MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr07.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr07.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	417-UNIMOD:21,416-UNIMOD:21,419-UNIMOD:21	0.05	54.0	4	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	129-UNIMOD:21	0.29	50.0	5	2	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	1384-UNIMOD:21,1389-UNIMOD:4,632-UNIMOD:21	0.02	49.0	2	2	2
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	49.0	null	145-UNIMOD:28,160-UNIMOD:21,155-UNIMOD:21,164-UNIMOD:21	0.07	49.0	9	2	1
PRT	sp|Q96HP0|DOCK6_HUMAN	Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	878-UNIMOD:21	0.01	48.0	1	1	1
PRT	sp|Q7Z4S6-2|KI21A_HUMAN	Isoform 2 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	840-UNIMOD:21,849-UNIMOD:21	0.02	47.0	2	1	0
PRT	sp|O15056-3|SYNJ2_HUMAN	Isoform 2A of Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1122-UNIMOD:21	0.02	47.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	615-UNIMOD:21	0.01	47.0	2	1	0
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	68-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|Q5JTC6-2|AMER1_HUMAN	Isoform 2 of APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	286-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.20	46.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	220-UNIMOD:21,243-UNIMOD:4	0.02	46.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	942-UNIMOD:21	0.03	45.0	4	1	0
PRT	sp|Q9H841-2|NPAL2_HUMAN	Isoform 2 of NIPA-like protein 2 OS=Homo sapiens OX=9606 GN=NIPAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	362-UNIMOD:21,360-UNIMOD:21	0.06	45.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	119-UNIMOD:21,134-UNIMOD:4	0.18	45.0	1	1	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	344-UNIMOD:21,348-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|Q8TF01-2|PNISR_HUMAN	Isoform 2 of Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	290-UNIMOD:21	0.06	45.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	393-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q15714-4|T22D1_HUMAN	Isoform 4 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	263-UNIMOD:21,290-UNIMOD:35,293-UNIMOD:35	0.06	44.0	1	1	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	493-UNIMOD:21	0.02	44.0	2	1	0
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	395-UNIMOD:21,402-UNIMOD:4,889-UNIMOD:4,890-UNIMOD:21	0.02	44.0	2	2	2
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	135-UNIMOD:21,5739-UNIMOD:21,4486-UNIMOD:21,5737-UNIMOD:21,295-UNIMOD:21	0.01	44.0	16	5	3
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	561-UNIMOD:21,457-UNIMOD:21	0.06	44.0	3	2	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	3792-UNIMOD:21,3794-UNIMOD:35	0.01	44.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	18-UNIMOD:21,2-UNIMOD:1	0.09	44.0	2	1	0
PRT	sp|P78545-2|ELF3_HUMAN	Isoform 2 of ETS-related transcription factor Elf-3 OS=Homo sapiens OX=9606 GN=ELF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	192-UNIMOD:21	0.06	44.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	592-UNIMOD:21	0.03	43.0	2	1	0
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	384-UNIMOD:21,395-UNIMOD:4,220-UNIMOD:21	0.03	43.0	2	2	1
PRT	sp|Q96SU4-5|OSBL9_HUMAN	Isoform 5 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	148-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	320-UNIMOD:35,324-UNIMOD:21,334-UNIMOD:4,323-UNIMOD:21,322-UNIMOD:21	0.07	43.0	4	1	0
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	114-UNIMOD:21,116-UNIMOD:4	0.05	43.0	7	1	0
PRT	sp|O60268-2|K0513_HUMAN	Isoform 2 of Uncharacterized protein KIAA0513 OS=Homo sapiens OX=9606 GN=KIAA0513	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	72-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	14-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	1304-UNIMOD:28,1320-UNIMOD:21	0.01	43.0	1	1	0
PRT	sp|P98175-2|RBM10_HUMAN	Isoform 2 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	294-UNIMOD:21	0.06	42.0	2	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	109-UNIMOD:35	0.28	42.0	7	2	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	872-UNIMOD:21,234-UNIMOD:21	0.04	42.0	5	2	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1202-UNIMOD:21,1211-UNIMOD:4	0.01	42.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q3T8J9-2|GON4L_HUMAN	Isoform 2 of GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1425-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	4	2	1
PRT	sp|P49685|GPR15_HUMAN	G-protein coupled receptor 15 OS=Homo sapiens OX=9606 GN=GPR15 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	333-UNIMOD:21,335-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	3	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	339-UNIMOD:21	0.08	42.0	1	1	1
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	64-UNIMOD:21,72-UNIMOD:35	0.05	42.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1772-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|P12931|SRC_HUMAN	Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	17-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	98-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	44-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	36-UNIMOD:21	0.10	41.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	138-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q86U38-2|NOP9_HUMAN	Isoform 2 of Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q8WVM7-2|STAG1_HUMAN	Isoform 2 of Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1061-UNIMOD:35,1062-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O00763|ACACB_HUMAN	Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	35-UNIMOD:21,1412-UNIMOD:4,1414-UNIMOD:21	0.02	41.0	2	2	2
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	659-UNIMOD:21,662-UNIMOD:21	0.02	41.0	3	1	0
PRT	sp|O43164-2|PJA2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	253-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	125-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	5-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	0.07	41.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	433-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	479-UNIMOD:21,517-UNIMOD:21	0.04	41.0	5	2	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1120-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2362-UNIMOD:21,2370-UNIMOD:4	0.05	41.0	8	8	8
PRT	sp|Q07866-6|KLC1_HUMAN	Isoform N of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	546-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	53-UNIMOD:35,59-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	246-UNIMOD:35	0.05	41.0	2	2	2
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	314-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	17-UNIMOD:21,9-UNIMOD:21	0.16	40.0	2	1	0
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	260-UNIMOD:21	0.06	40.0	3	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	939-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	43-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	126-UNIMOD:21	0.09	40.0	2	1	0
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	966-UNIMOD:21,1522-UNIMOD:21	0.02	40.0	2	2	2
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	2	1	0
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	299-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|Q63HK5|TSH3_HUMAN	Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	85-UNIMOD:35,92-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P54198|HIRA_HUMAN	Protein HIRA OS=Homo sapiens OX=9606 GN=HIRA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	538-UNIMOD:21,539-UNIMOD:35	0.03	40.0	1	1	1
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1763-UNIMOD:21,1770-UNIMOD:4,1784-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	846-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9UBY9-3|HSPB7_HUMAN	Isoform 3 of Heat shock protein beta-7 OS=Homo sapiens OX=9606 GN=HSPB7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	14-UNIMOD:21	0.29	40.0	1	1	1
PRT	sp|Q8N9M5|TM102_HUMAN	Transmembrane protein 102 OS=Homo sapiens OX=9606 GN=TMEM102 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	218-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|O60716-32|CTND1_HUMAN	Isoform 4 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	530-UNIMOD:21,535-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	377-UNIMOD:21,378-UNIMOD:35,375-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|Q8IVL1-6|NAV2_HUMAN	Isoform 6 of Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	13-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q15653-2|IKBB_HUMAN	Isoform 2 of NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	175-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	142-UNIMOD:21,158-UNIMOD:35,333-UNIMOD:21	0.12	40.0	3	3	3
PRT	sp|Q9NWQ8|PHAG1_HUMAN	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Homo sapiens OX=9606 GN=PAG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	48-UNIMOD:28,50-UNIMOD:21,57-UNIMOD:35	0.04	40.0	1	1	1
PRT	sp|Q9NY61|AATF_HUMAN	Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:21,210-UNIMOD:35	0.04	39.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2638-UNIMOD:21	0.00	39.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	447-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	404-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|Q96FV2-2|SCRN2_HUMAN	Isoform 2 of Secernin-2 OS=Homo sapiens OX=9606 GN=SCRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	52-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P50443|S26A2_HUMAN	Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC26A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	25-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q15124|PGM5_HUMAN	Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	165-UNIMOD:4	0.05	39.0	4	2	1
PRT	sp|P08473|NEP_HUMAN	Neprilysin OS=Homo sapiens OX=9606 GN=MME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	4-UNIMOD:21,8-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|Q6UX71-3|PXDC2_HUMAN	Isoform 3 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	128-UNIMOD:21	0.11	39.0	1	1	0
PRT	sp|Q8NFZ8|CADM4_HUMAN	Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	361-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	61-UNIMOD:35	0.07	39.0	4	3	2
PRT	sp|Q01484|ANK2_HUMAN	Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	3845-UNIMOD:21,3859-UNIMOD:4,2440-UNIMOD:21,2661-UNIMOD:21,3844-UNIMOD:21,2115-UNIMOD:35,2122-UNIMOD:35,2127-UNIMOD:21,3823-UNIMOD:21	0.02	39.0	7	5	4
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	953-UNIMOD:21,1110-UNIMOD:21,1118-UNIMOD:35,1121-UNIMOD:35,1122-UNIMOD:35	0.02	39.0	3	2	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	713-UNIMOD:21,676-UNIMOD:21,642-UNIMOD:21	0.07	39.0	4	3	2
PRT	sp|Q96NY7-2|CLIC6_HUMAN	Isoform A of Chloride intracellular channel protein 6 OS=Homo sapiens OX=9606 GN=CLIC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	293-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1552-UNIMOD:21,1541-UNIMOD:21,1378-UNIMOD:21	0.01	39.0	3	2	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	2807-UNIMOD:21,2813-UNIMOD:35,2231-UNIMOD:27,2251-UNIMOD:21	0.01	39.0	2	2	2
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	185-UNIMOD:21,189-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	716-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q6NUK4|REEP3_HUMAN	Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	210-UNIMOD:21,214-UNIMOD:35	0.07	39.0	1	1	1
PRT	sp|P35612|ADDB_HUMAN	Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	692-UNIMOD:35,701-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	438-UNIMOD:21	0.03	39.0	4	2	0
PRT	sp|Q5JU85|IQEC2_HUMAN	IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	618-UNIMOD:28,626-UNIMOD:4,627-UNIMOD:21,212-UNIMOD:21	0.03	39.0	2	2	2
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	711-UNIMOD:28,717-UNIMOD:21,839-UNIMOD:21,843-UNIMOD:21	0.03	39.0	3	2	1
PRT	sp|Q7Z3E2|CC186_HUMAN	Coiled-coil domain-containing protein 186 OS=Homo sapiens OX=9606 GN=CCDC186 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	744-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	678-UNIMOD:21,683-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q8TE77-4|SSH3_HUMAN	Isoform 4 of Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	70-UNIMOD:21,87-UNIMOD:21	0.06	38.0	2	1	0
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	670-UNIMOD:4,679-UNIMOD:21,686-UNIMOD:4,677-UNIMOD:21	0.06	38.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	263-UNIMOD:21,231-UNIMOD:21	0.08	38.0	4	4	4
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1379-UNIMOD:35,1270-UNIMOD:4	0.03	38.0	4	3	2
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	917-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	389-UNIMOD:21,385-UNIMOD:21	0.04	38.0	2	1	0
PRT	sp|Q8IYL3|CA174_HUMAN	UPF0688 protein C1orf174 OS=Homo sapiens OX=9606 GN=C1orf174 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	145-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1128-UNIMOD:21,1233-UNIMOD:21	0.03	38.0	2	2	2
PRT	sp|Q66K14-2|TBC9B_HUMAN	Isoform 2 of TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	411-UNIMOD:21,547-UNIMOD:21	0.04	38.0	3	2	1
PRT	sp|Q04724|TLE1_HUMAN	Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	286-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	70-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9Y3M8-5|STA13_HUMAN	Isoform 5 of StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	125-UNIMOD:21,131-UNIMOD:4,328-UNIMOD:21,339-UNIMOD:4,326-UNIMOD:21	0.06	38.0	3	2	1
PRT	sp|Q86X10-4|RLGPB_HUMAN	Isoform 4 of Ral GTPase-activating protein subunit beta OS=Homo sapiens OX=9606 GN=RALGAPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	487-UNIMOD:21,489-UNIMOD:35,494-UNIMOD:35,499-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	107-UNIMOD:21,106-UNIMOD:28,113-UNIMOD:21,133-UNIMOD:35,135-UNIMOD:21	0.03	38.0	3	3	3
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	480-UNIMOD:21	0.00	38.0	2	1	0
PRT	sp|Q86W56-3|PARG_HUMAN	Isoform 3 of Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	31-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9BZ71-3|PITM3_HUMAN	Isoform 3 of Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	285-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	568-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9H2K8|TAOK3_HUMAN	Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	324-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	174-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	940-UNIMOD:21,923-UNIMOD:28,941-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q92766-4|RREB1_HUMAN	Isoform 4 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	111-UNIMOD:21	0.05	38.0	1	1	0
PRT	sp|Q9H4X1-2|RGCC_HUMAN	Isoform 2 of Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	45-UNIMOD:21	0.21	38.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	99-UNIMOD:21,101-UNIMOD:4,78-UNIMOD:21	0.12	38.0	5	2	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P43007-2|SATT_HUMAN	Isoform 2 of Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	223-UNIMOD:21,209-UNIMOD:21	0.12	38.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	596-UNIMOD:21,585-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	889-UNIMOD:21,971-UNIMOD:21,1176-UNIMOD:21	0.06	38.0	3	3	3
PRT	sp|Q15811-6|ITSN1_HUMAN	Isoform 6 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	974-UNIMOD:35,984-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q8IV36-3|HID1_HUMAN	Isoform 3 of Protein HID1 OS=Homo sapiens OX=9606 GN=HID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	363-UNIMOD:21,371-UNIMOD:35	0.04	38.0	1	1	1
PRT	sp|Q9UI47|CTNA3_HUMAN	Catenin alpha-3 OS=Homo sapiens OX=9606 GN=CTNNA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	637-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	20-UNIMOD:35	0.09	38.0	1	1	1
PRT	sp|P13994|CC130_HUMAN	Coiled-coil domain-containing protein 130 OS=Homo sapiens OX=9606 GN=CCDC130 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	331-UNIMOD:35,332-UNIMOD:21,336-UNIMOD:4,362-UNIMOD:21	0.12	38.0	2	2	2
PRT	sp|Q69YQ0|CYTSA_HUMAN	Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	384-UNIMOD:21,395-UNIMOD:4	0.02	38.0	1	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	199-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	133-UNIMOD:21,125-UNIMOD:21	0.10	37.0	2	1	0
PRT	sp|Q2M1Z3|RHG31_HUMAN	Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1080-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O43561-4|LAT_HUMAN	Isoform 4 of Linker for activation of T-cells family member 1 OS=Homo sapiens OX=9606 GN=LAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	194-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|P17661|DESM_HUMAN	Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q86VI3|IQGA3_HUMAN	Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9BUH6-2|PAXX_HUMAN	Isoform 2 of Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	22-UNIMOD:4,24-UNIMOD:4	0.15	37.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	970-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9Y3S1-2|WNK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1276-UNIMOD:21,1283-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	101-UNIMOD:21,74-UNIMOD:21,72-UNIMOD:21	0.02	37.0	3	2	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	71	1	0
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	79-UNIMOD:21	0.12	37.0	2	2	2
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	649-UNIMOD:21	0.03	37.0	6	1	0
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	530-UNIMOD:21,495-UNIMOD:21	0.05	37.0	3	2	1
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	18-UNIMOD:21,12-UNIMOD:21	0.06	37.0	3	1	0
PRT	sp|Q8NFA0|UBP32_HUMAN	Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1583-UNIMOD:35,1587-UNIMOD:21,1589-UNIMOD:35	0.01	37.0	1	1	1
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1106-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9Y6R1-4|S4A4_HUMAN	Isoform 4 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	254-UNIMOD:21,255-UNIMOD:21,257-UNIMOD:21	0.02	37.0	4	1	0
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	516-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	393-UNIMOD:21,174-UNIMOD:21,50-UNIMOD:21	0.08	37.0	3	3	2
PRT	sp|Q96JG6-3|VPS50_HUMAN	Isoform 3 of Syndetin OS=Homo sapiens OX=9606 GN=VPS50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	529-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1274-UNIMOD:35,314-UNIMOD:21	0.03	37.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	954-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q96N96-6|SPT13_HUMAN	Isoform 6 of Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	602-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1512-UNIMOD:21	0.00	37.0	1	1	1
PRT	sp|O43426|SYNJ1_HUMAN	Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1295-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	238-UNIMOD:21,244-UNIMOD:21	0.03	37.0	4	1	0
PRT	sp|Q8TDY2-2|RBCC1_HUMAN	Isoform 2 of RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	266-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q8WVV9-3|HNRLL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	30-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q9Y2H5|PKHA6_HUMAN	Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	775-UNIMOD:21,777-UNIMOD:21	0.02	37.0	3	1	0
