MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr06.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr06.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	417-UNIMOD:21,419-UNIMOD:21	0.05	50.0	3	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	655-UNIMOD:21,658-UNIMOD:21,116-UNIMOD:4	0.04	50.0	2	2	2
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	null	145-UNIMOD:28,155-UNIMOD:21,160-UNIMOD:21	0.07	50.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	678-UNIMOD:21,683-UNIMOD:21	0.03	48.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	246-UNIMOD:35	0.05	48.0	12	2	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	129-UNIMOD:21	0.29	48.0	5	2	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	38-UNIMOD:35,52-UNIMOD:4	0.05	48.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	47.0	2	1	0
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null		0.20	47.0	2	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	69-UNIMOD:21	0.14	46.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	615-UNIMOD:21	0.01	46.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	6	2	1
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	194-UNIMOD:21	0.00	44.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	128-UNIMOD:21	0.10	44.0	2	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	529-UNIMOD:21,676-UNIMOD:21,702-UNIMOD:21,642-UNIMOD:21	0.10	44.0	9	4	2
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	801-UNIMOD:4,802-UNIMOD:21	0.02	44.0	2	1	0
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	360-UNIMOD:35,361-UNIMOD:35	0.02	44.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	138-UNIMOD:35	0.05	44.0	3	1	0
PRT	sp|Q6ZV73-2|FGD6_HUMAN	Isoform 2 of FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1197-UNIMOD:21,651-UNIMOD:21	0.03	44.0	2	2	2
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	585-UNIMOD:21	0.03	44.0	3	1	0
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	28-UNIMOD:21,37-UNIMOD:35,30-UNIMOD:21,33-UNIMOD:21	0.04	44.0	3	1	0
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	56-UNIMOD:21	0.06	44.0	1	1	1
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	17-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	2	1	0
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	253-UNIMOD:21	0.02	43.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	18-UNIMOD:21,2-UNIMOD:1	0.09	43.0	3	1	0
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	659-UNIMOD:21,657-UNIMOD:21	0.02	43.0	4	1	0
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	56-UNIMOD:21	0.04	43.0	3	1	0
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	14-UNIMOD:21	0.07	43.0	2	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.11	43.0	2	1	0
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	314-UNIMOD:21	0.03	43.0	2	2	2
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	456-UNIMOD:21,743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4	0.07	42.0	6	3	0
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	132-UNIMOD:21,133-UNIMOD:21	0.09	42.0	2	1	0
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	220-UNIMOD:4	0.05	42.0	2	2	2
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	331-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	661-UNIMOD:4,662-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	157-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	148-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	15-UNIMOD:21,13-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	383-UNIMOD:35,507-UNIMOD:4,514-UNIMOD:21	0.08	42.0	2	2	2
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.12	42.0	2	1	0
PRT	sp|P68402|PA1B2_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.10	42.0	1	1	1
PRT	sp|O94979-3|SC31A_HUMAN	Isoform 3 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	532-UNIMOD:21,527-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1305-UNIMOD:21,1311-UNIMOD:4	0.02	41.0	1	1	1
PRT	sp|Q86U38-2|NOP9_HUMAN	Isoform 2 of Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1620-UNIMOD:35,2806-UNIMOD:4,3902-UNIMOD:35	0.01	41.0	7	5	3
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	320-UNIMOD:35,323-UNIMOD:21,334-UNIMOD:4,325-UNIMOD:21,322-UNIMOD:21	0.07	41.0	3	1	0
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	203-UNIMOD:21,205-UNIMOD:4,206-UNIMOD:4,227-UNIMOD:35	0.09	41.0	1	1	1
PRT	sp|Q6GQQ9-2|OTU7B_HUMAN	Isoform 2 of OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	467-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	276-UNIMOD:35	0.02	41.0	1	1	1
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|A8K7I4|CLCA1_HUMAN	Calcium-activated chloride channel regulator 1 OS=Homo sapiens OX=9606 GN=CLCA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	88-UNIMOD:21,86-UNIMOD:21	0.06	41.0	2	1	0
PRT	sp|Q9Y6R7|FCGBP_HUMAN	IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	2208-UNIMOD:4,2211-UNIMOD:4	0.01	41.0	1	1	1
PRT	sp|P78312-3|F193A_HUMAN	Isoform 3 of Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	393-UNIMOD:21,410-UNIMOD:4,412-UNIMOD:4,415-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|Q96GN5-5|CDA7L_HUMAN	Isoform 4 of Cell division cycle-associated 7-like protein OS=Homo sapiens OX=9606 GN=CDCA7L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	71-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P24821-6|TENA_HUMAN	Isoform 6 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	106-UNIMOD:21	0.10	40.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2251-UNIMOD:21,2008-UNIMOD:21,2019-UNIMOD:35,2246-UNIMOD:21	0.01	40.0	4	2	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	1	1	1
PRT	sp|Q5TCZ1-2|SPD2A_HUMAN	Isoform 2 of SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	604-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	819-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q6V0I7-2|FAT4_HUMAN	Isoform 2 of Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|Q9HBB8-2|CDHR5_HUMAN	Isoform 2 of Cadherin-related family member 5 OS=Homo sapiens OX=9606 GN=CDHR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	549-UNIMOD:35,560-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	819-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1602-UNIMOD:21,1612-UNIMOD:35,1621-UNIMOD:4,1603-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	763-UNIMOD:35,764-UNIMOD:35,599-UNIMOD:21,605-UNIMOD:21,606-UNIMOD:35	0.04	40.0	7	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2094-UNIMOD:4	0.01	40.0	3	2	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	92-UNIMOD:35	0.10	40.0	3	1	0
PRT	sp|Q8NF50-4|DOCK8_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	833-UNIMOD:35,834-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P29972-4|AQP1_HUMAN	Isoform 4 of Aquaporin-1 OS=Homo sapiens OX=9606 GN=AQP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	1	1	1
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	105-UNIMOD:28	0.12	40.0	2	2	2
PRT	sp|Q53TN4|CYBR1_HUMAN	Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	249-UNIMOD:35,257-UNIMOD:35,260-UNIMOD:21	0.09	40.0	1	1	1
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	207-UNIMOD:21	0.07	40.0	2	1	0
PRT	sp|P35749-4|MYH11_HUMAN	Isoform 4 of Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1752-UNIMOD:35,1755-UNIMOD:35,596-UNIMOD:35	0.05	39.0	6	6	6
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.04	39.0	8	2	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	77-UNIMOD:21	0.10	39.0	3	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	19-UNIMOD:21	0.16	39.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1882-UNIMOD:21,1899-UNIMOD:4	0.02	39.0	2	2	2
PRT	sp|O75398-5|DEAF1_HUMAN	Isoform 4 of Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	176-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	631-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	383-UNIMOD:21,400-UNIMOD:21,1378-UNIMOD:21	0.02	39.0	2	2	2
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	499-UNIMOD:21,503-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	484-UNIMOD:21,487-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	971-UNIMOD:21,979-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	264-UNIMOD:21,279-UNIMOD:35	0.07	39.0	1	1	1
PRT	sp|P39060-2|COIA1_HUMAN	Isoform 3 of Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	290-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:35,10-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	352-UNIMOD:35	0.03	39.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	85-UNIMOD:21	0.19	39.0	1	1	1
PRT	sp|Q9NQ79-3|CRAC1_HUMAN	Isoform 3 of Cartilage acidic protein 1 OS=Homo sapiens OX=9606 GN=CRTAC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	120-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|Q8WUA7-4|TB22A_HUMAN	Isoform 4 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	100-UNIMOD:21,104-UNIMOD:4,118-UNIMOD:21	0.11	39.0	2	2	2
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1243-UNIMOD:21,1245-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1932-UNIMOD:21,1915-UNIMOD:21	0.01	39.0	2	2	2
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.12	39.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	252-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	116-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	39-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	80-UNIMOD:21	0.20	38.0	1	1	1
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	224-UNIMOD:21,71-UNIMOD:21	0.11	38.0	2	2	2
PRT	sp|O94887|FARP2_HUMAN	FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	439-UNIMOD:21	0.04	38.0	2	2	2
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	188-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1934-UNIMOD:35	0.03	38.0	4	4	4
PRT	sp|Q14183-2|DOC2A_HUMAN	Isoform 2 of Double C2-like domain-containing protein alpha OS=Homo sapiens OX=9606 GN=DOC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	385-UNIMOD:21	0.04	38.0	6	2	1
PRT	sp|O43182-5|RHG06_HUMAN	Isoform 5 of Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	159-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1183-UNIMOD:21,1188-UNIMOD:21,1179-UNIMOD:21,1187-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	917-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	387-UNIMOD:4,396-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	88-UNIMOD:35	0.09	38.0	2	1	0
PRT	sp|Q9BZ71|PITM3_HUMAN	Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	295-UNIMOD:21,310-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	299-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	167-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	247-UNIMOD:21,249-UNIMOD:21	0.05	38.0	2	1	0
