878.866564	K	N	591	608
PSM	DASDDLDDLNFFNQK	369	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=16381	110.934925	2	1756.750913	1755.758774	K	K	65	80
PSM	DADDAVYELNGK	370	sp|Q08170|SRSF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=8425	58.05126833333333	2	1308.588769	1308.583375	R	D	47	59
PSM	AVAEEDNGSIGEETDSSPGR	371	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4411	34.068735	2	2019.857109	2018.866486	K	K	652	672
PSM	DLDDIEDENEQLK	372	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10325	69.76336666666667	2	1575.693870	1574.694776	R	Q	313	326
PSM	DLTTGYDDSQPDK	373	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=4762	36.13953166666666	2	1453.626540	1453.620883	R	K	520	533
PSM	DIDECDIVPDACK	374	sp|Q12805|FBLN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=9700	65.82399833333332	2	1548.650965	1548.643610	K	G	44	57
PSM	APSTPVPPSPAPAPGLTK	375	sp|Q96EZ8|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21	ms_run[1]:scan=8685	59.56502333333333	2	1763.892316	1763.885903	K	R	100	118
PSM	TLSSPSLQTDGIAATPVPPPPPPK	376	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=12816	85.88608833333333	3	2448.246604	2447.234909	R	S	1800	1824
PSM	APSPAPPPLPSSR	377	sp|Q6UXY1|BI2L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=6726	47.926671666666664	2	1352.653972	1352.648967	R	R	463	476
PSM	DCPDGSDEAPEICPQSK	378	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=5453	40.341905	2	1904.764314	1903.756408	R	A	52	69
PSM	LVQDVANNTNEEAGDGTTTATVLAR	379	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9694	65.79430333333333	3	2560.229951	2559.241253	K	S	97	122
PSM	LPNLSSPSAEGPPGPPSGPAPR	380	sp|O60784|TOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=10087	68.23142833333333	2	2162.011017	2161.020499	R	K	457	479
PSM	DLDDIEDENEQLK	381	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10235	69.15514333333333	2	1575.686474	1574.694776	R	Q	313	326
PSM	IHSNSSSEEVSQELESDDG	382	sp|Q7Z2X4|PCLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=6053	43.89839833333333	2	2128.825431	2127.811748	R	-	232	251
PSM	VDNALQSGNSQESVTEQDSK	383	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=5073	37.990703333333336	2	2135.951405	2134.961449	K	D	43	63
PSM	AEDGSVIDYELIDQDAR	384	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13970	93.846	3	1907.8749	1907.8749	R	D	180	197
PSM	AQLSSPEDQDDQDDIK	385	sp|Q86US8-3|EST1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4748	36.052	2	1802.7806	1802.7806	K	V	88	104
PSM	DADDAVYELDGK	386	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14413	96.93	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	387	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16514	111.91	2	1309.5674	1309.5674	R	E	49	61
PSM	DASMQDSDTFEIYDPR	388	sp|Q6UX04|CWC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35	ms_run[2]:scan=11790	79.185	2	1904.7734	1904.7734	K	N	435	451
PSM	DDDDGPVSSQGYMPYLNK	389	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=9194	62.669	2	2015.8419	2015.8419	R	Y	57	75
PSM	DDGSTLMEIDGDK	390	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=6331	45.659	2	1410.5821	1410.5821	R	G	6	19
PSM	DDGSTLMEIDGDK	391	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=8104	56.136	2	1410.5821	1410.5821	R	G	6	19
PSM	DDLQGAQSEIEAK	392	sp|Q14BN4-5|SLMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6873	48.771	2	1402.6576	1402.6576	K	Q	18	31
PSM	DDSELEGQVISCLK	393	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4	ms_run[2]:scan=14017	94.176	2	1591.74	1591.7400	K	L	959	973
PSM	DELADEITNSASGK	394	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9593	65.222	2	1448.6631	1448.6631	R	S	1711	1725
PSM	DESVDYVPMLDMK	395	sp|P09619|PGFRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=10877	73.263	2	1572.6688	1572.6688	K	G	746	759
PSM	DFVDDDDDDDLER	396	sp|Q9H9C1-2|SPE39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8526	58.666	2	1582.5907	1582.5907	R	V	44	57