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	461-UNIMOD:21,295-UNIMOD:21	0.06	37.0	2	2	2
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1915-UNIMOD:21,1932-UNIMOD:21,1949-UNIMOD:21,1339-UNIMOD:21	0.03	37.0	7	4	1
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	56-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	92-UNIMOD:35	0.10	37.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	117-UNIMOD:21,363-UNIMOD:21	0.06	37.0	2	2	2
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	1	1	1
PRT	sp|Q8NEY1-5|NAV1_HUMAN	Isoform 5 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	417-UNIMOD:21,790-UNIMOD:21	0.03	37.0	3	2	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	122-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	188-UNIMOD:21	0.05	37.0	4	1	0
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	99-UNIMOD:21,101-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q8NDF8-4|PAPD5_HUMAN	Isoform 4 of Terminal nucleotidyltransferase 4B OS=Homo sapiens OX=9606 GN=TENT4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	49-UNIMOD:21	0.10	36.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	82-UNIMOD:21	0.16	36.0	1	1	1
PRT	sp|Q9H0E3-3|SP130_HUMAN	Isoform 3 of Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	300-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	92-UNIMOD:4,94-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q6U841-4|S4A10_HUMAN	Isoform 4 of Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens OX=9606 GN=SLC4A10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	89-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q2T9K0-2|TMM44_HUMAN	Isoform 2 of Transmembrane protein 44 OS=Homo sapiens OX=9606 GN=TMEM44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	286-UNIMOD:21,295-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q7Z3J3|RGPD4_HUMAN	RanBP2-like and GRIP domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RGPD4 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1275-UNIMOD:21,1271-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	216-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	176-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	133-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	16-UNIMOD:21	0.03	36.0	2	2	2
PRT	sp|Q8TF47|ZFP90_HUMAN	Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	434-UNIMOD:21,435-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1576-UNIMOD:21,1653-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	221-UNIMOD:35	0.06	36.0	2	1	0
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1676-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9UGJ0-3|AAKG2_HUMAN	Isoform C of 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens OX=9606 GN=PRKAG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	113-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9Y6C2|EMIL1_HUMAN	EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	703-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9NS73-3|MBIP1_HUMAN	Isoform 3 of MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	91-UNIMOD:21	0.07	36.0	2	1	0
PRT	sp|P05165-3|PCCA_HUMAN	Isoform 3 of Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q8WUY3-4|PRUN2_HUMAN	Isoform 4 of Protein prune homolog 2 OS=Homo sapiens OX=9606 GN=PRUNE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2331-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	883-UNIMOD:35	0.04	36.0	2	2	2
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	249-UNIMOD:35,257-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:35,197-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	246-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1049-UNIMOD:21,1053-UNIMOD:4,1058-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	446-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	152-UNIMOD:4,155-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	131-UNIMOD:21,134-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q2LD37-2|K1109_HUMAN	Isoform 2 of Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1225-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	555-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	355-UNIMOD:21,358-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	770-UNIMOD:4,782-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1038-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1173-UNIMOD:21,1218-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q9P2R6-2|RERE_HUMAN	Isoform 2 of Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	125-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|Q8NF50-4|DOCK8_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	833-UNIMOD:35,836-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	221-UNIMOD:21,164-UNIMOD:21	0.13	36.0	2	2	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	357-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|O95382-2|M3K6_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	707-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	183-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P51784|UBP11_HUMAN	Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	648-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	98-UNIMOD:28,100-UNIMOD:21,552-UNIMOD:21	0.06	36.0	2	2	2
PRT	sp|Q9Y6R1|S4A4_HUMAN	Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	254-UNIMOD:21	0.02	36.0	5	1	0
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	138-UNIMOD:28,140-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	532-UNIMOD:21,534-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|C9J069|AJM1_HUMAN	Apical junction component 1 homolog OS=Homo sapiens OX=9606 GN=AJM1 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	109-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2340-UNIMOD:21,781-UNIMOD:21,257-UNIMOD:21,2159-UNIMOD:21	0.04	35.0	6	5	4
PRT	sp|Q9UKI8-5|TLK1_HUMAN	Isoform 5 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	46-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	203-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8TF40|FNIP1_HUMAN	Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	87-UNIMOD:4,88-UNIMOD:4,96-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O00533|NCHL1_HUMAN	Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1137-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q6UB98-2|ANR12_HUMAN	Isoform 2 of Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1349-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:21,60-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1283-UNIMOD:21,1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35	0.04	35.0	4	3	2
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	237-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	697-UNIMOD:35,699-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q13555-10|KCC2G_HUMAN	Isoform 10 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	334-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P27216-2|ANX13_HUMAN	Isoform B of Annexin A13 OS=Homo sapiens OX=9606 GN=ANXA13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	36-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	29-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|P27816-6|MAP4_HUMAN	Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	635-UNIMOD:4,636-UNIMOD:21,278-UNIMOD:35,280-UNIMOD:21	0.03	35.0	5	3	2
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	560-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q15788-2|NCOA1_HUMAN	Isoform 2 of Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	22-UNIMOD:21,24-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|O60861-1|GAS7_HUMAN	Isoform 1 of Growth arrest-specific protein 7 OS=Homo sapiens OX=9606 GN=GAS7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	88-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1543-UNIMOD:21	0.00	35.0	2	1	0
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1228-UNIMOD:4,1231-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q8IXK0-3|PHC2_HUMAN	Isoform 3 of Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:21,38-UNIMOD:35	0.09	35.0	1	1	1
PRT	sp|Q7L4E1-3|MIGA2_HUMAN	Isoform 3 of Mitoguardin 2 OS=Homo sapiens OX=9606 GN=MIGA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	228-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	441-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O75410-7|TACC1_HUMAN	Isoform 7 of Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	86-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q9UPV7|PHF24_HUMAN	PHD finger protein 24 OS=Homo sapiens OX=9606 GN=PHF24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	47-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|O95171-3|SCEL_HUMAN	Isoform 3 of Sciellin OS=Homo sapiens OX=9606 GN=SCEL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	325-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9NSC7|SIA7A_HUMAN	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	73-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q8TF65|GIPC2_HUMAN	PDZ domain-containing protein GIPC2 OS=Homo sapiens OX=9606 GN=GIPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	13-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	624-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35,622-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	426-UNIMOD:21,143-UNIMOD:21	0.06	35.0	2	2	2
PRT	sp|Q9UKE5-8|TNIK_HUMAN	Isoform 8 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	526-UNIMOD:21,862-UNIMOD:21,865-UNIMOD:35,873-UNIMOD:35	0.03	35.0	2	2	2
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:4,71-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	164-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q96QF0-8|RAB3I_HUMAN	Isoform 8 of Rab-3A-interacting protein OS=Homo sapiens OX=9606 GN=RAB3IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	69-UNIMOD:21,71-UNIMOD:35,66-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	197-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	294-UNIMOD:4,309-UNIMOD:21,41-UNIMOD:21	0.02	35.0	2	2	2
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	601-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P55317-2|FOXA1_HUMAN	Isoform 2 of Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	298-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q9BUE6|ISCA1_HUMAN	Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	73-UNIMOD:21	0.12	35.0	1	1	1
PRT	sp|Q8TD06|AGR3_HUMAN	Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	90-UNIMOD:35	0.10	35.0	2	1	0
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	967-UNIMOD:4,1263-UNIMOD:4,1265-UNIMOD:4,1270-UNIMOD:35,1275-UNIMOD:35	0.01	35.0	2	2	2
PRT	sp|Q8TDB6|DTX3L_HUMAN	E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	545-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8IXS6|PALM2_HUMAN	Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	318-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	490-UNIMOD:21	0.03	34.0	3	2	1
PRT	sp|Q9NUA8-2|ZBT40_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	139-UNIMOD:35,143-UNIMOD:21	0.12	34.0	1	1	1
PRT	sp|Q9UBW5-2|BIN2_HUMAN	Isoform 2 of Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	332-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	73-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	518-UNIMOD:21,527-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q9HD26|GOPC_HUMAN	Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	441-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	300-UNIMOD:21,294-UNIMOD:21,810-UNIMOD:21	0.02	34.0	3	2	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	821-UNIMOD:21,832-UNIMOD:21,825-UNIMOD:21	0.02	34.0	3	2	1
PRT	sp|O15504-2|NUP42_HUMAN	Isoform 2 of Nucleoporin NUP42 OS=Homo sapiens OX=9606 GN=NUP42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	82-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|O14523|C2C2L_HUMAN	Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	660-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	463-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	1917-UNIMOD:35,1356-UNIMOD:35,1597-UNIMOD:28,1954-UNIMOD:21	0.05	34.0	7	7	7
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	24-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	702-UNIMOD:21,452-UNIMOD:28,471-UNIMOD:21	0.03	34.0	2	2	2
PRT	sp|P02747|C1QC_HUMAN	Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	559-UNIMOD:21	0.04	34.0	2	2	2
PRT	sp|Q9BVG4|PBDC1_HUMAN	Protein PBDC1 OS=Homo sapiens OX=9606 GN=PBDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q9Y6F6-5|MRVI1_HUMAN	Isoform 5 of Protein MRVI1 OS=Homo sapiens OX=9606 GN=MRVI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	153-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P61073|CXCR4_HUMAN	C-X-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CXCR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	339-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	236-UNIMOD:35,242-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q13228-2|SBP1_HUMAN	Isoform 2 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	88-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	60-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	15-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	677-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	770-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	502-UNIMOD:35,505-UNIMOD:35	0.02	34.0	3	1	0
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	347-UNIMOD:21,354-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	151-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|P11137|MTAP2_HUMAN	Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1155-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1002-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	114-UNIMOD:21	0.04	34.0	4	1	0
PRT	sp|Q92870|APBB2_HUMAN	Amyloid-beta A4 precursor protein-binding family B member 2 OS=Homo sapiens OX=9606 GN=APBB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	334-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P49796-2|RGS3_HUMAN	Isoform 2 of Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	14-UNIMOD:35,15-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1186-UNIMOD:21,1208-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	43-UNIMOD:21	0.14	34.0	1	1	1
PRT	sp|Q9UNH5|CC14A_HUMAN	Dual specificity protein phosphatase CDC14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	484-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	25-UNIMOD:21	0.03	34.0	4	1	0
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1340-UNIMOD:21,381-UNIMOD:21	0.03	34.0	2	2	2
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	372-UNIMOD:35,376-UNIMOD:21,382-UNIMOD:4,2-UNIMOD:1,17-UNIMOD:21	0.10	34.0	2	2	2
PRT	sp|Q71F56|MD13L_HUMAN	Mediator of RNA polymerase II transcription subunit 13-like OS=Homo sapiens OX=9606 GN=MED13L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	915-UNIMOD:35,923-UNIMOD:21,762-UNIMOD:21	0.01	34.0	3	2	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	125-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q14469|HES1_HUMAN	Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	10-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	550-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2954-UNIMOD:21,1318-UNIMOD:21	0.01	34.0	2	2	2
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	89-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q8NAA4-2|A16L2_HUMAN	Isoform 2 of Autophagy-related protein 16-2 OS=Homo sapiens OX=9606 GN=ATG16L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	172-UNIMOD:21,181-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q8N488|RYBP_HUMAN	RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	123-UNIMOD:21	0.10	34.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	360-UNIMOD:21,369-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	246-UNIMOD:21,233-UNIMOD:21	0.03	34.0	3	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:35,68-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	92-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	617-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	128-UNIMOD:21	0.11	34.0	2	2	2
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	672-UNIMOD:21,677-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	841-UNIMOD:21,843-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|P29762|RABP1_HUMAN	Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	921-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	871-UNIMOD:21	0.02	34.0	5	1	0
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	13-UNIMOD:21,26-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q9Y4B6|DCAF1_HUMAN	DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	977-UNIMOD:28,979-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9NS62|THSD1_HUMAN	Thrombospondin type-1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THSD1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	463-UNIMOD:21,469-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9ULD4|BRPF3_HUMAN	Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	962-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	599-UNIMOD:21,602-UNIMOD:21,606-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	642-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	893-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	150-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q13506|NAB1_HUMAN	NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	356-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	2	2	2
PRT	sp|Q14CZ8|HECAM_HUMAN	Hepatocyte cell adhesion molecule OS=Homo sapiens OX=9606 GN=HEPACAM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	318-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	252-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	318-UNIMOD:21	0.01	33.0	3	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1441-UNIMOD:21,1448-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|P33241-2|LSP1_HUMAN	Isoform 2 of Lymphocyte-specific protein 1 OS=Homo sapiens OX=9606 GN=LSP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	466-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9H2Y7-2|ZN106_HUMAN	Isoform 2 of Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	556-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	368-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	260-UNIMOD:35,264-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	130-UNIMOD:21	0.07	33.0	2	1	0