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	125-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	766-UNIMOD:35	0.00	38.0	2	1	0
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	220-UNIMOD:21,224-UNIMOD:21,939-UNIMOD:21,951-UNIMOD:35	0.05	38.0	2	2	2
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	72-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O75122-3|CLAP2_HUMAN	Isoform 3 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	838-UNIMOD:21,840-UNIMOD:35,854-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	57-UNIMOD:4,62-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|P63267|ACTH_HUMAN	Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	306-UNIMOD:35	0.06	37.0	1	1	1
PRT	sp|Q4VCS5-2|AMOT_HUMAN	Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	305-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1679-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	659-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q6ZMZ3|SYNE3_HUMAN	Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	908-UNIMOD:4,914-UNIMOD:4,921-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	255-UNIMOD:21	0.05	37.0	3	2	1
PRT	sp|P23229-4|ITA6_HUMAN	Isoform Alpha-6X2A of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|O60237-4|MYPT2_HUMAN	Isoform 4 of Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	394-UNIMOD:21,400-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	551-UNIMOD:21,552-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|P08183-2|MDR1_HUMAN	Isoform 2 of ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	589-UNIMOD:35	0.01	37.0	1	1	1
PRT	sp|Q9Y2H0-3|DLGP4_HUMAN	Isoform 3 of Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	81-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	426-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	287-UNIMOD:21,289-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	161-UNIMOD:4,171-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|Q9HCH5-7|SYTL2_HUMAN	Isoform 5 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	884-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	868-UNIMOD:21,872-UNIMOD:35,874-UNIMOD:21,883-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P01009-2|A1AT_HUMAN	Isoform 2 of Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	453-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q3L8U1-2|CHD9_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	654-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	3	1	0
PRT	sp|P01042|KNG1_HUMAN	Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	325-UNIMOD:27,328-UNIMOD:4,332-UNIMOD:21,340-UNIMOD:4	0.03	37.0	2	1	0
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:21,115-UNIMOD:21	0.07	36.0	2	2	2
PRT	sp|Q16568|CART_HUMAN	Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	48-UNIMOD:21	0.14	36.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	92-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q8TE77-4|SSH3_HUMAN	Isoform 4 of Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	70-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1380-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O14523|C2C2L_HUMAN	Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	660-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	24-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	2	2
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	649-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P06753-5|TPM3_HUMAN	Isoform 5 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	2	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	770-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35,1176-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	377-UNIMOD:35	0.10	36.0	2	2	2
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O15061|SYNEM_HUMAN	Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1044-UNIMOD:21,1049-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9Y4J8-6|DTNA_HUMAN	Isoform 6 of Dystrobrevin alpha OS=Homo sapiens OX=9606 GN=DTNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	229-UNIMOD:21,231-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	626-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|O15117|FYB1_HUMAN	FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	457-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	284-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q96PN7-2|TREF1_HUMAN	Isoform 2 of Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	825-UNIMOD:21,844-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	293-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	921-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	136-UNIMOD:35,139-UNIMOD:35	0.07	36.0	1	1	1
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	46-UNIMOD:385,46-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|P17677|NEUM_HUMAN	Neuromodulin OS=Homo sapiens OX=9606 GN=GAP43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	147-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	518-UNIMOD:21,527-UNIMOD:21	0.03	35.0	2	1	0
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2917-UNIMOD:4,2924-UNIMOD:4,2930-UNIMOD:4	0.00	35.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	350-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	13-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q6P4A8|PLBL1_HUMAN	Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	489-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q00722-3|PLCB2_HUMAN	Isoform 3 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O43301|HS12A_HUMAN	Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	985-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P01042-3|KNG1_HUMAN	Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:21,292-UNIMOD:4,304-UNIMOD:4	0.05	35.0	1	1	0
PRT	sp|Q2TAL5|SMTL2_HUMAN	Smoothelin-like protein 2 OS=Homo sapiens OX=9606 GN=SMTNL2 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	134-UNIMOD:21,145-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1330-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	133-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9UGM5-2|FETUB_HUMAN	Isoform 2 of Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	278-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1119-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1570-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	604-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	502-UNIMOD:35,505-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|P29350|PTN6_HUMAN	Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P82970|HMGN5_HUMAN	High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	93-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	391-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q7Z3J2-2|VP35L_HUMAN	Isoform 2 of VPS35 endosomal protein sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	953-UNIMOD:21	0.01	35.0	4	1	0
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.00	35.0	1	1	1
PRT	sp|O94919|ENDD1_HUMAN	Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	712-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	309-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	355-UNIMOD:21,361-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	613-UNIMOD:4,614-UNIMOD:21,618-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q9HCY8|S10AE_HUMAN	Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	3049-UNIMOD:21,3069-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	165-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:21	0.17	35.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	798-UNIMOD:4,800-UNIMOD:21,814-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q8NFP9|NBEA_HUMAN	Neurobeachin OS=Homo sapiens OX=9606 GN=NBEA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1730-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	629-UNIMOD:21,644-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q8IV36-3|HID1_HUMAN	Isoform 3 of Protein HID1 OS=Homo sapiens OX=9606 GN=HID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	412-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	140-UNIMOD:21,151-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	5-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	0.07	35.0	1	1	1
PRT	sp|Q9NWS9-2|ZN446_HUMAN	Isoform 2 of Zinc finger protein 446 OS=Homo sapiens OX=9606 GN=ZNF446	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	137-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1800-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	1	1	1
PRT	sp|Q9ULV3-5|CIZ1_HUMAN	Isoform 5 of Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	151-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q96MM6|HS12B_HUMAN	Heat shock 70 kDa protein 12B OS=Homo sapiens OX=9606 GN=HSPA12B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	36-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O75022|LIRB3_HUMAN	Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	530-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	251-UNIMOD:27,263-UNIMOD:21	0.03	35.0	1	1	0
PRT	sp|Q6NYC8|PPR18_HUMAN	Phostensin OS=Homo sapiens OX=9606 GN=PPP1R18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	100-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	120-UNIMOD:27,123-UNIMOD:21	0.09	35.0	1	1	0