PSM	DFVDDDDDDDLER	397	sp|Q9H9C1-2|SPE39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8927	61.011	2	1582.5907	1582.5907	R	V	44	57
PSM	DIQENDEEAVQVK	398	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5336	39.628	2	1515.7053	1515.7053	R	E	34	47
PSM	DLDDIEDENEQLK	399	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10167	68.748	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	400	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11340	76.337	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	401	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12997	87.106	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	402	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13993	93.999	2	1574.6948	1574.6948	R	Q	313	326
PSM	DQSEQETSDADQHVTSNASDSESSYR	403	sp|Q12959-4|DLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=4936	37.149	3	2952.1167	2952.1167	K	G	658	684
PSM	DSDDYAQLCNIPVTGR	404	sp|Q14766-3|LTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=11862	79.613	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSDGDGIGDACDNCPQK	405	sp|P49747-2|COMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=2485	21.767	2	1822.6734	1822.6734	K	S	344	361
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	406	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=12369	82.89	3	2961.1785	2961.1785	R	V	489	518
PSM	DYEPPSPSPAPGAPPPPPQR	407	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=7186	50.67	3	2132.9568	2132.9568	R	N	1674	1694
PSM	DYSAAQELMEDEMK	408	sp|Q8NHU6-2|TDRD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=7887	54.817	2	1690.6702	1690.6702	K	E	412	426
PSM	EDEEEEEGENYQK	409	sp|P05060|SCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1578	14.887	2	1626.6169	1626.6169	R	G	163	176
PSM	EDEISPPPPNPVVK	410	sp|P10644-2|KAP0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=8290	57.209	2	1596.7437	1596.7437	R	G	79	93
PSM	EDLNCQEEEDPMNK	411	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=2302	20.389	2	1765.6771	1765.6771	K	L	135	149
PSM	EEASDYLELDTIK	412	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13565	91.027	2	1524.7195	1524.7195	K	N	253	266
PSM	EEQEYEEEVEEEPR	413	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6941	49.201	2	1822.7381	1822.7381	R	P	769	783
PSM	EIESEIDSEEELINK	414	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12715	85.214	2	1775.8313	1775.8313	K	K	755	770
PSM	ELENEENQEEQGLEEK	415	sp|Q8IWE2-2|NXP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5921	43.117	2	1945.8389	1945.8389	K	G	139	155
PSM	GDSFPDDGVQDDDDR	416	sp|Q92932-2|PTPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5768	42.195	2	1651.6234	1651.6234	R	L	373	388
PSM	GDSFPDDGVQDDDDR	417	sp|Q92932-2|PTPR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5934	43.207	2	1651.6234	1651.6234	R	L	373	388
PSM	GGTMTDLDEQEDESMETTGK	418	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=3789	30.371	2	2204.8573	2204.8573	K	D	374	394
PSM	GSTESCNTTTEDEDLK	419	sp|Q13555-10|KCC2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=2268	20.15	2	1785.7211	1785.7211	K	V	346	362
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	420	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=11329	76.26	3	3011.3427	3011.3427	R	D	374	402
PSM	LDETDDPDDYGDR	421	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3296	27.241	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	422	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6827	48.527	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	423	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7339	51.579	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	424	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10049	67.999	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	425	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10238	69.172	2	1524.5852	1524.5852	R	E	401	414