PRT	sp|P02790|HEMO_HUMAN	Hemopexin OS=Homo sapiens OX=9606 GN=HPX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	154-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q96NA2-2|RILP_HUMAN	Isoform 2 of Rab-interacting lysosomal protein OS=Homo sapiens OX=9606 GN=RILP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	144-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Aldo-keto reductase family 1 member A1 OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9UGM5-2|FETUB_HUMAN	Isoform 2 of Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	278-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|O14981|BTAF1_HUMAN	TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q15032-2|R3HD1_HUMAN	Isoform 2 of R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	845-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	924-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1029-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q6P6C2-3|ALKB5_HUMAN	Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	360-UNIMOD:21,367-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q86Y97|KMT5C_HUMAN	Histone-lysine N-methyltransferase KMT5C OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	416-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q9HAN9|NMNA1_HUMAN	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	111-UNIMOD:4,117-UNIMOD:21	0.06	33.0	2	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	388-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|P35442|TSP2_HUMAN	Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	712-UNIMOD:4	0.01	33.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	178-UNIMOD:35,187-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	185-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	312-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	884-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	854-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9UQQ2|SH2B3_HUMAN	SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	150-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	714-UNIMOD:21,718-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P01275|GLUC_HUMAN	Glucagon OS=Homo sapiens OX=9606 GN=GCG PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	32-UNIMOD:21,47-UNIMOD:35	0.12	33.0	2	1	0
PRT	sp|Q9Y2J2-2|E41L3_HUMAN	Isoform 2 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	443-UNIMOD:21,457-UNIMOD:35,651-UNIMOD:21,76-UNIMOD:28,88-UNIMOD:21	0.07	33.0	3	3	3
PRT	sp|Q14191|WRN_HUMAN	Werner syndrome ATP-dependent helicase OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	478-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1089-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	247-UNIMOD:21,249-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	21-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	592-UNIMOD:21,599-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	257-UNIMOD:21,265-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	211-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	162-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	261-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P02042|HBD_HUMAN	Hemoglobin subunit delta OS=Homo sapiens OX=9606 GN=HBD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1143-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	926-UNIMOD:21,894-UNIMOD:21	0.03	33.0	2	2	2
PRT	sp|Q9UHG3-2|PCYOX_HUMAN	Isoform 2 of Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	94-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	397-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	282-UNIMOD:21,296-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	175-UNIMOD:28,187-UNIMOD:21,186-UNIMOD:21	0.07	33.0	3	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	345-UNIMOD:28,349-UNIMOD:21,346-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|O75170|PP6R2_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	769-UNIMOD:385,769-UNIMOD:4,771-UNIMOD:21,777-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	168-UNIMOD:28,183-UNIMOD:21	0.06	33.0	1	1	0
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	345-UNIMOD:21,363-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q92793|CBP_HUMAN	CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1076-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	454-UNIMOD:21,448-UNIMOD:21	0.02	33.0	3	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	485-UNIMOD:21,494-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.28	32.0	1	1	1
PRT	sp|P35228-2|NOS2_HUMAN	Isoform 2 of Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	33-UNIMOD:4,36-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1049-UNIMOD:21,1058-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q6GTX8-3|LAIR1_HUMAN	Isoform 3 of Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	250-UNIMOD:21,257-UNIMOD:35	0.08	32.0	1	1	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|P61224-3|RAP1B_HUMAN	Isoform 3 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:35	0.08	32.0	1	1	1
PRT	sp|O94988-6|FA13A_HUMAN	Isoform 5 of Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	243-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P01042-3|KNG1_HUMAN	Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	292-UNIMOD:4,296-UNIMOD:21,304-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	438-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q6NXT4-4|ZNT6_HUMAN	Isoform 4 of Zinc transporter 6 OS=Homo sapiens OX=9606 GN=SLC30A6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	352-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	123-UNIMOD:21,124-UNIMOD:21	0.14	32.0	3	1	0
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1053-UNIMOD:21,1059-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q15700-5|DLG2_HUMAN	Isoform 5 of Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8N5D0-5|WDTC1_HUMAN	Isoform 5 of WD and tetratricopeptide repeats protein 1 OS=Homo sapiens OX=9606 GN=WDTC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	510-UNIMOD:21,516-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1062-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1397-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q15057|ACAP2_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9Y2K1-2|ZBTB1_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	305-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2526-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	801-UNIMOD:4,803-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q8NFW9-5|MYRIP_HUMAN	Isoform 5 of Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	534-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|A0A1B0GTU1|ZC11B_HUMAN	Zinc finger CCCH domain-containing protein 11B OS=Homo sapiens OX=9606 GN=ZC3H11B PE=4 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	762-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9H3H3-1|CK068_HUMAN	Isoform 1 of UPF0696 protein C11orf68 OS=Homo sapiens OX=9606 GN=C11orf68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	53-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	657-UNIMOD:21,659-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|A8TX70-2|CO6A5_HUMAN	Isoform 2 of Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2255-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q92539|LPIN2_HUMAN	Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	243-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P23508|CRCM_HUMAN	Colorectal mutant cancer protein OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	120-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9UBF8-2|PI4KB_HUMAN	Isoform 2 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	275-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q5HYJ3-3|FA76B_HUMAN	Isoform 3 of Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	151-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|P51159-2|RB27A_HUMAN	Isoform Short of Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	198-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q8IY57-3|YAF2_HUMAN	Isoform 3 of YY1-associated factor 2 OS=Homo sapiens OX=9606 GN=YAF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	107-UNIMOD:21	0.19	32.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	258-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9P266|JCAD_HUMAN	Junctional protein associated with coronary artery disease OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	983-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	927-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|O15075-3|DCLK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	39-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9NRA8-2|4ET_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	190-UNIMOD:21,194-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	60-UNIMOD:35,64-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q14680-3|MELK_HUMAN	Isoform 3 of Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	311-UNIMOD:21,321-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	103-UNIMOD:21,104-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9C0E8-2|LNP_HUMAN	Isoform 2 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	9-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1315-UNIMOD:21,1324-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	201-UNIMOD:21,211-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q9HB58-5|SP110_HUMAN	Isoform 5 of Sp110 nuclear body protein OS=Homo sapiens OX=9606 GN=SP110	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	378-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P02679-2|FIBG_HUMAN	Isoform Gamma-A of Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P48960-2|CD97_HUMAN	Isoform 2 of CD97 antigen OS=Homo sapiens OX=9606 GN=CD97	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	732-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	38-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	255-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	75-UNIMOD:21	0.01	32.0	6	1	0
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	874-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|Q9HCH5|SYTL2_HUMAN	Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	316-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	188-UNIMOD:21	0.05	32.0	1	1	0
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	176-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	2	2	2
PRT	sp|Q96SB3|NEB2_HUMAN	Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	99-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q8NFH5-3|NUP35_HUMAN	Isoform 3 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	173-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	449-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	488-UNIMOD:35	0.04	31.0	2	2	2
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q96JC9-2|EAF1_HUMAN	Isoform 2 of ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	64-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	111-UNIMOD:35	0.08	31.0	1	1	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q6ZNJ1-2|NBEL2_HUMAN	Isoform 2 of Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1959-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	436-UNIMOD:21,425-UNIMOD:27,430-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	486-UNIMOD:21,490-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P04004|VTNC_HUMAN	Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|O94885|SASH1_HUMAN	SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	614-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q96S38-2|KS6C1_HUMAN	Isoform 2 of Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	411-UNIMOD:21,415-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|O00192-2|ARVC_HUMAN	Isoform Short of Armadillo repeat protein deleted in velo-cardio-facial syndrome OS=Homo sapiens OX=9606 GN=ARVCF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	852-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1834-UNIMOD:21,1671-UNIMOD:21	0.01	31.0	3	2	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	311-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	650-UNIMOD:21,653-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	243-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1318-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	23-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	463-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9P2R7-2|SUCB1_HUMAN	Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	408-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q13510-2|ASAH1_HUMAN	Isoform 2 of Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	317-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	45-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	321-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	391-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1284-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	471-UNIMOD:35,477-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q05707|COEA1_HUMAN	Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q13555-9|KCC2G_HUMAN	Isoform 9 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	344-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q96A73-2|P33MX_HUMAN	Isoform 2 of Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	164-UNIMOD:21	0.07	31.0	1	1	0
PRT	sp|Q8IWC1-2|MA7D3_HUMAN	Isoform 2 of MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	186-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|O75179-6|ANR17_HUMAN	Isoform 6 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1388-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q53SF7|COBL1_HUMAN	Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	324-UNIMOD:21,325-UNIMOD:35,335-UNIMOD:4,273-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	775-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	242-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q6NUJ5-2|PWP2B_HUMAN	Isoform 2 of PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	447-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|Q6ZNL6|FGD5_HUMAN	FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	632-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P01857|IGHG1_HUMAN	Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	27-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P78310-7|CXAR_HUMAN	Isoform 7 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	252-UNIMOD:21,264-UNIMOD:35,269-UNIMOD:35	0.07	31.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	77-UNIMOD:4,86-UNIMOD:4,416-UNIMOD:4,289-UNIMOD:4	0.07	31.0	3	3	3
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	54-UNIMOD:21	0.13	31.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	24-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	23-UNIMOD:21	0.30	31.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	311-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q1MSJ5-2|CSPP1_HUMAN	Isoform 2 of Centrosome and spindle pole-associated protein 1 OS=Homo sapiens OX=9606 GN=CSPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	130-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	243-UNIMOD:21,246-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	223-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.10	31.0	11	1	0
PRT	sp|Q6NV74|K121L_HUMAN	Uncharacterized protein KIAA1211-like OS=Homo sapiens OX=9606 GN=KIAA1211L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	185-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9HAU4|SMUF2_HUMAN	E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	44-UNIMOD:21,47-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P00738-2|HPT_HUMAN	Isoform 2 of Haptoglobin OS=Homo sapiens OX=9606 GN=HP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	241-UNIMOD:35,250-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1103-UNIMOD:28,1106-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	0
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q96A00|PP14A_HUMAN	Protein phosphatase 1 regulatory subunit 14A OS=Homo sapiens OX=9606 GN=PPP1R14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	126-UNIMOD:28,128-UNIMOD:21	0.12	31.0	1	1	1
PRT	sp|Q9NW68|BSDC1_HUMAN	BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	387-UNIMOD:21	0.03	31.0	1	1	0
PRT	sp|Q6UX71|PXDC2_HUMAN	Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	506-UNIMOD:21	0.03	31.0	1	1	0
PRT	sp|O43151|TET3_HUMAN	Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	496-UNIMOD:21,504-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P30926|ACHB4_HUMAN	Neuronal acetylcholine receptor subunit beta-4 OS=Homo sapiens OX=9606 GN=CHRNB4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	354-UNIMOD:21,355-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	127-UNIMOD:4,128-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q9Y6R0|NUMBL_HUMAN	Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	269-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q52LW3-2|RHG29_HUMAN	Isoform 2 of Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	357-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	251-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q16568|CART_HUMAN	Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:21	0.14	30.0	1	1	1
PRT	sp|Q8NF91-4|SYNE1_HUMAN	Isoform 4 of Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	8234-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:35,120-UNIMOD:21,127-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q68DQ2|CRBG3_HUMAN	Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2893-UNIMOD:4,2902-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	308-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5M775-2|CYTSB_HUMAN	Isoform 2 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	54-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	403-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1259-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q15149-6|PLEC_HUMAN	Isoform 6 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.00	30.0	1	1	1
PRT	sp|Q6WN34|CRDL2_HUMAN	Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	179-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	54-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	495-UNIMOD:21,500-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1243-UNIMOD:21,1255-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	92-UNIMOD:35,93-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|O76070|SYUG_HUMAN	Gamma-synuclein OS=Homo sapiens OX=9606 GN=SNCG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	226-UNIMOD:21,255-UNIMOD:21	0.04	30.0	2	2	2
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9UHB6-3|LIMA1_HUMAN	Isoform 3 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:21	0.04	30.0	1	1	0
PRT	sp|Q9H3U1-3|UN45A_HUMAN	Isoform 3 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	184-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q68DA7-3|FMN1_HUMAN	Isoform 3 of Formin-1 OS=Homo sapiens OX=9606 GN=FMN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	288-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	738-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	2	2	2
PRT	sp|P07948-2|LYN_HUMAN	Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O14908-2|GIPC1_HUMAN	Isoform 2 of PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	35-UNIMOD:21,47-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	627-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5TCZ1-2|SPD2A_HUMAN	Isoform 2 of SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	607-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q53TN4-3|CYBR1_HUMAN	Isoform 3 of Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	191-UNIMOD:35,199-UNIMOD:35,202-UNIMOD:21	0.11	30.0	1	1	1
PRT	sp|P08240-2|SRPRA_HUMAN	Isoform 2 of Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	267-UNIMOD:4,270-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	110-UNIMOD:4,114-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	255-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q9NW68-9|BSDC1_HUMAN	Isoform 9 of BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	292-UNIMOD:21	0.04	30.0	1	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	36-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	438-UNIMOD:21,446-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O94808|GFPT2_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	244-UNIMOD:21,247-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P34910|EVI2B_HUMAN	Protein EVI2B OS=Homo sapiens OX=9606 GN=EVI2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q8TBP0-3|TBC16_HUMAN	Isoform 3 of TBC1 domain family member 16 OS=Homo sapiens OX=9606 GN=TBC1D16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	21-UNIMOD:21,30-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	515-UNIMOD:35	0.03	30.0	2	2	2