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	175-UNIMOD:28,187-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q6NUK4|REEP3_HUMAN	Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	210-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	646-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	401-UNIMOD:21,405-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1534-UNIMOD:4,1540-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	17-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q14376-2|GALE_HUMAN	Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|P25940|CO5A3_HUMAN	Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	351-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2475-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9P219|DAPLE_HUMAN	Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q96S66-4|CLCC1_HUMAN	Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	324-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	184-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|Q70EL1-6|UBP54_HUMAN	Isoform 3 of Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	481-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	616-UNIMOD:21,626-UNIMOD:21,634-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|O43432|IF4G3_HUMAN	Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1156-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q96QE3-2|ATAD5_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|O95671-3|ASML_HUMAN	Isoform 3 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	170-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	391-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q96FZ7|CHMP6_HUMAN	Charged multivesicular body protein 6 OS=Homo sapiens OX=9606 GN=CHMP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q5VSL9-4|STRP1_HUMAN	Isoform 4 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	59-UNIMOD:21	0.10	34.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q96RU8|TRIB1_HUMAN	Tribbles homolog 1 OS=Homo sapiens OX=9606 GN=TRIB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9BUJ2-2|HNRL1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	343-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P01871|IGHM_HUMAN	Immunoglobulin heavy constant mu OS=Homo sapiens OX=9606 GN=IGHM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	357-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9Y2M0-2|FAN1_HUMAN	Isoform 2 of Fanconi-associated nuclease 1 OS=Homo sapiens OX=9606 GN=FAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	169-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q9UJF2|NGAP_HUMAN	Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	16-UNIMOD:21,29-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	944-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P00488|F13A_HUMAN	Coagulation factor XIII A chain OS=Homo sapiens OX=9606 GN=F13A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	521-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q8N9M5|TM102_HUMAN	Transmembrane protein 102 OS=Homo sapiens OX=9606 GN=TMEM102 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	216-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:4,86-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	283-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	364-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1132-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	350-UNIMOD:4,359-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	448-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P30049|ATPD_HUMAN	ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|Q70E73|RAPH1_HUMAN	Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	805-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P52735|VAV2_HUMAN	Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	75-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|O43909|EXTL3_HUMAN	Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	632-UNIMOD:21,634-UNIMOD:21,646-UNIMOD:21	0.02	34.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LPNLSSPSAEGPPGPPSGPAPR	1	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	6-UNIMOD:21	ms_run[2]:scan=14022	70.577	2	2161.0205	2161.0205	R	K	412	434
PSM	SRTSVQTEDDQLIAGQSAR	2	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9996	51.001	2	2220.9413	2220.9413	R	A	652	671
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	3	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=5974	32.229018333333336	3	3007.3325	3007.3290	K	S	145	174
PSM	AAPEASSPPASPLQHLLPGK	4	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=18241	95.475	2	2126.9803	2126.9803	K	A	673	693
PSM	DPDAQPGGELMLGGTDSK	5	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	11-UNIMOD:35	ms_run[2]:scan=11403	57.56	2	1802.7993	1802.7993	R	Y	236	254
PSM	GDQPAASGDSDDDEPPPLPR	6	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9930	50.709	2	2034.8767	2034.8767	R	L	48	68
PSM	MAEGGSGDVDDAGDCSGAR	7	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=1792	12.133	2	1841.6792	1841.6792	K	Y	38	57
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	8	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13527	68.01	3	2789.2772	2789.2772	R	T	112	140
PSM	VDNALQSGNSQESVTEQDSK	9	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=5816	31.495	2	2134.9614	2134.9614	K	D	43	63
PSM	GDQPAASGDSDDDEPPPLPR	10	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=10166	51.738	2	2034.8767	2034.8767	R	L	48	68
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	11	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:21	ms_run[2]:scan=9075	46.774	3	2796.2339	2796.2339	K	K	68	94
PSM	TSGPLSPPTGPPGPAPAGPAVR	12	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=14379	72.463	2	2060.0092	2060.0092	K	L	610	632
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	13	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=13725	69.05614333333334	3	2789.277696	2789.277184	R	T	112	140
PSM	DPDAQPGGELMLGGTDSK	14	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:35	ms_run[2]:scan=10989	55.539	2	1802.7993	1802.7993	R	Y	236	254
PSM	GDQPAASGDSDDDEPPPLPR	15	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=9704	49.671	2	2034.8767	2034.8767	R	L	48	68
PSM	LYGSAGPPPTGEEDTAEKDEL	16	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13232	66.555	2	2174.9855	2174.9855	K	-	634	655
PSM	DAHDVSPTSTDTEAQLTVER	17	sp|Q8IVF2-3|AHNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=11250	56.812	2	2250.9642	2250.9642	R	Q	189	209
PSM	DPDAQPGGELMLGGTDSK	18	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=11194	56.544	2	1802.7993	1802.7993	R	Y	236	254
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	19	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=8438	43.796	3	3001.2673	3001.2673	R	E	120	150
PSM	ESEDDLNKESEEEVGPTK	20	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=5820	31.513	2	2113.8576	2113.8576	K	E	520	538
PSM	GDQPAASGDSDDDEPPPLPR	21	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=9482	48.639	2	2034.8767	2034.8767	R	L	48	68
PSM	LCSSSDTLVSEGEENQKPK	22	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=9014	46.517	2	2186.9403	2186.9403	R	K	800	819
PSM	LYGSAGPPPTGEEDTAEKDEL	23	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12823	64.5	2	2174.9855	2174.9855	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	24	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13025	65.523	2	2174.9855	2174.9855	K	-	634	655
PSM	MMDYLQGSGETPQTDVR	25	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=10111	51.511	2	1958.835	1958.8350	K	W	360	377
PSM	PVTVEPMDQLDDEEGLPEK	26	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:35	ms_run[2]:scan=14003	70.474	2	2155.9831	2155.9831	R	L	132	151
PSM	SLDEADSENKEEVSPLGSK	27	sp|Q6ZV73-2|FGD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=9841	50.328	2	2112.91	2112.9100	R	A	1197	1216
PSM	SSPPAPPLPPGSGSPGTPQALPR	28	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=15258	77.37	2	2244.094	2244.0940	R	R	585	608
PSM	SVSKESVASMGADSGDDFASDGSSSR	29	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8679	44.945	2	2631.028	2631.0280	R	E	28	54
PSM	VAYEGSDSEKGEGAEPLK	30	sp|P78549-3|NTH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=6885	36.494	2	1944.8354	1944.8354	R	V	51	69
PSM	GSSGSPAHAESYSSGGGGQQK	31	sp|P15408|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=1109	8.6973	2	2014.8018	2014.8018	R	F	15	36
PSM	LPNLSSPSAEGPPGPPSGPAPR	32	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=14250	71.744	2	2161.0205	2161.0205	R	K	412	434
PSM	LSEGSQPAEEEEDQETPSR	33	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5303	29.105	2	2116.9033	2116.9033	K	N	239	258
PSM	NFDDEDSVDGNRPSSASSTSSK	34	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=5702	30.957	2	2380.9292	2380.9292	K	A	240	262
PSM	SETAPAETATPAPVEKSPAK	35	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=5213	28.664	2	2060.9667	2060.9667	M	K	2	22
PSM	SQSESSDEVTELDLSHGK	36	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=11498	57.984	2	2026.8368	2026.8368	R	K	657	675
PSM	SVSKESVASMGADSGDDFASDGSSSR	37	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=12336	62.146	3	2615.033	2615.0330	R	E	28	54
PSM	SYEDLTESEDGAASGDSHK	38	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=7792	40.733	2	2076.7797	2076.7797	R	E	56	75
PSM	TAKDSDDDDDVAVTVDR	39	sp|Q16623-3|STX1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=7109	37.584	2	1915.7684	1915.7684	R	D	10	27
PSM	TTTTNTQVEGDDEAAFLER	40	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14449	72.841	2	2096.9498	2096.9498	K	L	75	94
PSM	GDQPAASGDSDDDEPPPLPR	41	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=9442	48.464801666666666	2	2035.865741	2034.876657	R	L	48	68
PSM	PEDTGAEKSPTTSADLK	42	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	9-UNIMOD:21	ms_run[1]:scan=3545	20.801423333333332	2	1825.7981	1825.7977	D	S	306	323
PSM	DPDAQPGGELMLGGTDSK	43	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=10773	54.526	2	1802.7993	1802.7993	R	Y	236	254
PSM	ESTQLSPADLTEGKPTDPSK	44	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=11970	60.319	2	2179.9886	2179.9886	R	L	451	471
PSM	GNAEGSSDEEGKLVIDEPAK	45	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=10514	53.336	2	2123.926	2123.9260	K	E	127	147
PSM	LPDSDDDEDEETAIQR	46	sp|Q96K21-4|ANCHR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8626	44.715	2	1846.7705	1846.7705	R	V	176	192
PSM	LSDAGQYLCQAGDDSNSNK	47	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:4	ms_run[2]:scan=10625	53.843	2	2041.8647	2041.8647	R	K	212	231
PSM	SEVERPASIPLSSGYSTASSDSTPR	48	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=13654	68.685	3	2660.1967	2660.1967	K	A	324	349
PSM	SGCSDLEEAVDSGADKK	49	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=11959	60.269	2	1846.7292	1846.7292	K	F	659	676
PSM	SSPPAPPLPPGSGSPGTPQALPR	50	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=15073	76.361	2	2244.094	2244.0940	R	R	585	608
PSM	SSTPSHGQTTATEPTPAQK	51	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=1405	10.161	2	2004.879	2004.8790	R	T	153	172
PSM	STVTGERQSGDGQESTEPVENK	52	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=3007	18.3	2	2414.0235	2414.0235	K	V	140	162
PSM	VSESEGKLEGQATAVTPNK	53	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=9390	48.227	2	2023.9463	2023.9463	K	N	12	31
PSM	YDAFGEDSSSAMGVENR	54	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:35	ms_run[2]:scan=9936	50.734	2	1849.7425	1849.7425	R	A	372	389
PSM	YPDLYPQEDEDEEEER	55	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13349	67.101	2	2054.8229	2054.8229	K	E	101	117
PSM	SETAPAETATPAPVEKSPAK	56	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7663	40.10824166666667	2	2102.9810	2102.9768	M	K	2	22
PSM	SQGDSNPAAIPHAAEDIQGDDR	57	sp|P68402|PA1B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1	ms_run[1]:scan=12772	64.26561666666666	2	2305.0195	2305.0202	M	W	2	24