PSM	MDTIDQDDELIR	426	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=8947	61.132	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	NAELDPVTTEEQVLDVK	427	sp|O95140|MFN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15055	101.38	2	1898.9473	1898.9473	R	G	63	80
PSM	NYTDEAIETDDLTIK	428	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12127	81.274	2	1739.8101	1739.8101	K	L	105	120
PSM	PAAMISQPPTPPTGQPVR	429	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=7394	51.916	2	1939.9227	1939.9227	R	E	985	1003
PSM	PGPVPEAAQPFLFTPR	430	sp|Q7Z406-4|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=16255	110.08	2	1802.8757	1802.8757	R	G	17	33
PSM	PQMPPGPCSPGPLAQLQSR	431	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=11334	76.299	2	2112.9486	2112.9486	K	Q	245	264
PSM	QVVEQDEEEDEELTLK	432	sp|P49768-4|PSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9487	64.591	2	1931.8848	1931.8848	R	Y	61	77
PSM	SDDEVDDPAVELK	433	sp|P12111-3|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8446	58.171	2	1430.6413	1430.6413	K	Q	941	954
PSM	SEDEAGCSSVDEESYK	434	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=3284	27.174	2	1790.6789	1790.6789	K	T	328	344
PSM	SLDGALYDDEDDDDIER	435	sp|Q6P3S1|DEN1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10574	71.375	2	1954.7916	1954.7916	K	A	514	531
PSM	SPVGKSPPSTGSTYGSSQK	436	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=2825	24.15	2	2010.8337	2010.8337	K	E	315	334
PSM	TEGTQEADQYADEK	437	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2901	24.651	2	1583.6587	1583.6587	K	T	1156	1170
PSM	TGSTSSKEDDYESDAATIVQK	438	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=8498	58.503	3	2310.9741	2310.9741	R	C	360	381
PSM	TLSSPSLQTDGIAATPVPPPPPPK	439	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=13420	90.071	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TTTTNTQVEGDDEAAFLER	440	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11256	75.778	2	2096.9498	2096.9498	K	L	75	94
PSM	QKDEDDEEEEDDDVDTMLIMQR	441	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,17-UNIMOD:35,20-UNIMOD:35	ms_run[1]:scan=10111	68.37353833333333	2	2712.0583	2712.0533	K	L	1575	1597
PSM	DASDDLDDLNFFNQK	442	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18609	127.79213166666666	2	1755.765113	1755.758774	K	K	65	80
PSM	DASDDLDDLNFFNQK	443	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18436	126.44673666666667	2	1756.767596	1755.758774	K	K	65	80
PSM	NPDDITNEEYGEFYK	444	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11205	75.425555	2	1833.764491	1832.774089	R	S	300	315
PSM	NSLEPQTTVVHNATDGIK	445	sp|Q13555-9|KCC2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=10795	72.74663333333334	2	2003.925893	2002.936101	K	G	337	355
PSM	DINAYNCEEPTEK	446	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:4	ms_run[1]:scan=4812	36.41240166666667	2	1582.666126	1581.661702	K	L	85	98
PSM	DIVVQETMEDIDK	447	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:35	ms_run[1]:scan=8697	59.63424166666666	2	1549.723833	1549.718155	K	N	190	203
PSM	KSSTGSPTSPLNAEK	448	sp|Q15746|MYLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=3200	26.600853333333333	2	1662.696241	1662.690313	R	L	1771	1786
PSM	NAYLNNSNYEEGDEYFDK	449	sp|Q9UHW9|S12A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11996	80.44496666666666	2	2184.882617	2183.891973	R	N	114	132
PSM	TVFPGAVPVLPASPPPK	450	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=14945	100.58582666666668	2	1752.927888	1752.921560	K	D	217	234
PSM	QPSPSHDGSLSPLQDR	451	sp|Q96A00|PP14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=8725	59.78697	2	1782.7628	1782.7569	R	A	126	142
PSM	NGPLNESQEDEEDSEHGTSLNR	452	sp|Q9H2K8|TAOK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=6444	46.35156833333333	2	2536.989834	2535.998714	R	E	318	340
PSM	VYNDGYDDDNYDYIVK	453	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11800	79.24078666666666	2	1970.811739	1969.821768	K	N	135	151
PSM	GDVVNQDDLYQALASGK	454	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14562	97.92823333333334	2	1792.853915	1791.863908	R	I	246	263