PRT	sp|P51636-2|CAV2_HUMAN	Isoform Beta of Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1-UNIMOD:35,7-UNIMOD:21,10-UNIMOD:21	0.13	30.0	1	1	1
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1956-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|P15822|ZEP1_HUMAN	Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1034-UNIMOD:35,1036-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O75815-2|BCAR3_HUMAN	Isoform 2 of Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens OX=9606 GN=BCAR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q13342-2|SP140_HUMAN	Isoform LYSp100-A of Nuclear body protein SP140 OS=Homo sapiens OX=9606 GN=SP140	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	169-UNIMOD:4,172-UNIMOD:35,185-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1054-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	646-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P06731-2|CEAM5_HUMAN	Isoform 2 of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P17302|CXA1_HUMAN	Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	255-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	197-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	433-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q76L83|ASXL2_HUMAN	Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	524-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y2X9-2|ZN281_HUMAN	Isoform 2 of Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	584-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P81408-2|F189B_HUMAN	Isoform B of Protein FAM189B OS=Homo sapiens OX=9606 GN=FAM189B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	397-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	94-UNIMOD:21,107-UNIMOD:4,112-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q5TZA2-2|CROCC_HUMAN	Isoform 2 of Rootletin OS=Homo sapiens OX=9606 GN=CROCC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	922-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	60-UNIMOD:35,68-UNIMOD:21,73-UNIMOD:35	0.08	30.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	331-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9Y3C5|RNF11_HUMAN	RING finger protein 11 OS=Homo sapiens OX=9606 GN=RNF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	19-UNIMOD:21	0.12	30.0	1	1	1
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	350-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	319-UNIMOD:21,324-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q6H8Q1-4|ABLM2_HUMAN	Isoform 4 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	209-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q8TDX7|NEK7_HUMAN	Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	195-UNIMOD:21,203-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|Q9UKT5-2|FBX4_HUMAN	Isoform 2 of F-box only protein 4 OS=Homo sapiens OX=9606 GN=FBXO4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	46-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1099-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	984-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P69892|HBG2_HUMAN	Hemoglobin subunit gamma-2 OS=Homo sapiens OX=9606 GN=HBG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.00	30.0	1	1	1
PRT	sp|Q96EU7|C1GLC_HUMAN	C1GALT1-specific chaperone 1 OS=Homo sapiens OX=9606 GN=C1GALT1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P02730-2|B3AT_HUMAN	Isoform 2 of Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	291-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	50-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|O60547-2|GMDS_HUMAN	Isoform 2 of GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	293-UNIMOD:21,306-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q9H2Y7|ZN106_HUMAN	Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1304-UNIMOD:21,1307-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	486-UNIMOD:27,490-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|O43493|TGON2_HUMAN	Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	71-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	202-UNIMOD:4,206-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	888-UNIMOD:21	0.01	30.0	1	1	0
PRT	sp|P00915|CAH1_HUMAN	Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:35,2-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	302-UNIMOD:21,303-UNIMOD:21,307-UNIMOD:21,315-UNIMOD:21	0.03	30.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LPNLSSPSAEGPPGPPSGPAPR	1	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	6-UNIMOD:21	ms_run[2]:scan=15231	71.551	2	2161.0205	2161.0205	R	K	412	434
PSM	GDQPAASGDSDDDEPPPLPR	2	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=10252	48.489	2	2034.8767	2034.8767	R	L	48	68
PSM	GDQPAASGDSDDDEPPPLPR	3	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=10483	49.488	2	2034.8767	2034.8767	R	L	48	68
PSM	KGSSSSVCSVASSSDISLGSTK	4	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=13192	61.644	2	2209.9774	2209.9774	R	T	1382	1404
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	5	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7447	36.07529166666667	3	3008.3412	3007.3292	K	S	145	174
PSM	GDQPAASGDSDDDEPPPLPR	6	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10947	51.513	2	2034.8767	2034.8767	R	L	48	68
PSM	SKSISSSNPDLAVAPGSVDDEVSR	7	sp|Q96HP0|DOCK6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=14579	68.316	2	2496.1381	2496.1381	R	I	878	902
PSM	GDQPAASGDSDDDEPPPLPR	8	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=10709	50.502	2	2034.8767	2034.8767	R	L	48	68
PSM	KLSSSDAPAQDTGSSAAAVETDASR	9	sp|Q7Z4S6-2|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=10266	48.542	2	2501.0919	2501.0919	R	T	838	863
PSM	SASDASISSGTHGQYSILQTAR	10	sp|O15056-3|SYNJ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=15091	70.869	2	2316.0383	2316.0383	K	L	1122	1144
PSM	TSGPLSPPTGPPGPAPAGPAVR	11	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21	ms_run[2]:scan=15415	72.46	2	2060.0092	2060.0092	K	L	610	632
PSM	KVSQSTSSLVDTSVSATSR	12	sp|Q8IY17-5|PLPL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=11941	55.927	2	2018.9521	2018.9521	R	P	66	85
PSM	LPNLSSPSAEGPPGPPSGPAPR	13	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=15023	70.544	2	2161.0205	2161.0205	R	K	412	434
PSM	PAPEASSLEEPHSPETGEK	14	sp|Q5JTC6-2|AMER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:21	ms_run[2]:scan=8005	38.521	2	2070.8783	2070.8783	K	V	274	293
PSM	VDNALQSGNSQESVTEQDSK	15	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=6433	31.566	2	2134.9614	2134.9614	K	D	43	63
PSM	RSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSR	16	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	2-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=13264	61.98009666666667	3	3558.493805	3557.500214	R	Q	219	254
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	17	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21	ms_run[2]:scan=12847	60.073	3	3322.2318	3322.2318	K	D	929	958
PSM	IQPDSHSLSYGTLPDGSDSTK	18	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21	ms_run[2]:scan=13622	63.684	2	2283.9897	2283.9897	K	S	354	375
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	19	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21,25-UNIMOD:4	ms_run[2]:scan=8564	40.978	3	3620.4217	3620.4217	R	A	110	145
PSM	RDSLGAYASQDANEQGQDLGK	20	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=11782	55.232	2	2301.9863	2301.9863	K	R	342	363
PSM	SKFDSDEEEEDTENVEAASSGK	21	sp|Q8TF01-2|PNISR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21	ms_run[2]:scan=11375	53.463	2	2481.9544	2481.9544	R	V	286	308
PSM	TIGGGDDSFNTFFSETGAGK	22	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=20857	106.99	2	2006.8858	2006.8858	K	H	6	26
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	23	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6772	33.08600833333333	3	3007.3376	3007.3290	K	S	145	174
PSM	GQKSPGALETPSAAGSQGNTASQGK	24	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=5586	27.824	3	2408.0969	2408.0969	K	E	390	415
PSM	IQPDSHSLSYGTLPDGSDSTK	25	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21	ms_run[2]:scan=13415	62.679	2	2283.9897	2283.9897	K	S	354	375
PSM	KLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMR	26	sp|Q15714-4|T22D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,30-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=14383	67.333	3	3422.5582	3422.5582	R	A	261	295
PSM	KTSASDVTNIYPGDAGK	27	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=10817	50.959	2	1802.8088	1802.8088	K	A	491	508
PSM	KTSASDVTNIYPGDAGK	28	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=11041	51.977	2	1802.8088	1802.8088	K	A	491	508
PSM	KYSASSGGLCEEATAAK	29	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=8587	41.073	2	1808.7652	1808.7652	R	V	393	410
PSM	LKSEDGVEGDLGETQSR	30	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=8333	39.947	2	1898.8259	1898.8259	R	T	133	150
PSM	NEKPTQSVSSPEATSGSTGSVEK	31	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=4675	24.065	3	2386.0537	2386.0537	R	K	552	575
PSM	PAEKPAETPVATSPTATDSTSGDSSR	32	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=5316	26.691	3	2639.16	2639.1600	K	S	148	174
PSM	REESPMDVDQPSPSAQDTQSIASDGTPQGEK	33	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=10348	48.9	3	3382.4144	3382.4144	R	E	3789	3820
PSM	SETAPAETATPAPVEKSPAK	34	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=5824	28.864	2	2060.9667	2060.9667	M	K	2	22
PSM	SSHSSDSGGSDVDLDPTDGK	35	sp|P78545-2|ELF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=6422	31.511	2	2041.775	2041.7750	R	L	183	203
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	36	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=6550	32.076335	3	3007.3392	3007.3292	K	S	145	174
PSM	RSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSR	37	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	2-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=13505	63.13986833333333	3	3558.492648	3557.500214	R	Q	219	254
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	38	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=13132	61.366	3	3322.2318	3322.2318	K	D	929	958
PSM	HGSGADSDYENTQSGDPLLGLEGK	39	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=17931	86.379	2	2526.0548	2526.0548	R	R	590	614
PSM	KGSSGNASEVSVACLTER	40	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13419	62.698	2	1930.8456	1930.8456	R	I	382	400
PSM	LIDSSGSASVLTHSSSGNSLK	41	sp|Q96SU4-5|OSBL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=12935	60.473	2	2125.9893	2125.9893	R	R	133	154
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	42	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:35,5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11202	52.679	3	3061.253	3061.2530	R	V	320	347
PSM	RASVCAEAYNPDEEEDDAESR	43	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10015	47.455	2	2491.9435	2491.9435	R	I	112	133
PSM	RSSSNESFSSNQSTESTQDEETLALR	44	sp|O60268-2|K0513_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:21	ms_run[2]:scan=14099	65.988	3	2969.2524	2969.2524	R	D	71	97
PSM	TAKDSDDDDDVAVTVDR	45	sp|Q16623-3|STX1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=7598	36.8	2	1915.7684	1915.7684	R	D	10	27
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	46	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7063	34.30909833333333	3	3007.3392	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	47	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7116	34.53353333333333	3	3007.3392	3007.3292	K	S	145	174
PSM	QVAGDAPVEQATAETASPVHR	48	sp|Q92766|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,17-UNIMOD:21	ms_run[1]:scan=13117	61.285808333333335	2	2195.9916	2195.9843	R	E	1304	1325
PSM	HDYDDSSEEQSAEDSYEASPGSETQR	49	sp|P98175-2|RBM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=10415	49.196	3	2998.0898	2998.0898	K	R	55	81
PSM	HYSPEDEPSPEAQPIAAYK	50	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=12961	60.582	2	2207.9412	2207.9412	R	I	292	311
PSM	KEESEESDDDMGFGLFD	51	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=18855	92.278	2	1964.7469	1964.7469	K	-	99	116
PSM	KETESEAEDNLDDLEK	52	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=13306	62.179	2	1943.7885	1943.7885	K	H	868	884
PSM	KSSADTEFSDECTTAER	53	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7146	34.653	2	2012.767	2012.7670	R	V	1200	1217
PSM	LEGLGSSEADQDGLASTVR	54	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15165	71.237	2	1903.9123	1903.9123	R	S	455	474
PSM	LKSEDGVEGDLGETQSR	55	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=8039	38.666	2	1898.8259	1898.8259	R	T	133	150
PSM	LSSPPGKPEDSSSVDGQSVGTPVGPETGGEK	56	sp|Q3T8J9-2|GON4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21	ms_run[2]:scan=11827	55.442	3	3061.3765	3061.3765	R	N	1424	1455
PSM	LYGSAGPPPTGEEDTAEKDEL	57	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14067	65.823	2	2174.9855	2174.9855	K	-	634	655
PSM	NYDFGSSTETSDSHLTK	58	sp|P49685|GPR15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=10928	51.428	2	1967.7786	1967.7786	K	A	323	340
PSM	PFPSEETTENDDDVYR	59	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12578	58.789	2	1912.7963	1912.7963	R	S	128	144
PSM	PTSNPQVVNEGGAKPELASQATEGSK	60	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:21	ms_run[2]:scan=10295	48.663	3	2675.244	2675.2440	K	S	321	347
PSM	SGSPSDNSGAEEMEVSLAKPK	61	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9114	43.407	2	2214.9352	2214.9352	R	H	60	81
PSM	SKSQDADSPGSSGAPENLTFK	62	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=11925	55.86	2	2201.9478	2201.9478	R	E	1772	1793
PSM	SLEPAENVHGAGGGAFPASQTPSK	63	sp|P12931|SRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=12263	57.388	2	2388.0747	2388.0747	R	P	17	41
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	64	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=12565	58.731	3	3322.2318	3322.2318	K	D	929	958
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	65	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=13228	61.814	3	3322.2318	3322.2318	K	D	929	958
PSM	GAAEEAELEDSDDEEKPVK	66	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=8065	38.779	2	2139.8733	2139.8733	K	Q	88	107
PSM	KETESEAEDNLDDLEK	67	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=10099	47.807	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	68	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=13290	62.11	2	1943.7885	1943.7885	K	H	868	884
PSM	KGSAVDASVQEESPVTK	69	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=7517	36.428	2	1810.835	1810.8350	R	E	42	59
PSM	KLSGDQITLPTTVDYSSVPK	70	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=19074	93.69	2	2228.0977	2228.0977	R	Q	34	54
PSM	KSSTGEASENGLEDIDR	71	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10064	47.663	2	1886.7895	1886.7895	K	I	136	153
PSM	LLGSAAEEEEEEEEDGK	72	sp|Q86U38-2|NOP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10556	49.791	2	1862.7905	1862.7905	R	D	156	173
PSM	LYGSAGPPPTGEEDTAEKDEL	73	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13857	64.814	2	2174.9855	2174.9855	K	-	634	655
PSM	NSLVTGGEDDRMSVNSGSSSSK	74	sp|Q8WVM7-2|STAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=4950	25.223	2	2308.9479	2308.9479	R	T	1050	1072
PSM	SKSEANLIPSQEPFPASDNSGETPQR	75	sp|O00763|ACACB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=16074	75.873	3	2865.2818	2865.2818	K	N	35	61
PSM	SQSESSDEVTELDLSHGK	76	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=12373	57.869	2	2026.8368	2026.8368	R	K	657	675
PSM	SSAGDTEFVHQNSQEIQR	77	sp|O43164-2|PJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=9074	43.2	2	2111.8909	2111.8909	K	S	241	259
PSM	SSEDLAGPLPSSVSSSSTTSSKPK	78	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=12355	57.788	2	2415.1054	2415.1054	R	L	125	149
PSM	TCEERPAEDGSDEEDPDSMEAPTR	79	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=5246	26.386	3	2818.0219	2818.0219	R	I	4	28
PSM	TDKTDEPVPGASSATAALSPQEK	80	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21	ms_run[2]:scan=11535	54.181	2	2379.0843	2379.0843	K	R	415	438
PSM	TGRDTPENGETAIGAENSEK	81	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=5073	25.694	2	2154.9066	2154.9067	K	I	475	495
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	82	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=13892	64.98	3	2909.304	2909.3040	R	V	1118	1147
PSM	VHSPSGALEECYVTEIDQDK	83	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18096	87.431	2	2355.993	2355.9930	K	Y	2360	2380
PSM	YESGPDGGEEDGTGSLKR	84	sp|Q07866-6|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=4641	23.914	2	1932.7738	1932.7738	K	S	532	550
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	85	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=15793	74.39012	3	3222.385663	3221.393230	R	S	38	70
PSM	PDAQPGGELMLGGTDSK	86	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	10-UNIMOD:35	ms_run[1]:scan=10759	50.725746666666666	2	1687.7749	1687.7718	D	Y	237	254
PSM	PEDTGAEKSPTTSADLK	87	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	9-UNIMOD:21	ms_run[1]:scan=3911	20.713175	2	1825.8015	1825.7977	D	S	306	323
PSM	DPDAQPGGELMLGGTDSK	88	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=11539	54.199	2	1802.7993	1802.7993	R	Y	236	254
PSM	ELVSSSSSGSDSDSEVDKK	89	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=3755	20.022	2	2021.8314	2021.8314	K	L	6	25
PSM	EREESEDELEEANGNNPIDIEVDQNK	90	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=17159	81.917	3	3094.2888	3094.2888	R	E	256	282
PSM	FSGEEGEIEDDESGTENREEK	91	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=8563	40.974	2	2464.9391	2464.9391	K	D	927	948
PSM	GGVTGSPEASISGSKGDLK	92	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=9338	44.366	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GKLSAEENPDDSEVPSSSGINSTK	93	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=10251	48.485	2	2527.0963	2527.0963	K	S	40	64
PSM	GNAEGSSDEEGKLVIDEPAK	94	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=11542	54.211	2	2123.926	2123.9260	K	E	120	140
PSM	GNASPGAATHDSLSDYGPQDSR	95	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=11004	51.787	2	2281.9237	2281.9237	R	P	963	985
PSM	GPSSEGPEEEDGEGFSFK	96	sp|P84157-2|MXRA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14270	66.824	2	1883.7697	1883.7697	K	Y	125	143
PSM	LNQVCFDDDGTSSPQDR	97	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4	ms_run[2]:scan=11002	51.776	2	1952.817	1952.8170	K	L	295	312
PSM	MADFESGSIKNEEETK	98	sp|Q63HK5|TSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=7694	37.207	2	1909.7653	1909.7653	R	E	85	101
PSM	PAGDSVNKDSMNATSTPAALSPSVLTTPSK	99	sp|P54198|HIRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=16187	76.46	3	3039.4108	3039.4108	R	I	529	559
PSM	RASVCAEAYNPDEEEDDAESR	100	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9781	46.403	3	2491.9435	2491.9435	R	I	112	133
PSM	RISSSSVQPCSEEVSTPQDSLAQCK	101	sp|P42694|HELZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,10-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=12904	60.336	3	2859.2416	2859.2416	R	E	1761	1786
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	102	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=8451	40.477	3	2967.2003	2967.2003	K	I	832	862