PSM	DPDAQPGGELMLGGTDSK	58	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12991	65.365	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	59	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=16573	84.809	3	2861.224	2861.2240	K	E	520	546
PSM	GVVPLAGTDGETTTQGLDGLSER	60	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17410	90.057	2	2272.1183	2272.1183	K	C	112	135
PSM	IETDEEESCDNAHGDANQPAR	61	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3160	19.017	2	2436.9125	2436.9125	R	D	1303	1324
PSM	LLGSAAEEEEEEEEDGK	62	sp|Q86U38-2|NOP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9721	49.748	2	1862.7905	1862.7905	R	D	156	173
PSM	MDVNVGDIDIEGPEGK	63	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35	ms_run[2]:scan=15768	80.161	2	1702.772	1702.7720	K	L	1620	1636
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	64	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,4-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10397	52.79	3	3061.253	3061.2530	R	V	320	347
PSM	SQSESSDEVTELDLSHGK	65	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10913	55.156	2	2026.8368	2026.8368	R	K	657	675
PSM	SSPPAPPLPPGSGSPGTPQALPR	66	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=14709	74.34	2	2244.094	2244.0940	R	R	585	608
PSM	SSSQPSSCCSDPSKPGGNVEGATQSLAEQMR	67	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:4,30-UNIMOD:35	ms_run[2]:scan=10895	55.081	3	3334.3537	3334.3538	K	K	198	229
PSM	STPESGDSDKESVGSSSTSNEGGR	68	sp|Q6GQQ9-2|OTU7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=1479	10.487	2	2435.9562	2435.9562	R	R	460	484
PSM	VLAVNQENEQLMEDYEK	69	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:35	ms_run[2]:scan=13077	65.786	2	2066.9467	2066.9467	K	L	265	282
PSM	YYSPCEEHPAETNQNEGAESGTIR	70	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8860	45.814	3	2818.1178	2818.1178	R	Q	182	206
PSM	DPDAQPGGELMLGGTDSK	71	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:35	ms_run[1]:scan=11516	58.062555	2	1803.791913	1802.799259	R	Y	236	254
PSM	TVTLELLDNGAGADATK	72	sp|A8K7I4|CLCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=17232	88.95877333333333	2	1687.854100	1687.862845	K	D	637	654
PSM	DQQPSGSEGEDDDAEAALKK	73	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	7-UNIMOD:21	ms_run[1]:scan=7098	37.53136	2	2169.878597	2168.874682	K	E	82	102
PSM	VPAAYAGSLCGLCGNYNQDPADDLK	74	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=18404	96.58061	3	2669.174572	2668.189752	R	A	2199	2224
PSM	ADSPPPSYPTQQAEQAPNTCECHVCK	75	sp|P78312-3|F193A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,20-UNIMOD:4,22-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=8960	46.294	3	3051.2198	3051.2198	K	Q	391	417
PSM	ASLVSEEEEDEEEDKATPR	76	sp|Q96GN5-5|CDA7L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=11747	59.194	2	2241.9162	2241.9162	K	R	67	86
PSM	CECDDGFTGADCGELK	77	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10533	53.435	2	1832.6651	1832.6652	R	C	392	408
PSM	DDDDIDLFGSDDEEESEEAKR	78	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=16367	83.587	2	2507.9337	2507.9337	K	L	97	118
PSM	DQQPSGSEGEDDDAEAALKK	79	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=6881	36.475	2	2168.8747	2168.8747	K	E	82	102
PSM	EDALDDSVSSSSVHASPLASSPVR	80	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:21	ms_run[2]:scan=14163	71.298	2	2492.1068	2492.1068	R	K	2231	2255
PSM	GIVDQSQQAYQEAFEISK	81	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19293	102.85	2	2039.98	2039.9800	K	K	140	158
PSM	GNAEGSSDEEGKLVIDEPAK	82	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=10731	54.337	2	2123.926	2123.9260	K	E	127	147
PSM	GPSSEGPEEEDGEGFSFK	83	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12887	64.849	2	1883.7697	1883.7697	K	Y	125	143
PSM	GSKSEDSELPPQTASEAPSEGSR	84	sp|Q5TCZ1-2|SPD2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=7140	37.718	3	2425.0282	2425.0282	K	R	601	624
PSM	KLSSSDAPAQDTGSSAAAVETDASR	85	sp|Q7Z4S6-6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=9462	48.551	2	2501.0919	2501.0919	R	T	815	840
PSM	LSQVNESDADDEDNYGAR	86	sp|Q6V0I7-2|FAT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7094	37.512	2	1996.8246	1996.8246	K	L	3111	3129
PSM	PAEAPMPAEPAPPGPASPGGAPEPPAAAR	87	sp|Q9HBB8-2|CDHR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=11295	57.051	3	2753.252	2753.2520	K	A	544	573
PSM	SSSPAELDLKDDLQQTQGK	88	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=14572	73.548	2	2138.9733	2138.9733	R	C	819	838
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	89	sp|Q9BY89|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9826	50.262	3	3138.2319	3138.2319	R	R	1596	1625
PSM	TAKDSDDDDDVAVTVDR	90	sp|Q16623-3|STX1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=6816	36.151	2	1915.7684	1915.7684	R	D	10	27
PSM	TEDSDDIHFEPVVQMPEK	91	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=14514	73.218	2	2210.9079	2210.9079	K	V	2005	2023
PSM	VAEEDEDDDGGIMMR	92	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3178	19.114	2	1712.6505	1712.6505	K	S	751	766
PSM	VAEEDEDDDGGIMMR	93	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4034	23.172	2	1712.6505	1712.6505	K	S	751	766
PSM	VANPSGNLTETYVQDR	94	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11762	59.259	2	1762.8486	1762.8486	R	G	1297	1313
PSM	VDPSLMEDSDDGPSLPTK	95	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:35	ms_run[2]:scan=11945	60.2	2	1917.8514	1917.8514	K	Q	87	105
PSM	VMSSSNPDLAGTHSAADEEVK	96	sp|Q8NF50-4|DOCK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=7023	37.182	2	2239.9304	2239.9304	R	N	832	853
PSM	VWTSGQVEEYDLDADDINSR	97	sp|P29972-4|AQP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17188	88.659	2	2311.024	2311.0240	K	V	129	149
PSM	YPDLYPQEDEDEEEER	98	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13127	66.036	2	2054.8229	2054.8229	K	E	101	117
PSM	QHLENDPGSNEDTDIPK	99	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=9541	48.90325	2	1890.8217	1890.8226	K	G	105	122
PSM	GDQPAASGDSDDDEPPPLPR	100	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=9206	47.379153333333335	2	2035.865741	2034.876657	R	L	48	68
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	101	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6556	34.908755	3	3007.3313	3007.3290	K	S	145	174
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	102	sp|Q53TN4|CYBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=9166	47.19123333333333	3	2742.078581	2741.094605	R	K	247	272
PSM	AAESVSKPDVSEEAPGPSK	103	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21	ms_run[1]:scan=6570	34.971468333333334	2	1963.880400	1963.877583	K	V	204	223
PSM	ATQQAEQLSNELATER	104	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12560	63.245	2	1787.865	1787.8650	K	S	1762	1778
PSM	DPDAQPGGELMLGGTDSK	105	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=11628	58.624	2	1802.7993	1802.7993	R	Y	236	254
PSM	EEEAIQLDGLNASQIR	106	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17122	88.272	2	1784.8905	1784.8905	R	E	52	68
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	107	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	22-UNIMOD:21	ms_run[2]:scan=7657	40.082	3	3061.3513	3061.3513	K	G	56	88
PSM	ELVSSSSSGSDSDSEVDKK	108	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=3645	21.249	2	2021.8314	2021.8314	K	L	6	25
PSM	GGNDSDELANGEVGGDR	109	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5841	31.604	2	1660.6925	1660.6925	K	N	1427	1444
PSM	GPAAPLTPGPQSPPTPLAPGQEK	110	sp|O75398-5|DEAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=14419	72.673	2	2287.125	2287.1250	K	G	165	188
PSM	GSDALSETSSVSHIEDLEK	111	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=14934	75.604	2	2082.8994	2082.8994	R	V	622	641
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	112	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=13898	69.925	3	3011.3427	3011.3427	R	D	374	402
PSM	IDENSDKEMEVEESPEK	113	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4466	25.197	2	2102.8239	2102.8239	K	I	495	512
PSM	KASSPSPLTIGTPESQR	114	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10583	53.662	2	1914.8489	1914.8489	R	K	482	499
PSM	KPSVGVPPPASPSYPR	115	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10577	53.635	2	1794.8107	1794.8107	R	A	969	985
PSM	LFEESDDKEDEDADGK	116	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=6375	34.096	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	117	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=6600	35.115	2	1920.715	1920.7150	K	E	672	688
PSM	LNESDEQHQENEGTNQLVMGIQK	118	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=12256	61.72	3	2736.1698	2736.1698	K	Q	261	284
PSM	LPAPPPVTTPPLAGGSSTEDSR	119	sp|P39060-2|COIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=15515	78.724	2	2226.0569	2226.0569	R	S	274	296
PSM	LPNLSSPSAEGPPGPPSGPAPR	120	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=14030	70.616	3	2161.0205	2161.0205	R	K	412	434
PSM	MGDEDDDESCAVELR	121	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=8273	43.051	2	1755.6564	1755.6564	-	I	1	16
PSM	MQQQLDEYQELLDIK	122	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35	ms_run[2]:scan=20323	110.75	2	1908.9139	1908.9139	R	L	352	367
PSM	PVPAAPVPSPVAPAPVPSR	123	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=14024	70.584	2	1884.9863	1884.9863	K	R	77	96
PSM	QGNAIGVTACDIDGDGR	124	sp|Q9NQ79-3|CRAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=10179	51.79	2	1717.769	1717.7690	R	E	111	128
PSM	SEDFGVNEDLADSDAR	125	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13450	67.627	2	1738.7282	1738.7282	R	A	189	205
PSM	SVSESHTSCPAESASDAAPLQR	126	sp|Q8WUA7-4|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8218	42.794	2	2365.9846	2365.9846	K	S	96	118
PSM	TASRPDDIPDSPSSPK	127	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5637	30.669	2	1828.7282	1828.7282	R	V	1233	1249
PSM	TTKTPEDGDYSYEIIEK	128	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=13229	66.538	2	2067.8926	2067.8926	K	T	1929	1946
PSM	VAEEDEDDDGGIMMR	129	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3839	22.173	2	1712.6505	1712.6505	K	S	751	766
PSM	VGDAIPAVEVFEGEPGNK	130	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19078	101.26	2	1826.905	1826.9050	K	V	6	24
PSM	VISDSESDIGGSDVEFKPDTK	131	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=13832	69.586	2	2304.0046	2304.0046	R	E	250	271
PSM	YLVVNADEGEPGTCK	132	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4	ms_run[2]:scan=10373	52.685	2	1650.7559	1650.7559	K	D	103	118
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	133	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=11568	58.31174	3	3174.244479	3173.243468	R	-	738	768
PSM	EVAENQQNQSSDPEEEKGSQPPPAAESQSSLR	134	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=7216	38.082973333333335	3	3533.508913	3532.522724	K	R	29	61
PSM	DASTLQSQKAEGTGDAK	135	sp|O00479|HMGN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=1439	10.311	2	1785.7782	1785.7782	R	-	74	91
PSM	DGSNKSGAEEQGPIDGPSK	136	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=3101	18.74	2	1951.816	1951.8160	K	S	219	238
PSM	DSSSSLTDPQVSYVKSPAAER	137	sp|O94887|FARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=11960	60.273	2	2303.0319	2303.0319	K	R	424	445
PSM	DSTSQHDDDNISTTSGFSSR	138	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=7758	40.594	2	2235.8553	2235.8553	K	A	171	191
PSM	EAQAALAEAQEDLESER	139	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16476	84.243	2	1858.8545	1858.8545	R	V	1132	1149
PSM	ELEQAEQGQGLLEER	140	sp|Q14183-2|DOC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12798	64.38	2	1727.8326	1727.8326	K	G	120	135
PSM	ESEDKPEIEDVGSDEEEEK	141	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=8433	43.767	2	2271.8792	2271.8792	K	K	373	392
PSM	GAMSVDSITDLDDNQSR	142	sp|O43182-5|RHG06_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:35	ms_run[2]:scan=12146	61.18	2	1838.7952	1838.7952	R	L	157	174
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	143	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:21,29-UNIMOD:21	ms_run[2]:scan=13191	66.355	3	3371.3239	3371.3239	R	S	1160	1192
PSM	GAVAAEGASDTEREEPTESQGLAAR	144	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=9008	46.491	3	2581.1293	2581.1293	R	L	907	932
PSM	GDVPSVGLEGPDVDLQGPEAK	145	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17419	90.11	2	2078.0168	2078.0168	K	I	5210	5231
PSM	IAQLEEELEEEQGNMEAMSDR	146	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=15484	78.571	3	2482.0476	2482.0476	R	V	1738	1759
PSM	IECVSAETTEDCIAK	147	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10118	51.541	2	1724.7597	1724.7597	K	I	385	400
PSM	INEELESQYQQSMDSK	148	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:35	ms_run[2]:scan=8724	45.163	2	1943.8419	1943.8419	K	L	76	92
PSM	INEELESQYQQSMDSK	149	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:35	ms_run[2]:scan=9112	46.941	2	1943.8419	1943.8419	K	L	76	92
PSM	KGSISSTQDTPVAVEEDCSLASSK	150	sp|Q9BZ71|PITM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=12796	64.373	3	2575.1361	2575.1361	R	R	293	317
PSM	LEGLGSSEADQDGLASTVR	151	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14116	71.068	2	1903.9123	1903.9123	R	S	455	474
PSM	LFEESDDKEDEDADGK	152	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=6167	33.082	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	153	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=6811	36.129	2	1920.715	1920.7150	K	E	672	688
PSM	LNQVCFDDDGTSSPQDR	154	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4	ms_run[2]:scan=10091	51.424	2	1952.817	1952.8170	K	L	295	312
PSM	LYGSAGPPPTGEEDTAEKDEL	155	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13436	67.56	2	2174.9855	2174.9855	K	-	634	655
PSM	LYQPEYQEVSTEEQR	156	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11405	57.567	2	1897.8694	1897.8694	K	E	754	769
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	157	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10800	54.661	3	3045.258	3045.2580	R	V	320	347
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	158	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=4999	27.564	3	3336.3553	3336.3553	R	R	157	186
PSM	SAEIDSDDTGGSAAQK	159	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1634	11.298	2	1550.6696	1550.6696	K	Q	814	830
PSM	SEDFGVNEDLADSDAR	160	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13660	68.714	2	1738.7282	1738.7282	R	A	189	205
PSM	SQSESSDEVTELDLSHGK	161	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11715	59.054	2	2026.8368	2026.8368	R	K	657	675
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	162	sp|Q8WUA7-4|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=17008	87.546	3	2952.3714	2952.3714	R	E	118	147
PSM	SRTASGSSVTSLDGTR	163	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=6197	33.229	2	1740.7081	1740.7081	R	S	245	261
PSM	SSEDLAGPLPSSVSSSSTTSSKPK	164	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11508	58.029	2	2415.1054	2415.1054	R	L	125	149
PSM	SSQLGDTTTGHLSSGEQK	165	sp|Q6ZV73-2|FGD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=5984	32.274	2	1911.8211	1911.8211	K	G	651	669
PSM	SVLDQDDVDTSMEESLK	166	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:35	ms_run[2]:scan=12260	61.734	2	1925.8412	1925.8412	K	H	755	772
PSM	SVSKESVASMGADSGDDFASDGSSSR	167	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8637	44.765	3	2631.028	2631.0280	R	E	28	54
PSM	TAGPLESSETEEASQLK	168	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11586	58.41	2	1775.8425	1775.8425	R	E	901	918
PSM	TKDQPDGSSLSPAQSPSQSQPPAASSLR	169	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9915	50.644	3	2983.2962	2983.2962	R	E	210	238
PSM	VAEEDEDDDGGIMMR	170	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:35	ms_run[2]:scan=7426	39.012	2	1696.6556	1696.6556	K	S	751	766
PSM	VASGSDLHLTDIDSDSNR	171	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=12861	64.707	2	1980.8426	1980.8426	K	G	70	88
PSM	VVVAENFDEIVNNENK	172	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17161	88.505	2	1831.8952	1831.8952	K	D	380	396
PSM	YESYGMHSDDDANSDASSACSER	173	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,6-UNIMOD:35,20-UNIMOD:4	ms_run[2]:scan=4766	26.546	3	2648.8905	2648.8905	R	S	835	858
PSM	SETAPAETATPAPVEKSPAK	174	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=7352	38.65504333333333	2	2023.0110	2023.0104	M	K	2	22
PSM	GVITDQNSDGYCQTGTMSR	175	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:4,17-UNIMOD:35	ms_run[1]:scan=7221	38.10595166666667	2	2105.863925	2104.878983	R	H	46	65
PSM	AAAGEFADDPCSSVK	176	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4	ms_run[2]:scan=8653	44.837	2	1523.6562	1523.6562	K	R	106	121
PSM	AATEALGEKSPDSATVSGYDIMK	177	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=12332	62.126	2	2436.0768	2436.0768	K	S	930	953
PSM	ASVDSGSSEEQGGSSR	178	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=615	5.9471	2	1538.6445	1538.6445	R	A	623	639
PSM	DLYANNVLSGGTTMYPGIADR	179	sp|P63267|ACTH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:35	ms_run[2]:scan=18183	95.081	2	2243.0528	2243.0528	K	M	293	314
PSM	DTTVISHSPNTSYDTALEAR	180	sp|Q4VCS5-2|AMOT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=13169	66.25	2	2256.99	2256.9900	R	I	298	318
PSM	DYEPPSPSPAPGAPPPPPQR	181	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9689	49.605	2	2132.9568	2132.9568	R	N	1674	1694
PSM	EEPLSEEEPCTSTAIASPEKK	182	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=10791	54.615	2	2411.0451	2411.0451	K	K	498	519
PSM	EKPDSDDDLDIASLVTAK	183	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=19427	103.81	2	2010.9035	2010.9035	R	L	655	673
PSM	ESEDKPEIEDVGSDEEEEK	184	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=8643	44.792	2	2271.8792	2271.8792	K	K	373	392
PSM	ESTQLSPADLTEGKPTDPSK	185	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=11776	59.32	2	2179.9886	2179.9886	R	L	451	471
PSM	GEAGPGDAESQEAEFER	186	sp|Q6ZMZ3|SYNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9325	47.926	2	1777.7391	1777.7391	R	L	676	693
PSM	GTGGVDTAATGGVFDISNLDR	187	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19487	104.24	2	2021.9654	2021.9654	R	L	354	375
PSM	GTQCEDIDECEVFPGVCK	188	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=15745	80.029	2	2141.8704	2141.8704	K	N	905	923
PSM	IEDVGSDEEDDSGKDK	189	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=2650	16.571	2	1816.6888	1816.6888	K	K	250	266
PSM	IEFDNDADPTSESK	190	sp|P23229-4|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8757	45.341	2	1566.6686	1566.6686	R	E	97	111
PSM	IPDPDSDDVSEVDAR	191	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10104	51.481	2	1628.7166	1628.7166	K	H	690	705
PSM	LAEFSSQAAEEEEK	192	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9161	47.168	2	1566.7049	1566.7049	R	V	1025	1039
PSM	LDDDDEGVPSSALR	193	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10130	51.588	2	1487.674	1487.6740	R	E	37	51
PSM	LESGGSNPTTSDSYGDR	194	sp|O60237-4|MYPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=4127	23.618	2	1741.7391	1741.7391	R	A	63	80
PSM	LFEDDDSNEKLFDEEEDSSEK	195	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=16302	83.24	2	2599.0011	2599.0011	K	L	696	717
PSM	LFEESDDKEDEDADGK	196	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=7024	37.185	2	1920.715	1920.7150	K	E	672	688
PSM	LYGSAGPPPTGEEDTAEKDEL	197	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12876	64.794	3	2174.9855	2174.9855	K	-	634	655
PSM	MDVNVGDIDIEGPEGK	198	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=15593	79.14	2	1702.772	1702.7720	K	L	1620	1636
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	199	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10176	51.779	3	3061.253	3061.2530	R	V	320	347
PSM	NFDDEDSVDGNRPSSASSTSSK	200	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=5695	30.928	3	2380.9292	2380.9292	K	A	240	262
PSM	RALSSDSILSPAPDAR	201	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=13164	66.227	2	1814.7965	1814.7965	R	A	391	407
PSM	SCSEEKIPEDGSLNTTK	202	sp|P37173|TGFR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=8312	43.228	2	1973.8289	1973.8289	R	-	551	568
PSM	SEIDALEMSSNDSR	203	sp|P08183-2|MDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:35	ms_run[2]:scan=10088	51.413	2	1568.6624	1568.6624	K	S	582	596
PSM	SEVTSQSGLSNSSDSLDSSTRPPSVTR	204	sp|Q9Y2H0-3|DLGP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:21	ms_run[2]:scan=11490	57.951	3	2860.2724	2860.2724	K	G	58	85
PSM	SPNEVSLEQESEDDAR	205	sp|O94887|FARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9063	46.72	2	1803.7759	1803.7759	R	G	876	892
PSM	SQEPIPDDQKVSDDDK	206	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=5365	29.377	2	1894.7833	1894.7833	K	E	415	431
PSM	SRTASLTSAASVDGNR	207	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=7807	40.795	2	1751.7241	1751.7241	R	S	285	301
PSM	STNCFGDNDPIDVCEIGSK	208	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=16529	84.567	2	2126.8885	2126.8885	K	I	158	177
PSM	SVLDQDDVDTSMEESLK	209	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:35	ms_run[2]:scan=12233	61.61	2	1925.8412	1925.8412	K	H	755	772