PSM	SFHSSSSSSSSSTSSSASR	103	sp|Q9UBY9-3|HSPB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=673	6.0656	2	1928.7385	1928.7385	R	A	14	33
PSM	SPSDVSASESPQHDVVDLGSTAPLK	104	sp|Q8N9M5|TM102_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=16985	80.916	3	2602.18	2602.1800	K	T	209	234
PSM	SQSSHSYDDSTLPLIDR	105	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=16199	76.526	2	1999.8524	1999.8524	R	N	530	547
PSM	SSSMSSIDLVSASDDVHR	106	sp|Q9Y5P4|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13435	62.783	2	1987.8194	1987.8194	R	F	375	393
PSM	THSLSNADGQYDPYTDSR	107	sp|Q8IVL1-6|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=10426	49.249	2	2105.8328	2105.8328	R	F	11	29
PSM	TPDTNHTPVALYPDSDLEK	108	sp|Q15653-2|IKBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=14569	68.263	2	2191.9675	2191.9675	R	E	169	188
PSM	VAAAAGSGPSPPGSPGHDR	109	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3949	20.879	2	1846.7401	1846.7401	R	E	38	57
PSM	YPGPQAEGDSEGLSQGLVDR	110	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15356	72.158	2	2073.9603	2073.9603	K	E	194	214
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	111	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=15536	73.09470166666667	3	3222.388029	3221.393230	R	S	38	70
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	112	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7875	37.96056666666667	3	3007.3379	3007.3290	K	S	145	174
PSM	QHSGDHENLMNVPSDK	113	sp|Q9NWQ8|PHAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=5490	27.424609999999998	2	1885.7348	1885.7297	R	E	48	64
PSM	AGDRNSEDDGVVMTFSSVK	114	sp|Q9NY61|AATF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14434	67.596	2	2108.8722	2108.8722	R	V	198	217
PSM	AGDRNSEDDGVVMTFSSVK	115	sp|Q9NY61|AATF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14644	68.623	2	2108.8722	2108.8722	R	V	198	217
PSM	ATQQQHDFTLTQTADGR	116	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=10510	49.597	2	1996.864	1996.8640	R	S	2637	2654
PSM	CIPALDSLTPANEDQK	117	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4	ms_run[2]:scan=17226	82.314	2	1770.8458	1770.8458	R	I	447	463
PSM	DDKEEEEDGTGSPQLNNR	118	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=3452	18.729	2	2111.8281	2111.8281	K	-	393	411
PSM	DEVQEVVFVPAGTHTPGSR	119	sp|Q96FV2-2|SCRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=16221	76.64	2	2103.9626	2103.9626	R	L	38	57
PSM	DSAEGNDSYPSGIHLELQR	120	sp|P50443|S26A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=16976	80.869	2	2166.9219	2166.9219	R	E	15	34
PSM	GGEYGFGAAFDADGDR	121	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17134	81.778	2	1603.6539	1603.6539	K	Y	283	299
PSM	GKSESQMDITDINTPK	122	sp|P08473|NEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=8773	41.885	2	1858.802	1858.8020	M	P	2	18
PSM	GSGHPAYAEVEPVGEK	123	sp|Q6UX71-3|PXDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=9232	43.921	2	1705.7349	1705.7349	R	E	127	143
PSM	GSYLTHEASGLDEQGEAR	124	sp|Q8NFZ8|CADM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=12337	57.705	2	1998.832	1998.8320	K	E	353	371
PSM	IINEPTAAAIAYGLDK	125	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19623	97.518	2	1658.8879	1658.8879	R	K	172	188
PSM	KETESEAEDNLDDLEK	126	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=12510	58.493	2	1943.7885	1943.7885	K	H	868	884
PSM	KTSLVIVESADNQPETCER	127	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12640	59.076	2	2255.0141	2255.0141	R	L	3843	3862
PSM	LESIDNHSSTGGQSDQGYGSK	128	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=5892	29.2	2	2245.9125	2245.9125	R	D	951	972
PSM	LFDEEEDSSEKLFDDSDER	129	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=18159	87.813	2	2383.9217	2383.9217	K	G	706	725
PSM	LFEESDDKEDEDADGK	130	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=7423	35.942	2	1920.715	1920.7150	K	E	672	688
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	131	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11669	54.747	3	3045.258	3045.2580	R	V	320	347
PSM	PFPSEETTENDDDVYR	132	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12350	57.76	2	1912.7963	1912.7963	R	S	128	144
PSM	RVSGEPQQSGDGSLSPQAEAIEVAAGESAGR	133	sp|Q96NY7-2|CLIC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=18294	88.641	3	3119.4157	3119.4157	R	S	291	322
PSM	SGSSQELDVKPSASPQER	134	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=6735	32.903	2	1980.879	1980.8790	R	S	1539	1557
PSM	SISSPSVSSETMDKPVDLSTR	135	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=12908	60.353	2	2318.0349	2318.0349	K	K	2802	2823
PSM	SPSGPVKSPPLSPVGTTPVK	136	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12927	60.435	2	2091.0054	2091.0054	K	L	178	198
PSM	SYSSPDITQAIQEEEKR	137	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=17513	83.989	2	2059.9099	2059.9099	R	K	716	733
PSM	TDEEAEGPYSDNEMLTHK	138	sp|Q6NUK4|REEP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7750	37.44	2	2160.8195	2160.8195	K	G	201	219
PSM	TESVTSGPMSPEGSPSKSPSK	139	sp|P35612|ADDB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=3930	20.79	2	2171.9294	2171.9294	K	K	684	705
PSM	VQVAALQASPPLDQDDR	140	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15112	70.969	2	1821.9221	1821.9221	K	A	99	116
PSM	QLVYEADGCSPHGTLK	141	sp|Q5JU85|IQEC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,9-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=15554	73.18068833333334	2	1836.7786	1836.7748	R	H	618	634
PSM	QEEIDESDDDLDDKPSPIK	142	sp|Q9ULH1|ASAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=14716	69.00374166666666	2	2249.9148	2249.9095	R	K	711	730
PSM	SSAEDRSPENTGSSVAVDNFPQVDK	143	sp|Q7Z3E2|CC186_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=14534	68.08921666666666	3	2716.172222	2715.166113	R	A	734	759
PSM	AAPEASSPPASPLQHLLPGK	144	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19440	96.21	2	2126.9803	2126.9803	K	A	673	693
PSM	APSEEELHGDQTDFGQGSQSPQK	145	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=10027	47.503	3	2551.05	2551.0500	K	Q	68	91
PSM	CTLPEHESPSQDISDACEAESTER	146	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14386	67.35	3	2827.095	2827.0950	R	C	670	694
PSM	DSLEASPVLEDNSSHK	147	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=9660	45.766	2	1806.7673	1806.7673	K	T	2435	2451
PSM	ESEDKPEIEDVGSDEEEEK	148	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=9314	44.271	2	2271.8792	2271.8792	K	K	251	270
PSM	FDVPGDENAEMDAR	149	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=10839	51.047	2	1580.6413	1580.6413	K	T	1369	1383
PSM	GAVAAEGASDTEREEPTESQGLAAR	150	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=9801	46.487	3	2581.1293	2581.1293	R	L	907	932
PSM	GNSRPGTPSAEGGSTSSTLR	151	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=4912	25.066	2	1997.8804	1997.8804	R	A	383	403
PSM	HSAGSGAEESNSSSTVQK	152	sp|Q8IYL3|CA174_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=588	5.5902	2	1841.7429	1841.7429	K	Q	144	162
PSM	IEEIKTPDSFEESQGEEIGK	153	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=15226	71.528	3	2344.0359	2344.0359	R	V	1123	1143
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	154	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=12632	59.042	3	3259.4882	3259.4882	R	Q	409	441
PSM	KDASSSPASTASSASSTSLK	155	sp|Q04724|TLE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=5323	26.722	2	1948.8627	1948.8627	K	S	281	301
PSM	KDSSSVVEWTQAPK	156	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=12848	60.076	2	1640.7447	1640.7447	R	E	68	82
PSM	KGDDSDEEDLCISNK	157	sp|Q9Y3M8-5|STA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=7827	37.766	2	1803.687	1803.6870	K	W	121	136
PSM	KGSQMSTDTMVSNPMFDASEFPDNYEAGR	158	sp|Q86X10-4|RLGPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:35,10-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=17238	82.372	3	3339.3043	3339.3043	R	A	485	514
PSM	KLSSSDAPAQDTGSSAAAVETDASR	159	sp|Q7Z4S6-2|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=10232	48.404	3	2501.0919	2501.0919	R	T	838	863
PSM	KQSFDDNDSEELEDK	160	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=7907	38.096	2	1877.7204	1877.7204	K	D	105	120
PSM	LEGDSDDLLEDSDSEEHSR	161	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=11334	53.286	2	2226.8438	2226.8438	K	S	469	488
PSM	LENVSQLSLDKSPTEK	162	sp|Q86W56-3|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=13167	61.529	2	1866.8976	1866.8976	K	S	18	34
PSM	LSKSNIDISSGLEDEEPK	163	sp|Q9BZ71-3|PITM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=15586	73.326	2	2039.93	2039.9300	R	R	282	300
PSM	LSSSDRYSDASDDSFSEPR	164	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=10522	49.649	2	2199.8594	2199.8594	K	I	561	580
PSM	NGPLNESQEDEEDSEHGTSLNR	165	sp|Q9H2K8|TAOK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=8825	42.107	2	2535.9987	2535.9987	R	E	318	340
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	166	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=5345	26.812	3	3336.3553	3336.3553	R	R	157	186
PSM	QAAASATQTIAAAQHAASTPK	167	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=12382	57.914	2	2073.9844	2073.9844	K	A	923	944
PSM	QVAGDAPVEQATAETASPVHR	168	sp|Q92766-4|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=10039	47.561	2	2213.0114	2213.0114	R	E	95	116
PSM	RSSASVSDSSGFSDSESADSLYR	169	sp|Q9H4X1-2|RGCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=13837	64.727	3	2476.0027	2476.0027	R	N	43	66
PSM	RVSVCAETYNPDEEEEDTDPR	170	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11734	55.031	3	2590.0167	2590.0167	R	V	97	118
PSM	RVSVCAETYNPDEEEEDTDPR	171	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11748	55.091	2	2590.0167	2590.0167	R	V	97	118
PSM	SAEIDSDDTGGSAAQK	172	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1823	11.143	2	1550.6696	1550.6696	K	Q	814	830
PSM	SEEETSPLVTHQNPAGPVASAPELESK	173	sp|P43007-2|SATT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:21	ms_run[2]:scan=15454	72.682	3	2883.3175	2883.3175	K	E	204	231
PSM	SSPPAPPLPPGSGSPGTPQALPR	174	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=16095	75.98	2	2244.094	2244.0940	R	R	585	608
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTR	175	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=17252	82.45	3	3856.8619	3856.8619	R	G	889	925
PSM	STSMDSGSSESPASLKR	176	sp|Q15811-6|ITSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=2521	14.435	2	1821.7452	1821.7452	K	V	971	988
PSM	TGSQEGTSMEGSRPAAPAEPGTLK	177	sp|Q8IV36-3|HID1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=7776	37.567	2	2454.0734	2454.0734	R	T	363	387
PSM	TPEELEDVSDLEEEHEVR	178	sp|Q9UI47|CTNA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=16957	80.765	2	2233.9264	2233.9264	R	S	629	647
PSM	TSGPLSPPTGPPGPAPAGPAVR	179	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=15207	71.44	2	2060.0092	2060.0092	K	L	610	632
PSM	VADGLPLAASMQEDEQSGR	180	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=12492	58.411	2	1988.9109	1988.9109	R	D	10	29
PSM	VPEEAAQDRPMSPGDCPPETTETPK	181	sp|P13994|CC130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35,12-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7962	38.341	3	2834.1776	2834.1776	R	C	321	346
PSM	EDALDDSVSSSSVHASPLASSPVRK	182	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:27,21-UNIMOD:21	ms_run[1]:scan=15459	72.70558	3	2602.1976	2602.1907	R	N	2231	2256
PSM	SETAPAETATPAPVEKSPAK	183	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8365	40.093538333333335	2	2102.9835	2102.9768	M	K	2	22
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	184	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:35,4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11457	53.83296333333333	3	3061.261755	3061.252957	R	V	320	347
PSM	QAAASATQTIAAAQHAASTPK	185	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=16016	75.55589666666667	2	2056.9627	2056.9574	K	A	923	944
PSM	KGSSGNASEVSVACLTER	186	sp|Q69YQ0|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=14387	67.35341666666666	2	1931.834303	1930.845571	R	I	382	400
PSM	AAPEASSPPASPLQHLLPGK	187	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19298	95.202	2	2126.9803	2126.9803	K	A	673	693
PSM	AQLGGPEAAKSDETAAK	188	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=4018	21.192	2	1722.7826	1722.7826	R	-	189	206
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	189	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=9059	43.129	3	3001.2673	3001.2673	R	E	120	150
PSM	ESSPSVQDSTSPGEHPAK	190	sp|Q2M1Z3|RHG31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=2621	14.92	2	1918.7946	1918.7946	K	L	1070	1088
PSM	EYVNVSQELHPGAAK	191	sp|O43561-4|LAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=13420	62.702	2	1720.7822	1720.7822	R	T	189	204
PSM	FASEASGYQDNIAR	192	sp|P17661|DESM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9752	46.249	2	1527.6954	1527.6954	R	L	356	370
PSM	FEGLEADADDSNTR	193	sp|Q86VI3|IQGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9966	47.246	2	1538.6485	1538.6485	K	S	1350	1364
PSM	FVCYCEGEESGEGDR	194	sp|Q9BUH6-2|PAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=8465	40.536	2	1792.6669	1792.6669	R	G	20	35
PSM	GEEGSDDDETENGPKPK	195	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=896	7.1028	2	1882.7106	1882.7106	K	K	966	983
PSM	GGEYGFGAAFDADGDR	196	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16489	78.184	2	1603.6539	1603.6539	K	Y	283	299
PSM	GSDPGTSPPHLSTCGLGTGEESR	197	sp|Q9Y3S1-2|WNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13279	62.057	3	2377.9846	2377.9846	R	Q	1270	1293
PSM	GSVILDSGHLSTASSSDDLK	198	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=14721	69.027	2	2067.9362	2067.9362	R	G	88	108
PSM	GVVDSDDLPLNVSR	199	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17741	85.305	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	200	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17918	86.313	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	201	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18241	88.334	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	202	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20337	102.86	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	203	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20969	107.91	2	1484.7471	1484.7471	K	E	435	449
PSM	GYGYGQGAGTLSTDKGESLGIK	204	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=15154	71.183	2	2238.0206	2238.0206	K	H	70	92
PSM	IEEVLSPEGSPSKSPSK	205	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=9384	44.555	2	1849.871	1849.8710	K	K	636	653
PSM	KDSIPQVLLPEEEK	206	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=17628	84.651	2	1703.8383	1703.8383	R	L	528	542
PSM	KSSLDSNSSEMAIMMGADAK	207	sp|Q5VZ89-7|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=8601	41.138	2	2199.8735	2199.8735	K	I	1108	1128
PSM	LGIYDADGDGDFDVDDAK	208	sp|Q12797-7|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18120	87.572	2	1899.801	1899.8010	K	V	102	120
PSM	LSLEGDHSTPPSAYGSVK	209	sp|A6NMY6|AXA2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=13114	61.272	2	1923.8615	1923.8615	K	A	11	29
PSM	LSLEGDHSTPPSAYGSVK	210	sp|A6NMY6|AXA2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=13332	62.289	2	1923.8615	1923.8615	K	A	11	29
PSM	MADTSSMDEDFESDYKK	211	sp|Q8NFA0|UBP32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=8291	39.763	2	2109.7432	2109.7432	K	Y	1583	1600
PSM	NEEENIYSVPHDSTQGK	212	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=7658	37.053	2	2025.8317	2025.8317	R	I	1099	1116
PSM	NLTSSSLNDISDKPEK	213	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=11653	54.687	2	1826.8299	1826.8299	R	D	252	268
PSM	NLTSSSLNDISDKPEK	214	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=10641	50.185	2	1826.8299	1826.8299	R	D	252	268
PSM	PALNSPVERPSSDQEEGETSAQTER	215	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=8699	41.538	3	2793.209	2793.2090	R	V	512	537
PSM	PFPSEETTENDDDVYR	216	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12792	59.816	2	1912.7963	1912.7963	R	S	128	144
PSM	RASVCAEAYNPDEEEDDAESR	217	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10242	48.448	3	2491.9435	2491.9435	R	I	112	133
PSM	RVSVCAETYNPDEEEEDTDPR	218	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11979	56.086	3	2590.0167	2590.0167	R	V	97	118
PSM	SAEDVSTVPTQPDNPFSHPDK	219	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=15088	70.853	2	2347.0006	2347.0006	R	L	393	414
PSM	SAYQEYDSDSDVPEELKR	220	sp|Q96JG6-3|VPS50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=14107	66.023	2	2209.9053	2209.9053	K	D	522	540
PSM	SIFDDDMDDIFSSGIQAK	221	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:35	ms_run[2]:scan=21467	111.94	2	2018.8779	2018.8779	K	T	1268	1286
PSM	SLIGVEYKPVSATGAEDK	222	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=15076	70.799	2	1942.9289	1942.9289	K	D	944	962
PSM	SLSIPEDSVAADPQKEDR	223	sp|Q96N96-6|SPT13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=13460	62.915	2	2035.9099	2035.9099	R	V	600	618
PSM	SQSSHSYDDSTLPLIDR	224	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=15785	74.342	2	1999.8524	1999.8524	R	N	530	547
PSM	SRSESDLSQPESDEEGYALSGR	225	sp|Q15751|HERC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=12860	60.127	3	2478.0184	2478.0184	K	R	1510	1532
PSM	SSHSLPSEASSQPQVK	226	sp|O43426|SYNJ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=6418	31.492	2	1747.7778	1747.7778	R	T	1292	1308
PSM	STPSHGSVSSLNSTGSLSPK	227	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=9973	47.278	2	2008.9103	2008.9103	R	H	238	258
PSM	SVEHVSPDTADAESGK	228	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=4694	24.149	2	1707.6989	1707.6989	K	E	261	277
PSM	TEEGEIDYSAEEGENRR	229	sp|Q8WVV9-3|HNRLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=8187	39.295	2	2062.8117	2062.8117	K	E	22	39
PSM	TKSPTDDEVTPSAVVR	230	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=9541	45.239	2	1780.8244	1780.8244	R	R	775	791
PSM	TPVASTHSISSAATPDR	231	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=7853	37.873	2	1776.8044	1776.8044	R	I	457	474
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	232	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=14160	66.274	3	2909.304	2909.3040	R	V	1118	1147
PSM	TTKSPSDSGYSYETIGK	233	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=9843	46.681	2	1899.8139	1899.8139	R	T	1912	1929
PSM	TTKTPEDGDYSYEIIEK	234	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=14297	66.952	3	2067.8926	2067.8926	K	T	1929	1946
PSM	VASGSDLHLTDIDSDSNR	235	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=14250	66.724	2	1980.8426	1980.8426	K	G	70	88
PSM	VAYEGSDSEKGEGAEPLK	236	sp|P78549-3|NTH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=7471	36.21	2	1944.8354	1944.8354	R	V	51	69
PSM	VDPSLMEDSDDGPSLPTK	237	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35	ms_run[2]:scan=12937	60.48	2	1917.8514	1917.8514	K	Q	87	105
PSM	VELKSEANDAVNSSTK	238	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=10000	47.398	2	1770.8037	1770.8037	K	E	113	129
PSM	VFDDESDEKEDEEYADEK	239	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=10460	49.387	2	2270.8264	2270.8264	K	G	637	655
PSM	VLQATVVAVGSGSK	240	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10852	51.097	2	1314.7507	1314.7507	K	G	41	55
PSM	VNSNSLDLPSSSDTTHASK	241	sp|Q8NEY1-5|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=9402	44.634	2	2038.8845	2038.8845	K	V	413	432
PSM	VTQHESDNENEIQIQNK	242	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=6301	31.006	2	2104.9063	2104.9063	R	L	117	134