PSM	SVPAFLQDESDDRETDTASESSYQLSR	210	sp|Q9HCH5-7|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=17630	91.449	3	3112.3146	3112.3146	K	H	884	911
PSM	SYEDLTESEDGAASGDSHK	211	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=8010	41.808	2	2076.7797	2076.7797	R	E	56	75
PSM	TPAVEGLTEAEEEELR	212	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16710	85.64	2	1771.8476	1771.8476	R	A	12	28
PSM	TPLSPSPMKTPPAAAVSPMQR	213	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,8-UNIMOD:35,10-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=10008	51.055	3	2355.0405	2355.0405	R	H	865	886
PSM	TYVGVVDGENELASPK	214	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13754	69.213	2	1676.8257	1676.8257	R	L	206	222
PSM	VDVECPDVNIEGPEGK	215	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=13475	67.751	2	1755.7985	1755.7985	K	W	2802	2818
PSM	VFDDESDEKEDEEYADEK	216	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9540	48.9	2	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	217	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9623	49.299	3	2270.8264	2270.8264	K	G	637	655
PSM	VFSNGADLSGVTEEAPLK	218	sp|P01009-2|A1AT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16343	83.459	2	1832.9156	1832.9156	K	L	335	353
PSM	VVSPTKEQVSDTEDK	219	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=3647	21.256	2	1740.7819	1740.7819	R	Q	451	466
PSM	YAEDIEGKQSEEEVK	220	sp|Q3L8U1-2|CHD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=6228	33.393	2	1832.7717	1832.7717	K	G	645	660
PSM	YLTESYGTGQDIDDR	221	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10708	54.233	2	1731.7588	1731.7588	R	I	167	182
PSM	GVVDSDDLPLNVSR	222	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=15312	77.649125	2	1484.746703	1484.747087	K	E	435	449
PSM	PDAQPGGELMLGGTDSK	223	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	10-UNIMOD:35	ms_run[1]:scan=9867	50.44036	2	1687.7712	1687.7718	D	Y	237	254
PSM	ETTCSKESNEELTESCETK	224	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:27,4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=5834	31.5742	2	2322.8871	2322.8864	R	K	325	344
PSM	VDNALQSGNSQESVTEQDSK	225	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=5999	32.33777833333333	2	2135.945191	2134.961449	K	D	43	63
PSM	AAESVSKPDVSEEAPGPSK	226	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=6504	34.671	2	1963.8776	1963.8776	K	V	204	223
PSM	AAVLSDSEDEEKASAK	227	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=4471	25.219	2	1728.7455	1728.7455	K	K	69	85
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	228	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=11349	57.305	3	3173.2435	3173.2435	R	-	738	768
PSM	ALDIYSAVDDASHEK	229	sp|Q16568|CART_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=14026	70.597	2	1712.7295	1712.7295	R	E	37	52
PSM	ALLVTASQCQQPAENK	230	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=8610	44.64	2	1756.8778	1756.8778	R	L	84	100
PSM	APSEEELHGDQTDFGQGSQSPQK	231	sp|Q8TE77-4|SSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9377	48.171	3	2551.05	2551.0500	K	Q	68	91
PSM	DLEPGEVPSDSDEDGEHK	232	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=7413	38.938	2	2033.7739	2033.7739	R	S	1372	1390
PSM	DLLPSGSRDEPPPASQSTSQDCSQALK	233	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=12890	64.865	3	2950.3016	2950.3016	R	Q	1878	1905
PSM	DPDAQPGGELMLGGTDSK	234	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=12069	60.805	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	235	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=12594	63.419	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	236	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13196	66.379	2	1786.8043	1786.8043	R	Y	236	254
PSM	DVPNPNQDDDDDEGFSFNPLK	237	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19131	101.62	2	2376.9982	2376.9982	K	I	523	544
PSM	EAGLSQSHDDLSNATATPSVR	238	sp|O14523|C2C2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=10672	54.064	3	2234.9805	2234.9805	K	K	656	677
PSM	EDALDDSVSSSSVHASPLASSPVR	239	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=14972	75.812	2	2492.1068	2492.1068	R	K	2231	2255
PSM	EEASSPGAGEGPAEEGTR	240	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2623	16.431	2	1729.7391	1729.7391	K	D	1143	1161
PSM	EGEEPTVYSDEEEPKDESAR	241	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=7677	40.184	2	2374.9326	2374.9326	K	K	121	141
PSM	ELDVEEAHAASTEEK	242	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=6850	36.322	2	1736.7142	1736.7142	R	E	14	29
PSM	FNPETDYLTGTDGK	243	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13794	69.416	2	1556.6995	1556.6995	K	K	507	521
PSM	GVGDDQLGEESEER	244	sp|P20645|MPRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6115	32.845	2	1518.6434	1518.6434	R	D	257	271
PSM	GVVDSDDLPLNVSR	245	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15341	77.795	2	1484.7471	1484.7471	K	E	435	449
PSM	IAEFTTNLTEEEEK	246	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14084	70.895	2	1652.7781	1652.7781	R	S	1001	1015
PSM	IEDVGSDEEDDSGKDK	247	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=2242	14.53	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEVLSPEGSPSKSPSK	248	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=8282	43.095	2	1849.871	1849.8710	K	K	636	653
PSM	IQVLQQQADDAEER	249	sp|P06753-5|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8066	42.063	2	1641.7958	1641.7958	K	A	14	28
PSM	IVSSSDVGHDEYSTQSLVK	250	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=13047	65.628	2	2129.9518	2129.9518	K	K	766	785
PSM	LDSSEMDHSENEDYTMSSPLPGK	251	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=9333	47.966	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	252	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,6-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=9884	50.513	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LEGALGADTTEDGDEK	253	sp|Q9NZM1-5|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6737	35.776	2	1619.7162	1619.7162	K	S	1094	1110
PSM	LEQGQAIDDLMPAQK	254	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=11041	55.797	2	1671.8138	1671.8138	R	-	367	382
PSM	LGIYDADGDGDFDVDDAK	255	sp|Q12797-10|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17037	87.717	2	1899.801	1899.8010	K	V	58	76
PSM	LSEGSQPAEEEEDQETPSR	256	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5215	28.671	2	2116.9033	2116.9033	K	N	239	258
PSM	NMDPLNDNVTSLLNASSDK	257	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35	ms_run[2]:scan=18896	99.982	2	2062.9477	2062.9477	K	F	595	614
PSM	NPDDITNEEYGEFYK	258	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15435	78.284	2	1832.7741	1832.7741	R	S	422	437
PSM	QRSPAPGSPDEEGGAEAPAAGIR	259	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=8298	43.171	3	2378.9893	2378.9893	R	F	1042	1065
PSM	SASACSTPTHTPQDSLTGVGGDVQEAFAQSSR	260	sp|Q9Y4J8-6|DTNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=19430	103.83	3	3328.4303	3328.4303	R	R	227	259
PSM	SGDETPGSEVPGDK	261	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3442	20.338	2	1373.5947	1373.5947	R	A	161	175
PSM	SLSKSDSDLLTCSPTEDATMGSR	262	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=13766	69.275	2	2553.0612	2553.0612	R	S	622	645
PSM	SPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASK	263	sp|O15117|FYB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21	ms_run[2]:scan=13703	68.942	3	4159.6411	4159.6411	K	E	432	470
PSM	SRTASGSSVTSLDGTR	264	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=6660	35.389	2	1740.7081	1740.7081	R	S	245	261
PSM	SSEEVDGQHPAQEEVPESPQTSGPEAENR	265	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=8242	42.903	3	3199.3215	3199.3215	R	C	267	296
PSM	SSPSHSTTSGETDPTTIFPCK	266	sp|Q96PN7-2|TREF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=12760	64.211	2	2315.9617	2315.9617	K	E	825	846
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	267	sp|Q9BY89|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9616	49.264	3	3138.2319	3138.2319	R	R	1596	1625
PSM	SVEDAQDVSLALTQR	268	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15195	77.056	2	1630.8162	1630.8162	K	G	1148	1163
PSM	SYEDLTESEDGAASGDSHK	269	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=6561	34.927	2	2076.7797	2076.7797	R	E	56	75
PSM	TVEIPDPVEAGEEVK	270	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16288	83.158	2	1610.8039	1610.8039	K	V	635	650
PSM	VANPSGNLTETYVQDR	271	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11678	58.876	2	1762.8486	1762.8486	R	G	1297	1313
PSM	VDINTEDLEDGTCR	272	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=10787	54.597	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VGAEDADGIDMAYR	273	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=9608	49.231	2	1497.6406	1497.6406	K	V	283	297
PSM	VIPEDASESEEKLDQK	274	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=9174	47.224	2	1895.8401	1895.8401	K	E	915	931
PSM	YLTESYGTGQDIDDR	275	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10930	55.242	2	1731.7588	1731.7588	R	I	167	182
PSM	YMADMDELFSQVDEK	276	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=15303	77.604	2	1851.7543	1851.7543	K	R	135	150
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	277	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	22-UNIMOD:21	ms_run[1]:scan=7940	41.499426666666665	3	3062.335381	3061.351348	K	G	56	88
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	278	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	22-UNIMOD:21	ms_run[1]:scan=8160	42.515611666666665	3	3062.336247	3061.351348	K	G	56	88
PSM	CGQEEHDVLLSNEEDR	279	sp|Q9UGI8|TES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=12795	64.36884666666667	2	1911.7944	1911.7900	K	K	46	62
PSM	VDPSLMEDSDDGPSLPTK	280	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:35	ms_run[1]:scan=11750	59.205333333333336	2	1918.856156	1917.851354	K	Q	87	105
PSM	VSESEGKLEGQATAVTPNK	281	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:21	ms_run[1]:scan=9512	48.77117833333333	2	2023.947002	2023.946331	K	N	12	31
PSM	AGSAETESATKASTDNSPSSK	282	sp|P17677|NEUM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=671	6.3071	2	2104.8798	2104.8798	K	A	135	156
PSM	AVSPPHLDGPPSPR	283	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11390	57.502	2	1585.6691	1585.6691	K	S	516	530
PSM	CVAEALLCNGQDDCGDSSDER	284	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=13078	65.79	3	2369.9158	2369.9158	R	G	2917	2938
PSM	DHTPSQELALTQSVGGDSSADR	285	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=13533	68.036	3	2350.0074	2350.0074	K	L	346	368
PSM	DPDAQPGGELMLGGTDSK	286	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=12603	63.459	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPHSPEDEEQPQGLSDDDILR	287	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=15107	76.562	3	2471.0126	2471.0126	R	D	10	31
PSM	DSPSKSSAEAQTPEDTPNK	288	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=1814	12.249	2	2067.8634	2067.8634	K	S	65	84
PSM	EDLNSPNPSPGGCYDTK	289	sp|Q6P4A8|PLBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=7373	38.748	2	1849.7789	1849.7789	R	V	477	494
PSM	EELAEELASSLSGR	290	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20622	113.13	2	1489.726	1489.7260	K	N	1711	1725
PSM	EESAGAAPGEGPEGVDGR	291	sp|Q00722-3|PLCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4507	25.357	2	1683.7336	1683.7336	R	V	947	965
PSM	ELSDQAGSEFENSDVR	292	sp|O43301|HS12A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10960	55.382	2	1781.7704	1781.7704	K	W	183	199
PSM	ESEDKPEIEDVGSDEEEEK	293	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=7942	41.507	2	2271.8792	2271.8792	K	K	373	392
PSM	ESLPVSGEESQLTPEKSPK	294	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=11740	59.163	2	2120.9879	2120.9879	K	F	969	988
PSM	ETTCSKESNEELTESCETK	295	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21,4-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=4291	24.421	2	2340.8975	2340.8975	R	K	289	308
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	296	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21,28-UNIMOD:21	ms_run[2]:scan=13421	67.473	3	3371.3239	3371.3239	R	S	1160	1192
PSM	GEIDASVPELEGDLR	297	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18088	94.448	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GELEDTLDSTNAQQELR	298	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14924	75.559	2	1917.8916	1917.8916	R	S	1170	1187
PSM	GQSLDHDEASESEMR	299	sp|Q2TAL5|SMTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=2628	16.457	2	1785.6513	1785.6513	R	K	132	147
PSM	GSLGSQGAKDEPEEELQK	300	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=8676	44.933	2	1980.8677	1980.8677	K	G	1329	1347
PSM	GSSQPNLSTSHSEQEYGK	301	sp|O95208-3|EPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=4967	27.429	2	2014.8269	2014.8269	R	A	132	150
PSM	GSVQYLPDLDDKNSQEK	302	sp|Q9UGM5-2|FETUB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=13867	69.749	2	2014.8885	2014.8885	R	G	265	282
PSM	GTGGVDTAAVGGVFDVSNADR	303	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17116	88.235	2	1963.9235	1963.9235	R	L	321	342
PSM	GYDVIAQAQSGTGK	304	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9846	50.35	2	1393.6838	1393.6838	K	T	69	83
PSM	IDQYQGADAVGLEEK	305	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11122	56.204	2	1634.7788	1634.7788	R	I	88	103
PSM	IEDSEPHIPLIDDTDAEDDAPTK	306	sp|P20020-6|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=18058	94.239	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEENSLKEEESIEGEK	307	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=9478	48.62	2	1941.8456	1941.8456	K	E	1566	1582
PSM	IEYNDQNDGSCDVK	308	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4	ms_run[2]:scan=4363	24.738	2	1655.6733	1655.6733	K	Y	594	608
PSM	IMVDMLDSDGSGK	309	sp|P17655-2|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=7612	39.873	2	1398.6007	1398.6007	K	L	501	514
PSM	IQNSGDFYDLYGGEK	310	sp|P29350|PTN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16029	81.612	2	1704.7631	1704.7631	R	F	54	69
PSM	ISDLTTNLAEEEEK	311	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12628	63.571	2	1590.7625	1590.7625	R	A	1008	1022
PSM	ITEAPASEKEIVEVK	312	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=10426	52.926	2	1721.8488	1721.8488	K	E	87	102
PSM	KPSVGVPPPASPSYPR	313	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10355	52.609	2	1794.8107	1794.8107	R	A	969	985
PSM	LASGEDDPFDSDFSCPVK	314	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=17341	89.636	2	1984.836	1984.8360	K	L	377	395
PSM	LDDDDEGVPSSALR	315	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9900	50.579	2	1487.674	1487.6740	R	E	37	51
PSM	LEELDDFEEGSQK	316	sp|Q7Z3J2-2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13561	68.176	2	1537.6784	1537.6784	R	E	40	53
PSM	LESIDNHSSTGGQSDQGYGSK	317	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=5681	30.867	3	2245.9125	2245.9125	R	D	951	972
PSM	LQDFSDQLSDYYEK	318	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17465	90.401	2	1749.7734	1749.7734	K	F	4499	4513
PSM	LVGEEEAGFGECDK	319	sp|O94919|ENDD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4	ms_run[2]:scan=10005	51.044	2	1538.6559	1538.6559	R	F	23	37
PSM	LYAQDADGCPIDIK	320	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=12879	64.808	2	1577.7396	1577.7396	K	V	704	718
PSM	MSASDPNSSIFLTDTAK	321	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=13892	69.888	2	1799.8247	1799.8247	K	Q	309	326
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVK	322	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=15999	81.464	3	3652.4937	3652.4937	K	R	353	388
PSM	RCSVTSMESTVSSGTQTTVQDDPEQFEVIK	323	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=16297	83.212	3	3441.4953	3441.4953	R	Q	612	642
PSM	SANAEDAQEFSDVER	324	sp|Q9HCY8|S10AE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9666	49.491	2	1666.7071	1666.7071	R	A	6	21
PSM	SDPEELREPQQSFSEAQQQLCNTR	325	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=17280	89.28	3	2956.2658	2956.2658	K	Q	3049	3073
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	326	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=15094	76.486	3	2927.271	2927.2710	K	K	158	184
PSM	SGDEEFKGEDELCDSGR	327	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10559	53.554	2	2008.7357	2008.7357	R	Q	339	356
PSM	SIQEIQELDKDDESLR	328	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=16120	82.116	2	1996.899	1996.8990	K	K	34	50
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK	329	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=17250	89.073	3	4458.0725	4458.0725	K	K	34	85
PSM	SQEATCPSPASSGASQETPNECSDDFGEFQSEKPK	330	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,8-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=13278	66.77	3	3868.5353	3868.5353	R	I	793	828
PSM	SQESLTENPSETLKPATSISSISQTK	331	sp|Q8NFP9|NBEA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=15625	79.31	3	2842.3485	2842.3485	K	G	1714	1740
PSM	SQLDDHPESDDEENFIDANDDEDMEK	332	sp|Q03701|CEBPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=13932	70.121	3	3147.1296	3147.1296	R	F	621	647
PSM	SQVSEDGTLRSLEPEPQQSLEDGSPAK	333	sp|Q8IV36-3|HID1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=14939	75.631	3	2963.3397	2963.3397	K	G	402	429
PSM	SSGHSSSELSPDAVEK	334	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=6028	32.465	2	1695.6989	1695.6989	R	A	1378	1394
PSM	SVEDDEEGHLICQSGDVLSAR	335	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16621	85.081	2	2394.9999	2394.9999	R	Y	140	161
PSM	TCEERPAEDGSDEEDPDSMEAPTR	336	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=4671	26.097	3	2818.0219	2818.0219	R	I	4	28
PSM	TEEPLGSPHPSGTVESPGEGPQDTR	337	sp|Q9NWS9-2|ZN446_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=10057	51.282	3	2640.1341	2640.1341	K	I	131	156
PSM	TLSSPSLQTDGIAATPVPPPPPPK	338	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=16530	84.571	2	2447.2349	2447.2349	R	S	1800	1824
PSM	TLSSPSLQTDGIAATPVPPPPPPK	339	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=16618	85.065	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TLTTVQGIADDYDK	340	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14890	75.352	2	1538.7464	1538.7464	K	K	43	57
PSM	TPAPEPEPCEASELPAK	341	sp|Q9ULV3-5|CIZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=9931	50.712	2	1821.8455	1821.8455	R	R	143	160
PSM	TQESCGIAPLTPSQSPKPEVR	342	sp|Q96MM6|HS12B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11356	57.339	3	2441.0699	2441.0699	R	A	32	53
PSM	TTKSPSDSGYSYETIGK	343	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=9113	46.945	2	1899.8139	1899.8139	R	T	1912	1929
PSM	VAEEDEDDDGGIMMR	344	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3148	18.961	2	1712.6505	1712.6505	K	S	751	766
PSM	VAEEDEDDDGGIMMR	345	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4300	24.46	2	1712.6505	1712.6505	K	S	751	766
PSM	VDPSLMEDSDDGPSLPTK	346	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35	ms_run[2]:scan=12154	61.216	2	1917.8514	1917.8514	K	Q	87	105
PSM	VELDSQSPHDEDPQAVTYAPVK	347	sp|O75022|LIRB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=13119	65.991	3	2504.1108	2504.1108	R	H	526	548
PSM	YLTESYGTGQDIDDR	348	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10416	52.874	2	1731.7588	1731.7588	R	I	167	182
PSM	ESEDKPEIEDVGSDEEEEK	349	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:27,13-UNIMOD:21	ms_run[1]:scan=10296	52.32978333333333	2	2253.8666	2253.8681	K	K	251	270
PSM	LLESPGVEAGEGEAEK	350	sp|Q6NYC8|PPR18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=9458	48.532763333333335	2	1614.782506	1613.778447	K	E	365	381
PSM	ETKSEETLDEGPPK	351	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=4470	25.215716666666665	2	1638.711879	1638.702578	K	Y	97	111
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	352	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:27,4-UNIMOD:21	ms_run[1]:scan=9677	49.547084999999996	3	2983.2585	2983.2563	R	E	120	150
PSM	LESIDNHSSTGGQSDQGYGSK	353	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=5902	31.896613333333335	3	2246.906103	2245.912465	R	D	951	972
PSM	QQIAEDPELTHSSSNK	354	sp|Q9ULC3|RAB23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,13-UNIMOD:21	ms_run[1]:scan=10097	51.44999666666667	2	1845.7780	1845.7777	K	I	175	191
PSM	TDEEAEGPYSDNEMLTHK	355	sp|Q6NUK4|REEP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=10466	53.11651	2	2145.828372	2144.824561	K	G	201	219
PSM	AFLDEDDMSLEEIK	356	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=17177	88.593	2	1669.7393	1669.7393	R	N	639	653
PSM	AKTQTPPVSPAPQPTEER	357	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=4725	26.334	2	2092.9232	2092.9232	R	L	397	415
PSM	AVSPPHLDGPPSPR	358	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11181	56.477	2	1585.6691	1585.6691	K	S	516	530
PSM	CDGFLDCSDESDEK	359	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9679	49.554	2	1675.5978	1675.5978	R	A	1534	1548
PSM	DEVDGGPPCAPGGTAK	360	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=4536	25.481	2	1526.6671	1526.6671	K	T	9	25
PSM	DLDEDELLGNLSETELK	361	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21204	117.9	2	1931.9211	1931.9211	K	Q	14	31