PSM	YNLDASEEEDSNKK	243	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=5233	26.336	2	1720.6829	1720.6829	K	K	183	197
PSM	RVSVCAETYNPDEEEEDTD	244	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=12058	56.46665333333333	2	2336.8686	2336.8623	R	P	97	116
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	245	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7680	37.147465000000004	3	3007.3379	3007.3290	K	S	145	174
PSM	EREESEDELEEANGNNPIDIEVDQNK	246	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:21	ms_run[1]:scan=17258	82.47693333333333	3	3095.283784	3094.288807	R	E	256	282
PSM	AGSSASSPPSASSSPHPSAAVPAADPADSASGSSNK	247	sp|Q8NDF8-4|PAPD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=9188	43.731	3	3273.4059	3273.4059	R	R	43	79
PSM	APSTSPSFEGTQETYTVAHEENVR	248	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=14626	68.538	3	2716.1654	2716.1654	R	F	76	100
PSM	AQSPVITTTAAHATDSALSR	249	sp|Q9H0E3-3|SP130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=14628	68.545	2	2076.9841	2076.9841	R	P	298	318
PSM	CVSVQTDPTDEIPTKK	250	sp|P18583-2|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10699	50.453	2	1896.854	1896.8540	R	S	92	108
PSM	DLDEDELLGNLSETELK	251	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22181	117.98	2	1931.9211	1931.9211	K	Q	14	31
PSM	DSGLEDGRESPSFDTPSQR	252	sp|Q6U841-4|S4A10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=10611	50.059	3	2158.8804	2158.8804	R	V	80	99
PSM	EARESPDTQALLTCAEK	253	sp|Q2T9K0-2|TMM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13630	63.729	2	1997.8765	1997.8765	K	E	282	299
PSM	EDALDDSVSSSSVHASPLASSPVR	254	sp|Q7Z3J3|RGPD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	20-UNIMOD:21	ms_run[2]:scan=15210	71.451	2	2492.1068	2492.1068	R	K	1256	1280
PSM	ESTQLSPADLTEGKPTDPSK	255	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=12717	59.441	2	2179.9886	2179.9886	R	L	215	235
PSM	FADQDDIGNVSFDR	256	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16118	76.106	2	1597.7009	1597.7009	K	V	489	503
PSM	FGYVDFESAEDLEK	257	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20256	102.19	2	1647.7304	1647.7304	K	A	349	363
PSM	GGDRDSDDDSVLEATSSR	258	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=8965	42.711	2	1960.7647	1960.7647	K	D	171	189
PSM	GSSQPNLSTSHSEQEYGK	259	sp|O95208-3|EPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=5597	27.868	2	2014.8269	2014.8269	R	A	132	150
PSM	GVGIISEGNETVEDIAAR	260	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19255	94.888	2	1828.9167	1828.9167	K	L	630	648
PSM	HSTSLTQDESTLTEVK	261	sp|Q8TF47|ZFP90_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=12983	60.681	3	1854.8248	1854.8248	K	S	433	449
PSM	IEENSLKEEESIEGEK	262	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=10287	48.63	2	1941.8456	1941.8456	K	E	1566	1582
PSM	IEEVLSPEGSPSKSPSK	263	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=9147	43.549	2	1849.871	1849.8710	K	K	636	653
PSM	ILDQGEDFPASEMTR	264	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:35	ms_run[2]:scan=12369	57.854	2	1723.7723	1723.7723	K	I	209	224
PSM	ILEDHGSPAGEIDDEDK	265	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=10002	47.405	2	1918.7833	1918.7833	R	D	1670	1687
PSM	ILGENEEEEDLAESGR	266	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13288	62.099	2	1788.8014	1788.8014	R	L	388	404
PSM	KSTAALEEDAQILK	267	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=14803	69.428	2	1595.7808	1595.7808	R	V	494	508
PSM	KTSGLSSSPSTPTQVTK	268	sp|Q9UGJ0-3|AAKG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5698	28.271	2	1784.8557	1784.8557	R	Q	111	128
PSM	KVSSSSESEPELAQLK	269	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=11792	55.276	2	1797.8397	1797.8397	R	K	2659	2675
PSM	KYSEVDDSLPSGGEK	270	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=10008	47.43	2	1689.7135	1689.7135	R	P	26	41
PSM	LKSEDGVEGDLGETQSR	271	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=8565	40.982	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	272	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9167	43.632	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	273	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9422	44.711	2	1898.8259	1898.8259	R	T	133	150
PSM	LPPNTNDEVDEDPTGNK	274	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7669	37.097	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQGQLEQGDDTAAER	275	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5648	28.071	2	1629.7594	1629.7594	R	L	359	374
PSM	LQQEATEHATESEER	276	sp|Q9Y6C2|EMIL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=2131	12.613	2	1836.7527	1836.7527	R	F	692	707
PSM	LQSPIKEENTTAVEEIGR	277	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=14059	65.783	2	2093.0042	2093.0042	K	T	89	107
PSM	LSLEGDHSTPPSAYGSVK	278	sp|A6NMY6|AXA2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=12883	60.239	2	1923.8615	1923.8615	K	A	11	29
PSM	LSSQEAASSFGDDR	279	sp|P05165-3|PCCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8835	42.148	2	1468.643	1468.6430	R	L	244	258
PSM	LTLSEGHPETPVDGDLGK	280	sp|Q8WUY3-4|PRUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=13235	61.845	2	1943.8878	1943.8878	K	Q	2322	2340
PSM	MAPYQGPDAVPGALDYK	281	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35	ms_run[2]:scan=15784	74.339	2	1807.8451	1807.8451	R	S	883	900
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	282	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10811	50.933	3	3061.253	3061.2530	R	V	320	347
PSM	MLENTDNSSPSTEHSQGLEK	283	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=4632	23.876	2	2298.9312	2298.9312	K	Q	249	269
PSM	MQNTDDEERPQLSDDER	284	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5689	28.234	2	2172.8267	2172.8267	K	Q	185	202
PSM	NEKPTQSVSSPEATSGSTGSVEK	285	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=4708	24.21	2	2386.0537	2386.0537	R	K	552	575
PSM	NFDDEDSVDGNRPSSASSTSSK	286	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=5966	29.504	2	2380.9292	2380.9292	K	A	240	262
PSM	NKSESQCDEDGMTSSLSESLK	287	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=9495	45.03	3	2426.9455	2426.9455	R	T	1047	1068
PSM	NLTSSSLNDISDKPEK	288	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=12936	60.476	2	1826.8299	1826.8299	R	D	252	268
PSM	NQVAMNPTNTVFDAK	289	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35	ms_run[2]:scan=11664	54.73	2	1664.7828	1664.7828	K	R	57	72
PSM	QKSDAEEDGGTVSQEEEDR	290	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=3634	19.507	2	2187.8441	2187.8441	K	K	444	463
PSM	SGPDCAGSLKEETGPSYQR	291	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=8051	38.72	2	2117.8725	2117.8725	R	A	148	167
PSM	SGSSQELDVKPSASPQER	292	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=7420	35.934	2	1980.879	1980.8790	R	S	1539	1557
PSM	SHSQASLAGPGPVDPSNR	293	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=8491	40.668	2	1935.7877	1935.7877	R	S	129	147
PSM	SHSSSSSSEENSSSSAAQPLLAGEK	294	sp|Q2LD37-2|K1109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=9426	44.73	3	2543.0661	2543.0661	R	E	1225	1250
PSM	SLGDDISSETSGDFR	295	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15547	73.145	2	1584.6904	1584.6904	K	K	139	154
PSM	SNSQENVEASHPSQDGK	296	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=1016	7.6181	2	1892.7538	1892.7538	R	R	555	572
PSM	SQSESSDEVTELDLSHGK	297	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=11888	55.707	2	2026.8368	2026.8368	R	K	657	675
PSM	SRSPGSPVGEGTGSPPK	298	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3088	17.091	2	1755.723	1755.7230	K	W	353	370
PSM	SSGESSPSEHSSSGVSTPCLK	299	sp|Q9Y3M8-5|STA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=7310	35.37	2	2185.8835	2185.8835	K	E	321	342
PSM	TCSDGGPSSELAHSPTNSGK	300	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4298	22.452	2	2067.8205	2067.8205	R	K	769	789
PSM	TEIKEEEDQPSTSATQSSPAPGQSK	301	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=4841	24.781	3	2711.1811	2711.1811	K	K	1021	1046
PSM	THSDASDDEAFTTSK	302	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=4404	22.919	2	1690.636	1690.6360	R	T	1171	1186
PSM	TKSPTDDEVTPSAVVR	303	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9300	44.211	2	1780.8244	1780.8244	R	R	775	791
PSM	TQEISRPNSPSEGEGESSDSR	304	sp|Q9P2R6-2|RERE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=4033	21.255	2	2327.9503	2327.9503	K	S	117	138
PSM	VANPSGNLTETYVQDR	305	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12542	58.634	2	1762.8486	1762.8486	R	G	1297	1313
PSM	VESDLKGPEVDIEGPEGK	306	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=14866	69.739	2	1976.898	1976.8980	K	L	4484	4502
PSM	VFDDESDEKEDEEYADEK	307	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=10432	49.274	3	2270.8264	2270.8264	K	G	637	655
PSM	VGDAIPAVEVFEGEPGNK	308	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20102	100.98	2	1826.905	1826.9050	K	V	6	24
PSM	VMSSSNPDLAGTHSAADEEVK	309	sp|Q8NF50-4|DOCK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=7696	37.215	2	2239.9304	2239.9304	R	N	832	853
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	310	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=10785	50.83	3	2835.1244	2835.1244	K	A	213	238
PSM	VNQIGSVTESLQACK	311	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=14450	67.667	2	1632.8141	1632.8141	K	L	344	359
PSM	VPEEPAAEEPASPEESSGLSLLHQESK	312	sp|O95382-2|M3K6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=17553	84.209	3	2926.3121	2926.3121	R	R	696	723
PSM	VVNTDHGSPEQLQIPVTDSGR	313	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=14229	66.621	2	2328.0747	2328.0747	R	H	176	197
PSM	YNLDASEEEDSNKK	314	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=5719	28.365	2	1720.6829	1720.6829	K	K	183	197
PSM	YVTKPNSDDEDDGDEK	315	sp|P51784|UBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=1567	10.036	2	1905.7153	1905.7153	R	E	642	658
PSM	QESDPEDDDVKKPALQSSVVATSK	316	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11680	54.79125833333334	3	2635.1974	2635.1897	R	E	98	122
PSM	NLTSSSLNDISDKPEK	317	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=11886	55.699940000000005	2	1826.833704	1826.829904	R	D	252	268
PSM	QQSIAGSADSKPIDVSR	318	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11554	54.25797166666667	2	1820.8356	1820.8300	K	L	138	155
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	319	sp|Q9BTA9|WAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=6028	29.764163333333336	3	2845.234927	2844.242407	R	S	523	551
PSM	NLTSSSLNDISDKPEK	320	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=10691	50.41845333333333	2	1827.820151	1826.829904	R	D	252	268
PSM	ALDSNSLENDDLSAPGR	321	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13222	61.784	2	1772.8177	1772.8177	K	E	707	724
PSM	APPGLTPAPASPPVLPR	322	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=16949	80.722	2	1716.8964	1716.8964	R	R	99	116
PSM	AQTLPTSVVTITSESSPGKR	323	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=15869	74.777	2	2138.062	2138.0620	R	E	2326	2346
PSM	ASTNNESSNHSFGSLGSLSDK	324	sp|Q9UKI8-5|TLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=13969	65.345	2	2217.9175	2217.9175	K	E	39	60
PSM	AVTIANSPSKPSEK	325	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=3136	17.299	2	1507.7283	1507.7283	K	D	197	211
PSM	CCQLKPGGDSSSSLDSSVTSSSDIK	326	sp|Q8TF40|FNIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=12619	58.975	3	2681.1198	2681.1198	K	D	87	112
PSM	DETFGEYSDSDEKPLK	327	sp|O00533|NCHL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=12214	57.175	2	1938.7772	1938.7772	K	G	1130	1146
PSM	DLSNVSNIHSSFATSPTGASNSK	328	sp|Q6UB98-2|ANR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=14480	67.814	3	2400.0595	2400.0595	R	Y	1335	1358
PSM	DSGRGDSVSDSGSDALR	329	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=4535	23.51	2	1759.701	1759.7010	R	S	59	76
PSM	EAGAGGLAIAVEGPSK	330	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13749	64.331	2	1425.7464	1425.7464	R	A	2257	2273
PSM	EDILENEDEQNSPPKK	331	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=7884	37.996	2	1963.8412	1963.8412	K	G	1272	1288
PSM	EDKSLSEAPEDTSTR	332	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=3839	20.427	2	1743.72	1743.7200	R	G	234	249
PSM	ELDQDMVTEDEDDPGSHK	333	sp|Q9NRL2-2|BAZ1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=6399	31.415	2	2154.7937	2154.7937	K	R	692	710
PSM	EPQTTVVHNATDGIK	334	sp|Q13555-10|KCC2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=10357	48.935	2	1688.7771	1688.7771	K	G	331	346
PSM	GDSQPSTVVQPLSHPSR	335	sp|P27216-2|ANX13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=9345	44.396	2	1870.8575	1870.8575	K	N	21	38
PSM	GGVTGSPEASISGSKGDLK	336	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=9579	45.401	2	1825.8459	1825.8459	K	S	5726	5745
PSM	IEEVLSPEGSPSKSPSK	337	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=9684	45.876	2	1849.871	1849.8710	K	K	636	653
PSM	ILDQGEDFPASEMTR	338	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35	ms_run[2]:scan=12597	58.873	2	1723.7723	1723.7723	K	I	209	224
PSM	ILDSVGIEADDDR	339	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12742	59.56	2	1416.6733	1416.6733	K	L	26	39
PSM	ILDSVGIEADDDR	340	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12972	60.635	2	1416.6733	1416.6733	K	L	26	39
PSM	IQVLQQQADDAEER	341	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10265	48.539	2	1641.7958	1641.7958	K	A	14	28
PSM	KAALSASEGEEVPQDK	342	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=7157	34.698	2	1737.7822	1737.7822	K	A	25	41
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	343	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=12328	57.668	3	3259.4882	3259.4882	R	Q	409	441
PSM	KCSLPAEEDSVLEK	344	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10661	50.276	2	1683.7427	1683.7427	K	L	634	648
PSM	KESAPQVLLPEEEK	345	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=13154	61.475	2	1675.807	1675.8070	R	I	558	572
PSM	KGSPCDTLASSTEK	346	sp|Q15788-2|NCOA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4630	23.869	2	1559.6539	1559.6539	R	R	20	34
PSM	KSTGDSQNLGSSSPSK	347	sp|O60861-1|GAS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=969	7.4218	2	1658.7149	1658.7149	R	K	87	103
PSM	KTLDELSQGTTTVK	348	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=9178	43.682	2	1599.7757	1599.7757	R	E	1542	1556
PSM	KTSLVIVESADNQPETCER	349	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12823	59.974	3	2255.0141	2255.0141	R	L	3843	3862
PSM	LINDCHGSVSEASSEQK	350	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=4881	24.939	2	1939.7983	1939.7983	K	I	1224	1241
PSM	LLDEEEATDNDLR	351	sp|Q8WUM4-2|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11900	55.76	2	1531.7002	1531.7002	R	A	462	475
PSM	LPNLSSPSAEGPPGPPSGPAPR	352	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=15219	71.499	3	2161.0205	2161.0205	R	K	412	434
PSM	LPQQDHTTTTDSEMEEPYLQESK	353	sp|Q8IXK0-3|PHC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11031	51.925	3	2802.1579	2802.1579	K	E	25	48
PSM	NLTSSSLNDISDKPEK	354	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=10349	48.903	2	1826.8299	1826.8299	R	D	252	268
PSM	NPETASEPLSEPESQRK	355	sp|Q7L4E1-3|MIGA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=5728	28.4	2	1977.8681	1977.8681	R	E	215	232
PSM	NQVAMNPTNTVFDAK	356	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=11630	54.59	2	1664.7828	1664.7828	K	R	57	72
PSM	NVATEGTSTQKEFEVK	357	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=8901	42.413	2	1846.835	1846.8350	K	D	106	122
PSM	PASVSENHDAGPDGDK	358	sp|Q9H4G0|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=1034	7.6916	2	1674.6523	1674.6523	R	R	439	455
PSM	PSENEVPQQAIDSHSVK	359	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=8722	41.653	3	1943.8626	1943.8626	K	N	72	89
PSM	PSENEVPQQAIDSHSVK	360	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=8770	41.869	2	1943.8626	1943.8626	K	N	72	89
PSM	QDKPLSPAGSSQEAADTPDTR	361	sp|P13994|CC130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=6957	33.841	2	2249.9801	2249.9801	R	H	357	378
PSM	QEEIDESDDDLDDKPSPIK	362	sp|Q9ULH1|ASAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=12304	57.57	2	2266.9366	2266.9366	R	K	711	730
PSM	RGTVEGSVQEVQEEK	363	sp|Q9UPV7|PHF24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=7955	38.312	2	1753.7884	1753.7884	R	E	45	60
PSM	RSEDLDNATEVNPK	364	sp|O95171-3|SCEL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=6384	31.354	2	1666.72	1666.7200	R	G	324	338
PSM	RTTIYAEPVPENNALNTQTQPK	365	sp|Q9NSC7|SIA7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=13731	64.246	3	2564.2272	2564.2272	R	A	72	94
PSM	SEEETSPLVTHQNPAGPVASAPELESK	366	sp|P43007-2|SATT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=15180	71.313	3	2883.3175	2883.3175	K	E	204	231
PSM	SGEATDGARPQALPEPMQESK	367	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=8524	40.816	3	2293.9886	2293.9886	K	A	142	163
PSM	SKETAGLVEGEPTGAGGGSLSASR	368	sp|Q8TF65|GIPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=11544	54.218	3	2297.0536	2297.0536	K	A	13	37
PSM	SLSKSDSDLLTCSPTEDATMGSR	369	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14454	67.692	3	2553.0612	2553.0612	R	S	622	645
PSM	SQEPIPDDQKVSDDDK	370	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=5980	29.569	2	1894.7833	1894.7833	K	E	415	431
PSM	SQGPALTASQSVHEQPTK	371	sp|Q9UKE5-8|TNIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=6327	31.11	2	1944.8942	1944.8942	K	G	516	534
PSM	SSGEIVYCGQVFEKSPLR	372	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=17265	82.527	2	2134.9759	2134.9759	K	V	57	75
PSM	SSTVATLQGTPDHGDPR	373	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=6275	30.894	2	1817.7945	1817.7945	K	T	155	172
PSM	STGDIAGTVVPETNKEPR	374	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=12122	56.775	2	1949.9096	1949.9096	K	Y	438	456
PSM	STSSAMSGSHQDLSVIQPIVK	375	sp|Q96QF0-8|RAB3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=16096	75.984	2	2267.0505	2267.0505	K	D	66	87
PSM	SVIDPVPAPVGDSHVDGAAK	376	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=14340	67.138	2	2009.9459	2009.9459	R	S	197	217
PSM	TDCSSGDASRPSSDNADSPK	377	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=657	5.9896	2	2132.7954	2132.7954	R	S	292	312
PSM	TDGSISGDRQPVTVADYISR	378	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=16814	79.994	3	2216.0111	2216.0111	R	A	598	618
PSM	TGQLEGAPAPGPAASPQTLDHSGATATGGASELK	379	sp|P55317-2|FOXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=13778	64.466	3	3224.4987	3224.4987	K	T	284	318
PSM	TKGDSDEEVIQDGVR	380	sp|Q9BUE6|ISCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=9311	44.255	2	1726.7411	1726.7411	K	V	69	84
PSM	VFAQNEEIQEMAQNK	381	sp|Q8TD06|AGR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=9171	43.651	2	1793.8254	1793.8254	K	F	80	95
PSM	VTAQGPGLEPSGNIANK	382	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9454	44.853	2	1651.8529	1651.8529	K	T	384	401
PSM	WDVDDWDNENSSAR	383	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16879	80.342	2	1707.6761	1707.6761	R	L	25	39
PSM	YEDEECTLPIAGR	384	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=12825	59.98	2	1551.6875	1551.6875	R	H	962	975
PSM	NLTSSSLNDISDKPEK	385	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=10973	51.640055	2	1827.833807	1826.829904	R	D	252	268
PSM	EREESEDELEEANGNNPIDIEVDQNK	386	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=17659	84.82888833333332	3	3095.282445	3094.288807	R	E	256	282
PSM	AASPPLKGSVSSEASELDK	387	sp|Q8TDB6|DTX3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=12774	59.712	2	1951.914	1951.9140	K	K	537	556