PSM	DPEDTGAEKSPTTSADLK	362	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=4778	26.601	2	1940.8252	1940.8252	K	S	305	323
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	363	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=17135	88.341	3	2861.224	2861.2240	K	E	520	546
PSM	DSSDSADGRATPSENLVPSSAR	364	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=9302	47.824	3	2297.9761	2297.9761	R	V	184	206
PSM	EALNVFGNDYDTEDGTGVR	365	sp|Q14376-2|GALE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17137	88.353	2	2070.913	2070.9130	R	D	147	166
PSM	EDEEGDDSTMGPDFR	366	sp|P25940|CO5A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:35	ms_run[2]:scan=6145	32.977	2	1714.6264	1714.6264	R	A	342	357
PSM	EDKSPETGTAGGSSTASYSAGR	367	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=3176	19.101	2	2194.9016	2194.9016	K	G	2472	2494
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	368	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=8668	44.899	3	3001.2673	3001.2673	R	E	120	150
PSM	ELEDVTESAESMNR	369	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:35	ms_run[2]:scan=7602	39.827	2	1624.6886	1624.6886	R	E	1923	1937
PSM	ELLLQEDDSGSDTK	370	sp|Q9P219|DAPLE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10553	53.527	2	1548.7155	1548.7155	R	Y	943	957
PSM	ELSLDDPEVEQVSGR	371	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15163	76.88	2	1671.7952	1671.7952	R	G	172	187
PSM	ESEDKPEIEDVGSDEEEEK	372	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=7601	39.823	2	2271.8792	2271.8792	K	K	373	392
PSM	ESEDKPEIEDVGSDEEEEK	373	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=8804	45.566	3	2271.8792	2271.8792	K	K	373	392
PSM	ESSTESSQSAKPVSGQDTSGNTEGSPAAEK	374	sp|Q96S66-4|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	25-UNIMOD:21	ms_run[2]:scan=2133	13.944	3	3032.2732	3032.2732	K	A	300	330
PSM	FNADEFEDMVAEK	375	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35	ms_run[2]:scan=15214	77.154	2	1559.645	1559.6450	K	R	176	189
PSM	GDEPQASGYHSEGETLK	376	sp|Q70EL1-6|UBP54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=5647	30.708	2	1883.7575	1883.7575	K	E	471	488
PSM	GEATVSFDDPPSAK	377	sp|P35637-2|FUS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9614	49.257	2	1419.6518	1419.6518	K	A	334	348
PSM	GEIDASVPELEGDLR	378	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17937	93.441	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	379	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21,18-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13599	68.373	3	2842.2398	2842.2398	K	Q	609	638
PSM	GGSSKDLLDNQSQEEQR	380	sp|O43432|IF4G3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5901	31.893	2	1969.8378	1969.8378	R	R	1154	1171
PSM	GIDSDDVQDNSQLK	381	sp|Q96QE3-2|ATAD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7084	37.471	2	1532.6954	1532.6954	R	A	611	625
PSM	GVVDSDDLPLNVSR	382	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15530	78.809	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	383	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15711	79.823	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	384	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16181	82.511	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	385	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16353	83.517	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	386	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16848	86.544	2	1484.7471	1484.7471	K	E	435	449
PSM	HDSIPAADTFEDLSDVEGGGSEPTQR	387	sp|O95671-3|ASML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=18996	100.64	3	2809.1716	2809.1716	K	D	168	194
PSM	IAQLEEQLDNETK	388	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12392	62.421	2	1529.7573	1529.7573	K	E	1816	1829
PSM	IAQLEEQVEQEAR	389	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12924	65.028	2	1541.7686	1541.7686	K	E	1823	1836
PSM	IDCDNLEQYFIQQGGGPDK	390	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=19698	105.86	2	2195.9793	2195.9793	K	K	389	408
PSM	IEADSESQEDIIR	391	sp|P55957|BID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9397	48.257	2	1503.7053	1503.7053	R	N	72	85
PSM	IEDLSQQAQLAAAEK	392	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12276	61.813	2	1613.8261	1613.8261	K	F	128	143
PSM	ILDETQEAVEYQR	393	sp|Q96FZ7|CHMP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10900	55.098	2	1592.7682	1592.7682	R	Q	126	139
PSM	IPSAVSTVSMQNIHPK	394	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=10022	51.117	2	1883.8254	1883.8254	K	S	597	613
PSM	IQVLQQQADDAEER	395	sp|P06753-5|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9494	48.685	2	1641.7958	1641.7958	K	A	14	28
PSM	KDSEGYSESPDLEFEYADTDK	396	sp|Q5VSL9-4|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=16041	81.665	2	2503.9792	2503.9792	R	W	57	78
PSM	LCSSSDTLVSEGEENQKPK	397	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=8981	46.385	3	2186.9403	2186.9403	R	K	800	819
PSM	LEDGDIEEAPGAGGR	398	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7585	39.75	2	1484.6743	1484.6743	K	R	336	351
PSM	LESIDNHSSTGGQSDQGYGSK	399	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5234	28.762	3	2245.9125	2245.9125	R	D	951	972
PSM	LLDADDAAAVAAK	400	sp|Q96RU8|TRIB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10993	55.564	2	1242.6456	1242.6456	R	C	34	47
PSM	LQAALEAEEPDDER	401	sp|Q9BUJ2-2|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9252	47.592	2	1584.7267	1584.7267	R	E	33	47
PSM	NGSEADIDEGLYSR	402	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10703	54.21	2	1524.6692	1524.6692	K	Q	4	18
PSM	NLEAVETLGSTSTICSDK	403	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=15606	79.207	2	1923.9095	1923.9095	K	T	329	347
PSM	NPDDITQEEYGEFYK	404	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15682	79.643	2	1846.7897	1846.7897	R	S	292	307
PSM	NQDEESQEAPELLK	405	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10530	53.424	2	1628.753	1628.7530	K	R	552	566
PSM	NQLTSNPENTVFDAK	406	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13263	66.697	2	1676.8006	1676.8006	K	R	82	97
PSM	NSLQEQQEEEEEAR	407	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4472	25.223	2	1717.7391	1717.7391	K	K	1346	1360
PSM	PVTVEPMDQLDDEEGLPEK	408	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=13807	69.468	2	2155.9831	2155.9831	R	L	132	151
PSM	PVTVEPMDQLDDEEGLPEK	409	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=14001	70.468	3	2155.9831	2155.9831	R	L	132	151
PSM	QVGSGVTTDQVQAEAK	410	sp|P01871|IGHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6481	34.56	2	1616.8006	1616.8006	K	E	154	170
PSM	SEESLTSLHAVDGDSK	411	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11307	57.108	2	1753.7408	1753.7408	K	L	357	373
PSM	SGDETPGSEVPGDK	412	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3671	21.359	2	1373.5947	1373.5947	R	A	161	175
PSM	SIDKDEEFAGSSPQSSK	413	sp|Q9Y2M0-2|FAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=6547	34.867	2	1890.7884	1890.7884	K	S	169	186
PSM	SISGTSTSEKPNSMDTANTSPFK	414	sp|Q9UJF2|NGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=9157	47.148	2	2482.0571	2482.0571	R	V	16	39
PSM	SLDGALYDDEDDDDIER	415	sp|Q6P3S1|DEN1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14574	73.561	2	1954.7916	1954.7916	K	A	514	531
PSM	SLGDDISSETSGDFR	416	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12517	63.025	2	1584.6904	1584.6904	K	K	139	154
PSM	SLIGVEYKPVSATGAEDK	417	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=14229	71.643	2	1942.9289	1942.9289	K	D	944	962
PSM	SNVDMDFEVENAVLGK	418	sp|P00488|F13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=17907	93.25	2	1781.8142	1781.8142	R	D	517	533
PSM	SPSDVSASESPQHDVVDLGSTAPLK	419	sp|Q8N9M5|TM102_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=15905	80.948	3	2602.18	2602.1800	K	T	209	234
PSM	SQSESSDEVTELDLSHGK	420	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=11494	57.971	3	2026.8368	2026.8368	R	K	657	675
PSM	TCVADESAENCDK	421	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1460	10.41	2	1497.5712	1497.5712	K	S	76	89
PSM	TEDSDDIHFEPVVQMPEK	422	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=14671	74.112	3	2210.9079	2210.9079	K	V	2005	2023
PSM	TEFDQEIDMGSLNPGK	423	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35	ms_run[2]:scan=13982	70.375	2	1795.7934	1795.7934	R	Q	275	291
PSM	TGSTSSKEDDYESDAATIVQK	424	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=12686	63.844	2	2310.9741	2310.9741	R	C	360	381
PSM	TIASDSEEEAGKELSDK	425	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=8097	42.198	2	1887.7987	1887.7987	K	K	110	127
PSM	TITQIEEFSDVNEGEK	426	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15827	80.493	2	1837.8582	1837.8582	K	E	596	612
PSM	VASETHSEGSEYEELPK	427	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=9798	50.133	2	1970.8146	1970.8146	R	R	1130	1147
PSM	VCVETVESGAMTK	428	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=6769	35.927	2	1425.648	1425.6480	K	D	349	362
PSM	VEGDMQVPDLDIK	429	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=13584	68.299	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VSEVEEEKEPVPQPLPSDDTR	430	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=12043	60.665	3	2459.1105	2459.1105	R	V	447	468
PSM	ESTQLSPADLTEGKPTD	431	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=13209	66.44666166666667	2	1867.8083	1867.8083	R	P	451	468
PSM	ESTQLSPADLTEGKPTD	432	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=12992	65.36879499999999	2	1867.8083	1867.8083	R	P	451	468
PSM	LESIDNHSSTGGQSDQGYGSK	433	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=6239	33.45001	3	2246.899184	2245.912465	R	D	951	972
PSM	ETTCSKESNEELTESCETK	434	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:27,4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=5826	31.539816666666667	3	2322.8877	2322.8864	R	K	325	344
PSM	AQAELVGTADEATR	435	sp|P30049|ATPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=7829	40.90092166666667	2	1430.699036	1430.700137	K	A	137	151
PSM	TVAPVVTQAAPPTPTPPVPPAK	436	sp|Q70E73|RAPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=13825	69.557575	3	2216.168766	2215.165372	K	K	793	815
PSM	PFPSEETTENDDDVYR	437	sp|P52735|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=11641	58.68521	2	1913.799306	1912.796281	R	S	128	144
PSM	EIQNGNLHESDSESVPR	438	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=7764	40.62415	2	1990.827969	1989.842928	K	D	66	83
PSM	FLGSGTGFRPIGGGAGGSGK	439	sp|O43909|EXTL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21,6-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=7732	40.46337833333333	2	2021.813118	2018.805374	K	E	629	649