PSM	AELVLIDEDDEKSLR	388	sp|Q8IXS6|PALM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=17319	82.872	2	1823.8554	1823.8554	K	E	306	321
PSM	AESPAEKVPEESVLPLVQK	389	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=18337	88.895	3	2129.0657	2129.0657	K	S	488	507
PSM	AETEEAAHSVSQEMSVNSPTAQESQR	390	sp|Q9NUA8-2|ZBT40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=6602	32.313	3	2898.1975	2898.1975	K	N	126	152
PSM	AGQSAAGAAPGGGVDTR	391	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2439	14.092	2	1441.691	1441.6910	R	D	8	25
PSM	AKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLR	392	sp|Q9UBW5-2|BIN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=18353	89.002	3	3617.7462	3617.7462	R	T	323	359
PSM	AQLGINEDHSEGDEK	393	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=5469	27.352	2	1720.6941	1720.6941	R	S	211	226
PSM	AVLVDLEPGTMDSVR	394	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=16423	77.776	2	1616.808	1616.8080	R	S	63	78
PSM	AVSPPHLDGPPSPR	395	sp|P29590-2|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12308	57.589	2	1585.6691	1585.6691	K	S	516	530
PSM	AVTDTHENGDLGTASETPLDDGASK	396	sp|Q9HD26|GOPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:21	ms_run[2]:scan=9997	47.383	3	2580.0865	2580.0865	K	L	425	450
PSM	DDISEIQSLASDHSGR	397	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=17407	83.413	2	1808.7578	1808.7578	R	S	287	303
PSM	DNVESAQASEVKPLR	398	sp|Q12864|CAD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=8888	42.362	2	1721.7985	1721.7985	K	S	817	832
PSM	DQEKPYFSSFDSGASTNR	399	sp|O15504-2|NUP42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=14362	67.237	3	2114.8582	2114.8582	R	K	74	92
PSM	DSGRGDSVSDSGSDALR	400	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=5060	25.645	2	1759.701	1759.7010	R	S	59	76
PSM	EAGLSQSHDDLSNATATPSVR	401	sp|O14523|C2C2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=11531	54.166	2	2234.9805	2234.9805	K	K	656	677
PSM	EALGLGPPAAQLTPPPAPVGLR	402	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=21047	108.57	2	2201.161	2201.1610	R	G	451	473
PSM	ELDALDANDELTPLGR	403	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19360	95.653	2	1740.853	1740.8530	R	I	838	854
PSM	ELDEATESNEAMGR	404	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:35	ms_run[2]:scan=3987	21.054	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELDVEEAHAASTEEK	405	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=7475	36.235	2	1736.7142	1736.7142	R	E	14	29
PSM	ENQEPLRSLEDENK	406	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=10840	51.051	2	1779.7676	1779.7676	K	E	695	709
PSM	FNAVLTNPQGDYDTSTGK	407	sp|P02747|C1QC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14317	67.036	2	1926.8959	1926.8959	R	F	140	158
PSM	FNPETDYLTGTDGK	408	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14796	69.389	2	1556.6995	1556.6995	K	K	507	521
PSM	GADSGEEKEEGINR	409	sp|Q9BVG4|PBDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=1974	11.845	2	1569.6308	1569.6308	K	E	194	208
PSM	GDEADVSSPHPGEPNVPK	410	sp|Q9Y6F6-5|MRVI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=8049	38.713	2	1910.8048	1910.8048	K	G	146	164
PSM	GGHSSVSTESESSSFHSS	411	sp|P61073|CXCR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=4153	21.781	2	1874.6956	1874.6956	R	-	335	353
PSM	GGKPEPPAMPQPVPTA	412	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=7902	38.074	2	1668.7583	1668.7583	K	-	228	244
PSM	GGPVQVLEDEELK	413	sp|Q13228-2|SBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17978	86.691	2	1411.7195	1411.7195	K	S	294	307
PSM	GGSTGGGGGFDPPPAYHEVVDAEK	414	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=16877	80.334	3	2380.0009	2380.0009	R	N	86	110
PSM	GKLSAEENPDDSEVPSSSGINSTK	415	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=10230	48.397	3	2527.0963	2527.0963	K	S	40	64
PSM	GPSAAGEQEPDKESGASVDEVAR	416	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=7727	37.342	3	2365.0071	2365.0071	K	Q	47	70
PSM	GSEQESVKEFLAK	417	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=13414	62.676	2	1530.6967	1530.6967	K	A	10	23
PSM	GVVDSDDLPLNVSR	418	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16311	77.087	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	419	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16483	78.163	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	420	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16671	79.176	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	421	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16850	80.189	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	422	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16971	80.843	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	423	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17035	81.204	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	424	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17205	82.21	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	425	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17374	83.221	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	426	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17567	84.292	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	427	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18076	87.322	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	428	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18404	89.345	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	429	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18554	90.35	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	430	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18717	91.368	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	431	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18869	92.379	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	432	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19030	93.386	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	433	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19184	94.401	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	434	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19328	95.419	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	435	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19469	96.43	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	436	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19942	99.842	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	437	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20082	100.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	438	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20214	101.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	439	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20470	103.88	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	440	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20594	104.88	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	441	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20721	105.89	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	442	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20847	106.91	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	443	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21092	108.92	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	444	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21215	109.92	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	445	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21465	111.93	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	446	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21582	112.94	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	447	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21704	113.95	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	448	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21823	114.96	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	449	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22061	116.99	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	450	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22183	117.99	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	451	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22419	120	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	452	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22534	121.01	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	453	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22998	125.04	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	454	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23112	126.05	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	455	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23565	130.1	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	456	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23914	133.19	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	457	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24149	135.32	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	458	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24382	137.4	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	459	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24612	139.45	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	460	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19615	97.455	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSEDLPLNISR	461	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18022	86.96	2	1512.7784	1512.7784	R	E	387	401
PSM	HSTSDLSDATFSDIR	462	sp|Q9P227-2|RHG23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=15200	71.405	2	1730.7149	1730.7149	R	R	676	691
PSM	IAQLEEQLDNETK	463	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13251	61.918	2	1529.7573	1529.7573	K	E	1816	1829
PSM	IEEVLSPEGSPSKSPSK	464	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=8929	42.532	2	1849.871	1849.8710	K	K	636	653
PSM	IHVSDQELQSANASVDDSR	465	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=12608	58.924	3	2149.9277	2149.9277	K	L	767	786
PSM	IMVDMLDSDGSGK	466	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8008	38.538	2	1398.6007	1398.6007	K	L	501	514
PSM	IPSKEEEADMSSPTQR	467	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3669	19.649	2	1899.7921	1899.7921	K	T	345	361
PSM	IYISNTFSPSKAEGDSAGTAGTPGGTPAGDK	468	sp|Q92925-3|SMRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=15592	73.352	3	3033.3605	3033.3605	R	V	148	179
PSM	KDSIPQVLLPEEEK	469	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=18141	87.702	2	1703.8383	1703.8383	R	L	528	542
PSM	KETSPESSLIQDEIAVK	470	sp|P11137|MTAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=17299	82.742	2	1952.9344	1952.9344	K	L	1152	1169
PSM	KGDSEAEALSEIK	471	sp|Q5T1M5-2|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=11918	55.835	2	1455.6494	1455.6494	R	D	999	1012
PSM	KGSITEYTAAEEK	472	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7109	34.507	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSITEYTAAEEK	473	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7346	35.519	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSITEYTAAEEK	474	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7552	36.585	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSLSSVTPSPTPENEK	475	sp|Q92870|APBB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7570	36.662	2	1836.8506	1836.8506	R	Q	332	349
PSM	KMSGADTVGDDDEASR	476	sp|P49796-2|RGS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=1386	9.1786	2	1748.656	1748.6560	R	K	13	29
PSM	KSEDGTPAEDGTPAATGGSQPPSMGR	477	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=4671	24.047	3	2596.0749	2596.0749	R	K	1185	1211
PSM	KTLTTVQGIADDYDK	478	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=15031	70.582	2	1746.8077	1746.8077	R	K	42	57
PSM	KTSLVIVESADNQPETCER	479	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11948	55.957	3	2255.0141	2255.0141	R	L	3843	3862
PSM	LASSLGNLNAATDDPENKK	480	sp|Q9UNH5|CC14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=12602	58.896	2	2036.9416	2036.9416	R	T	481	500
PSM	LEEKSEDQDLQGLK	481	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=9537	45.221	2	1710.7713	1710.7713	R	D	21	35
PSM	LEEKSEDQDLQGLK	482	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=9210	43.827	2	1710.7713	1710.7713	R	D	21	35
PSM	LGAGEGGEASVSPEKTSTTSK	483	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=5228	26.314	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LMGIKSEDEAGCSSVDEESYK	484	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,6-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10800	50.888	3	2428.9652	2428.9652	K	T	371	392
PSM	LTLSEGHPETPVDGDLGK	485	sp|Q8WUY3-4|PRUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=13284	62.079	2	1943.8878	1943.8878	K	Q	2322	2340
PSM	MEVEDGLGSPKPEEIK	486	sp|Q71F56|MD13L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=11255	52.929	2	1852.8166	1852.8166	K	D	915	931
PSM	NGVAAEVSPAKEENPR	487	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=5924	29.333	2	1746.7938	1746.7938	K	R	118	134
PSM	NSSSPVAATPASVNTTPDKPK	488	sp|Q14469|HES1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=6815	33.271	2	2148.01	2148.0100	K	T	9	30
PSM	NYDFGSSTETSDSHLTK	489	sp|P49685|GPR15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=11175	52.565	2	1967.7786	1967.7786	K	A	323	340
PSM	PGSPEPETEPVSSVQENHENER	490	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7789	37.615	3	2527.05	2527.0500	K	I	548	570
PSM	RASVCAEAYNPDEEEDDAESR	491	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9262	44.06	3	2491.9435	2491.9435	R	I	112	133
PSM	RSLTVSDDAESSEPER	492	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=6927	33.718	2	1856.7789	1856.7789	K	K	2953	2969
PSM	RSTDSSSVSGSLQQETK	493	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=6168	30.418	2	1875.8211	1875.8211	R	Y	88	105
PSM	SASATSLTLSHCVDVVK	494	sp|Q8NAA4-2|A16L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=15873	74.792	2	1853.8594	1853.8594	R	G	170	187
PSM	SDILKDPPSEANSIQSANATTK	495	sp|Q8N488|RYBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=12999	60.744	3	2366.1003	2366.1003	K	T	115	137
PSM	SEAGHASSPDSEVTSLCQK	496	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=9934	47.094	2	2068.8409	2068.8409	K	E	353	372
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	497	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:21	ms_run[2]:scan=15919	75.048	3	2927.271	2927.2710	K	K	226	252
PSM	SGDEEFKGEDELCDSGR	498	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11543	54.214	2	2008.7357	2008.7357	R	Q	339	356
PSM	SPMSTNSSVHTGSDVEQDAEK	499	sp|Q9ULU4-4|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5546	27.662	3	2300.9104	2300.9104	R	K	56	77
PSM	SPSKPLPEVTDEYK	500	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11762	55.148	2	1668.7648	1668.7648	R	N	92	106
PSM	SQSESSDEVTELDLSHGK	501	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=12388	57.941	3	2026.8368	2026.8368	R	K	657	675
PSM	SSEPVKETVQTTQSPTPVEK	502	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=6877	33.509	2	2251.0621	2251.0621	K	E	604	624
PSM	SSGHSSSELSPDAVEK	503	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=6565	32.138	2	1695.6989	1695.6989	R	A	1378	1394
PSM	SSPPAPPLPPGSGSPGTPQALPR	504	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=15894	74.9	2	2244.094	2244.0940	R	R	585	608
PSM	SSSPGAGGGHSTSTSTSPATTLQR	505	sp|Q5JU85|IQEC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=5594	27.857	3	2311.0078	2311.0078	R	K	212	236
PSM	STPSHGSVSSLNSTGSLSPK	506	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9479	44.958	2	2008.9103	2008.9103	R	H	238	258
PSM	SVTEQGAELSNEER	507	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6609	32.342	2	1547.7063	1547.7063	K	N	28	42
PSM	TEEDETSEDANCLALSGHDK	508	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9988	47.341	3	2299.8788	2299.8788	K	T	666	686
PSM	TEPHDSDCSVDLGISK	509	sp|Q96RT1-7|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10812	50.936	2	1838.7394	1838.7394	R	S	836	852
PSM	TSQVGAASAPAKESPR	510	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=1853	11.281	2	1635.7618	1635.7618	K	K	368	384
PSM	VFAQNEEIQEMAQNK	511	sp|Q8TD06|AGR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=8949	42.632	2	1793.8254	1793.8254	K	F	80	95
PSM	VGEGFEEETVDGR	512	sp|P29762|RABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10737	50.614	2	1422.6263	1422.6263	K	K	68	81
PSM	VIPEDASESEEKLDQK	513	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9987	47.338	2	1895.8401	1895.8401	K	E	915	931
PSM	VSTLAGPSSDDENEEESKPEK	514	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=6212	30.62	2	2326.969	2326.9690	K	E	624	645
PSM	YGLQDSDEEEEEHPSK	515	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=6822	33.301	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	516	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=7064	34.313	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	517	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=7326	35.439	2	1970.7419	1970.7419	K	T	866	882
PSM	YLTESYGTGQDIDDR	518	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11679	54.788	2	1731.7588	1731.7588	R	I	167	182
PSM	SLSSSLQAPVVSTVGMQR	519	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=18134	87.657595	2	1942.939551	1941.923093	R	L	11	29
PSM	QKSDHGAYSQSPAIK	520	sp|Q9Y4B6|DCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5012	25.458348333333333	2	1678.7380	1678.7347	R	K	977	992
PSM	KNSDEENICELSEQR	521	sp|Q9NS62|THSD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=11392	53.53631333333333	2	1929.774352	1929.777551	R	G	461	476
PSM	VLENGEDHGVAGSPASPASIEEER	522	sp|Q9ULD4|BRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:21	ms_run[1]:scan=13176	61.572965	3	2530.090308	2529.102056	R	H	947	971
PSM	IPSAVSTVSMQNIHPK	523	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=12552	58.67512666666667	2	1883.823580	1883.825368	K	S	597	613
PSM	DLTGFPGPLNDQDNEDCINR	524	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:4	ms_run[1]:scan=19393	95.88614166666666	3	2289.981558	2288.996789	K	H	626	646
PSM	RDSLGAYASQDANEQGQDLGK	525	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=11156	52.48946166666667	3	2302.969211	2301.986298	K	R	891	912
PSM	AEDGATPSPSNETPKK	526	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=965	7.4081	2	1707.7353	1707.7353	K	K	138	154
PSM	AKSEELAALSSQQPEK	527	sp|Q13506|NAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10322	48.785	2	1794.8401	1794.8401	R	V	354	370
PSM	ANLPQSFQVDTSK	528	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13156	61.481	2	1433.7151	1433.7151	R	A	1465	1478
PSM	CLCYDGFMASEDMK	529	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,3-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=13620	63.672	2	1757.6405	1757.6405	R	T	1263	1277
PSM	DASDDLDDLNFFNQK	530	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21938	115.98	2	1755.7588	1755.7588	K	K	65	80
PSM	DKDSPETEENPAPEPR	531	sp|Q14CZ8|HECAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=3918	20.738	2	1889.768	1889.7680	K	S	315	331
PSM	DQEPKPSPEPAAVSR	532	sp|Q9H7S9|ZN703_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=4614	23.8	2	1686.7614	1686.7614	K	G	246	261
PSM	DVPPDILLDSPERK	533	sp|Q6KC79|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=16480	78.145	2	1672.8073	1672.8073	R	Q	309	323
PSM	DYSTLTSVSSHDSR	534	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10799	50.884	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EDSDEVHLEELSLSK	535	sp|P33241-2|LSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=16840	80.135	2	1808.7717	1808.7717	K	E	66	81
PSM	EEETSIDVAGKPNEVTK	536	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=8962	42.695	2	1924.8667	1924.8667	K	A	463	480
PSM	EPHSPADQPEQQAESTLTSAETR	537	sp|Q9H2Y7-2|ZN106_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=15029	70.575	3	2588.1028	2588.1028	K	G	553	576
PSM	FAAYFQQGDMESNGK	538	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:35	ms_run[2]:scan=11882	55.681	2	1707.7199	1707.7199	R	Y	359	374
PSM	FFQTACDVPELQDK	539	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=16967	80.819	2	1696.7767	1696.7767	R	F	1265	1279
PSM	FGESEEVEMEVESDEEDDKQEK	540	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14320	67.051	2	2712.0157	2712.0157	K	A	252	274
PSM	FGESEEVEMEVESDEEDDKQEK	541	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14423	67.543	3	2712.0157	2712.0157	K	A	252	274
PSM	GAKLTPEEEEILNK	542	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=13919	65.114	2	1649.7913	1649.7913	K	K	126	140
PSM	GECQAEGVLFFQGDR	543	sp|P02790|HEMO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=19028	93.375	2	1711.7624	1711.7624	R	E	152	167
PSM	GGEYGFGAAFDADGDR	544	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16958	80.769	2	1603.6539	1603.6539	K	Y	283	299
PSM	GGSTGGGGGFDPPPAYHEVVDAEK	545	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=16788	79.856	2	2380.0009	2380.0009	R	N	86	110
PSM	GKAESSEDETSSPAPSK	546	sp|Q96NA2-2|RILP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=798	6.6625	2	1785.7306	1785.7306	R	L	140	157
PSM	GLEVTAYSPLGSSDR	547	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16903	80.474	2	1550.7577	1550.7577	R	A	204	219
PSM	GPSSEGPEEEDGEGFSFK	548	sp|P84157-2|MXRA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13866	64.858	2	1883.7697	1883.7697	K	Y	125	143
PSM	GSVQYLPDLDDKNSQEK	549	sp|Q9UGM5-2|FETUB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=14890	69.855	2	2014.8885	2014.8885	R	G	265	282
PSM	GVGDDQLGEESEER	550	sp|P20645|MPRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6521	31.95	2	1518.6434	1518.6434	R	D	257	271
PSM	GVVDSDDLPLNVSR	551	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14834	69.586	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	552	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19810	98.832	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	553	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21937	115.97	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	554	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22301	119	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	555	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22651	122.01	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	556	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22883	124.04	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	557	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=24034	134.29	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	558	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=25886	151.08	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	559	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22768	123.02	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	560	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=23339	128.09	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	561	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=23452	129.09	2	1484.7471	1484.7471	K	E	435	449
PSM	HSTSLTQDESTLTEVK	562	sp|Q8TF47|ZFP90_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=12994	60.722	2	1854.8248	1854.8248	K	S	433	449
PSM	HYSPEDEPSPEAQPIAAYK	563	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=12910	60.358	3	2207.9412	2207.9412	R	I	292	311
PSM	IAQLEEQVEQEAR	564	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13927	65.152	2	1541.7686	1541.7686	K	E	1823	1836
PSM	IASHDFDPTDSSSK	565	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=8128	39.038	2	1585.6297	1585.6297	R	K	39	53
PSM	IIEGLQDLDDDVR	566	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18665	91.049	2	1499.7468	1499.7468	R	A	435	448
PSM	IMVDMLDSDGSGK	567	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8001	38.507	2	1398.6007	1398.6007	K	L	501	514
PSM	KAASTDLGAGETVVGK	568	sp|Q15032-2|R3HD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=8923	42.506	2	1582.7604	1582.7604	K	V	842	858
PSM	KDSSSEVFSDAAK	569	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=6795	33.192	2	1449.6025	1449.6025	R	E	922	935
PSM	KPSVSEEVQATPNK	570	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=5250	26.4	2	1592.7447	1592.7447	R	A	1027	1041
PSM	KSYESSEDCSEAAGSPAR	571	sp|Q6P6C2-3|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2941	16.403	2	2009.7674	2009.7674	R	K	359	377
PSM	LAPAPPATPAPAGTPGPILIPK	572	sp|Q86Y97|KMT5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=18694	91.227	2	2126.1541	2126.1541	R	Q	409	431
PSM	LDSSEMDHSENEDYTMSSPLPGK	573	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10116	47.875	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LEASDCDHQQNSPTLER	574	sp|Q9HAN9|NMNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5245	26.382	3	2078.8365	2078.8365	K	P	106	123
PSM	LESIDNHSSTGGQSDQGYGSK	575	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=5872	29.11	3	2245.9125	2245.9125	R	D	951	972
PSM	LKFSDDEEEEEVVK	576	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=13818	64.637	2	1774.755	1774.7550	K	D	385	399
PSM	LQSPIKEENTTAVEEIGR	577	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=14026	65.617	3	2093.0042	2093.0042	K	T	89	107
PSM	LVFNPDQEDLDGDGR	578	sp|P35442|TSP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15429	72.548	2	1688.7642	1688.7642	R	G	914	929
PSM	LYAQDADGCPIDIK	579	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=13878	64.918	2	1577.7396	1577.7396	K	V	704	718
PSM	MFVLDEADEMLSR	580	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=17343	83.011	2	1586.6956	1586.6956	K	G	178	191
PSM	NSLQDQLDEEMEAK	581	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=11555	54.262	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	NTDVAQSPEAPKQEAPAK	582	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=3436	18.66	2	1959.8939	1959.8939	R	K	179	197
PSM	NTVSQSISGDPEIDKK	583	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=7351	35.539	2	1796.8193	1796.8193	R	I	307	323
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	584	sp|Q96FS4|SIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=11678	54.784	3	2720.1814	2720.1814	K	G	866	892
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	585	sp|Q96FS4|SIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=11747	55.087	2	2720.1814	2720.1814	K	G	866	892
PSM	RSPTDSDVSLDSEDSGAK	586	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=6369	31.291	2	1944.795	1944.7950	R	S	853	871
PSM	SAGELPAAHTAAAPGTPGEAAETPAR	587	sp|Q9UQQ2|SH2B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=10907	51.332	3	2480.1333	2480.1333	R	P	150	176
PSM	SAIDLTPIVVEDKEEK	588	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=17748	85.34	2	1864.9071	1864.9071	K	K	1648	1664
PSM	SASQSSLDKLDQELK	589	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=16170	76.38	2	1727.7979	1727.7979	R	E	714	729
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	590	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=16119	76.108	3	2927.271	2927.2710	K	K	226	252
PSM	SFDDEESVDGNRPSSAASAFK	591	sp|O75122-2|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=13859	64.821	2	2294.9329	2294.9329	K	V	14	35
PSM	SFSASQADPLSDPDQMNEDKR	592	sp|P01275|GLUC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=13148	61.445	3	2432.9792	2432.9792	R	H	32	53
PSM	SFSASQADPLSDPDQMNEDKR	593	sp|P01275|GLUC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=13813	64.613	2	2432.9792	2432.9792	R	H	32	53
PSM	SKFDSDEEEEDTENVEAASSGK	594	sp|Q8TF01-2|PNISR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=11330	53.266	3	2481.9544	2481.9544	R	V	286	308
PSM	SKSQDADSPGSSGAPENLTFK	595	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=12156	56.937	3	2201.9478	2201.9478	R	E	1772	1793
PSM	SLDGASVNENHEIYMK	596	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=10201	48.273	2	1901.7867	1901.7867	R	D	443	459
PSM	SLENLNSGTVEPTHSK	597	sp|Q14191|WRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=9293	44.182	2	1791.804	1791.8040	K	C	478	494
PSM	SRSTTELDDYSTNK	598	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=6826	33.314	2	1695.6989	1695.6989	K	N	1087	1101
PSM	SRTASGSSVTSLDGTR	599	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=7312	35.383	2	1740.7081	1740.7081	R	S	245	261
PSM	SSESKPEFFYSEEQR	600	sp|A6ND36|FA83G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=14231	66.629	2	1928.783	1928.7830	R	L	18	33
PSM	SSFNVSDVARPEAAGSPPEEGGCTEGTPAK	601	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=14516	68.001	3	3083.3179	3083.3179	K	D	577	607
PSM	STGDIAGTVVPETNKEPR	602	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=11908	55.79	2	1949.9096	1949.9096	K	Y	438	456
PSM	STGKYSLATEEIER	603	sp|Q66K14-2|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=12465	58.293	2	1662.7502	1662.7502	K	D	542	556
PSM	STSTPNVHMVSTTLPVDSR	604	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=13011	60.798	2	2123.9558	2123.9558	R	M	257	276
PSM	TGNESGSNLSDSGSVKR	605	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=1729	10.74	2	1773.753	1773.7531	K	G	198	215
PSM	TKSPTDDEVTPSAVVR	606	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=8519	40.792	2	1780.8244	1780.8244	R	R	775	791
PSM	TNSDSALHTSALSTK	607	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=7166	34.732	2	1611.7141	1611.7141	R	P	160	175
PSM	TTRTPEEGGYSYDISEK	608	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=10275	48.579	2	2011.8412	2011.8412	K	T	1946	1963
PSM	TVEVAEGEAVRTPQSVTAK	609	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=10123	47.904	2	2050.9936	2050.9936	R	Q	132	151
PSM	TVLEGSTASTSPADHSALPNQSLTVR	610	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=15439	72.601	3	2718.2862	2718.2862	R	E	1308	1334
PSM	VAAAAGSGPSPPGSPGHDR	611	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3715	19.839	2	1846.7401	1846.7401	R	E	38	57
PSM	VISDSESDIGGSDVEFKPDTK	612	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=14360	67.225	3	2304.0046	2304.0046	R	E	250	271
PSM	VNVDAVGGEALGR	613	sp|P02042|HBD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12353	57.776	2	1255.6521	1255.6521	K	L	19	32
PSM	VQVAALQASPPLDQDDR	614	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15319	71.988	2	1821.9221	1821.9221	K	A	99	116
PSM	VSEDEEKLPASPK	615	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=5987	29.599	2	1507.6807	1507.6807	R	H	1133	1146
PSM	VVESPDFSKDEDYLGK	616	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=15367	72.215	2	1906.8238	1906.8238	K	V	923	939
PSM	YGLQDSDEEEEEHPSK	617	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=6596	32.287	2	1970.7419	1970.7419	K	T	866	882
PSM	YNLDASEEEDSNKK	618	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=6170	30.43	2	1720.6829	1720.6829	K	K	183	197
PSM	YQSHDYAFSSVEK	619	sp|Q9UHG3-2|PCYOX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=11138	52.411	2	1639.6556	1639.6556	R	L	92	105
PSM	GVVDSDDLPLNVSR	620	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=24781	141.02220666666668	2	1485.750841	1484.747087	K	E	435	449
PSM	QSFDDNDSEELEDKDSK	621	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=10984	51.69269666666667	2	2062.7578	2062.7523	K	S	106	123
PSM	QEASTGQSPEDHASLAPPLSPDHSSLEAK	622	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=15499	72.90017166666667	3	3048.3443	3048.3344	R	D	452	481
PSM	NLTSSSLNDISDKPEK	623	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=10874	51.19446833333333	2	1827.820151	1826.829904	R	D	252	268
PSM	QKFNDSEGDDTEETEDYR	624	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21	ms_run[1]:scan=8706	41.57074333333333	2	2257.825226	2256.833211	K	Q	392	410
PSM	LSSERPSSDGEGVVENGITTCNGK	625	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=10437	49.29490833333333	3	2573.101234	2572.111241	K	E	276	300
PSM	TGRDTPENGETAIGAENSEK	626	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=5549	27.671425	2	2155.898560	2154.906651	K	I	475	495
PSM	TGRDTPENGETAIGAENSEK	627	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=6109	30.133948333333333	2	2155.898258	2154.906651	K	I	475	495
PSM	QQIAEDPELTHSSSNK	628	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,13-UNIMOD:21	ms_run[1]:scan=11014	51.833505	2	1845.7826	1845.7777	K	I	175	191
PSM	QSLSSADNLESDAQGHQVAAR	629	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=14782	69.31290166666668	2	2245.9665	2245.9596	R	F	345	366
PSM	CSSPVDTECSHAEGSR	630	sp|O75170|PP6R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=6340	31.164526666666667	2	1840.6430	1840.6388	R	S	769	785
PSM	QPASAQSTPSTTPHSSPK	631	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=3579	19.26926	2	1870.8139	1870.8093	R	Q	168	186
PSM	KGGSYTQAASSDSAQGSDVSLTACK	632	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=9849	46.706401666666665	3	2556.084011	2555.084692	R	V	340	365
PSM	VEVKEEEESSSNGTASQSTSPSQPR	633	sp|Q92793|CBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	20-UNIMOD:21	ms_run[1]:scan=4169	21.856785000000002	3	2730.157678	2729.166507	K	K	1057	1082
PSM	ASQSRPNSSALETLGGEK	634	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21	ms_run[1]:scan=11479	53.93210833333334	2	1911.861879	1910.873500	K	L	447	465
PSM	AEEKENDTVTISPK	635	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=5446	27.255	2	1639.7342	1639.7342	K	Q	1511	1525
PSM	AESPAEKVPEESVLPLVQK	636	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=18207	88.118	2	2129.0657	2129.0657	K	S	488	507
PSM	AGLESGAEPGDGDSDTTKK	637	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=4116	21.625	2	1913.7892	1913.7892	K	K	481	500
PSM	AGPESDAQYQFTGIK	638	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14614	68.483	2	1610.7577	1610.7577	M	K	2	17
PSM	APCATSSPVTQDDLQYHNLSK	639	sp|P35228-2|NOS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=12530	58.584	3	2411.0465	2411.0465	K	Q	31	52
PSM	APSEEELHGDQTDFGQGSQSPQK	640	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:21	ms_run[2]:scan=9634	45.645	3	2551.05	2551.0500	K	Q	68	91
PSM	ASQSRPNSSALETLGGEK	641	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=10954	51.548	2	1910.8735	1910.8735	K	L	447	465
PSM	ASQSRPNSSALETLGGEK	642	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=11356	53.387	2	1910.8735	1910.8735	K	L	447	465
PSM	ATGSAGLLGDPECEGSPPEHSPEQGR	643	sp|Q5TH69|BIG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12531	58.588	3	2714.128	2714.1280	K	S	1046	1072
PSM	AVEVQGPSLESGDHGK	644	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=8120	39.006	2	1688.7407	1688.7407	R	I	288	304
PSM	AVSPQSTKPMAESITYAAVAR	645	sp|Q6GTX8-3|LAIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=13772	64.439	3	2273.0763	2273.0763	R	H	248	269
PSM	DADDAVYELNGK	646	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11412	53.631	2	1308.5834	1308.5834	R	E	47	59
PSM	DAGTIAGLNVLR	647	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18328	88.839	2	1198.667	1198.6670	K	I	160	172
PSM	DKYEPAAVSEQGDK	648	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=4909	25.055	2	1615.6767	1615.6767	R	K	8	22
PSM	DNVESAQASEVKPLRS	649	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=8247	39.575	2	1808.8306	1808.8306	K	-	817	833
PSM	DTDDVPMILVGNK	650	sp|P61224-3|RAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=16249	76.78	2	1431.6915	1431.6915	K	C	86	99
PSM	DYSTLTSVSSHDSR	651	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=8789	41.958	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EAGLSQSHDDLSNATATPSVR	652	sp|O14523|C2C2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=11508	54.062	3	2234.9805	2234.9805	K	K	656	677
PSM	EELAEELASSLSGR	653	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21592	113.03	2	1489.726	1489.7260	K	N	1711	1725
PSM	EGEEPTVYSDEEEPKDESAR	654	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=8177	39.252	2	2374.9326	2374.9326	K	K	121	141
PSM	ENSDSDEAHLSPQAGR	655	sp|O94988-6|FA13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=3890	20.632	2	1791.7061	1791.7061	R	L	233	249
PSM	ETTCSKESNEELTESCETK	656	sp|P01042-3|KNG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4114	21.618	2	2340.8975	2340.8975	R	K	289	308
PSM	FDVPGDENAEMDAR	657	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=11064	52.079	2	1580.6413	1580.6413	K	T	1369	1383
PSM	FNTANDDNVTQVR	658	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8081	38.847	2	1492.6906	1492.6906	R	A	432	445
PSM	GAGTGGLGLAVEGPSEAK	659	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13565	63.406	2	1569.7999	1569.7999	R	M	1382	1400
PSM	GLAITFVSDENDAK	660	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17313	82.839	2	1478.7253	1478.7253	K	I	384	398
PSM	GLVVDMDGFEEER	661	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=13800	64.559	2	1510.661	1510.6610	K	K	433	446
PSM	GNSRPGTPSAEGGSTSSTLR	662	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=4906	25.045	3	1997.8804	1997.8804	R	A	383	403
PSM	GTDDLNPVTSTPAKPSSPPPEFSFNTPGK	663	sp|Q6NXT4-4|ZNT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=18916	92.665	3	3064.4067	3064.4067	K	N	337	366
PSM	GTSPRPPEGGLGYSQLGDDDLK	664	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=16443	77.923	3	2338.0478	2338.0478	R	E	122	144
PSM	GVVDSDDLPLNVSR	665	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21336	110.93	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	666	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=23224	127.06	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	667	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25769	150.07	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	668	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=26147	153.1	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	669	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=23678	131.11	2	1484.7471	1484.7471	K	E	435	449
PSM	IEEVLSPEGSPSKSPSK	670	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=10257	48.507	2	1849.871	1849.8710	K	K	636	653
PSM	IETDEEESCDNAHGDANQPAR	671	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3506	18.95	3	2436.9125	2436.9125	R	D	1051	1072
PSM	IFYPETTDIYDR	672	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17333	82.949	2	1531.7195	1531.7195	K	K	131	143
PSM	ILDSVGIEADDDR	673	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14019	65.582	2	1416.6733	1416.6733	K	L	26	39
PSM	INDDLISEFPDK	674	sp|Q15700-5|DLG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18352	88.998	2	1404.6773	1404.6773	R	F	157	169
PSM	IVSSSDVGHDEYSTQSLVK	675	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=12776	59.719	2	2129.9518	2129.9518	K	K	766	785
PSM	KDSISEDEMVLR	676	sp|Q8N5D0-5|WDTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10615	50.077	2	1516.648	1516.6480	R	E	508	520
PSM	KNSSTDQGSDEEGSLQK	677	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=1662	10.459	2	1888.7688	1888.7688	R	E	1060	1077
PSM	KNSTDLDSAPEDPTSPK	678	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=6496	31.847	2	1880.8041	1880.8041	R	R	1395	1412
PSM	KPSVSEEVQATPNK	679	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=4942	25.188	2	1592.7447	1592.7447	R	A	1027	1041
PSM	KSSPSTGSLDSGNESK	680	sp|Q15057|ACAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=1382	9.1641	2	1659.6989	1659.6989	K	E	377	393
PSM	KSSTVESEIASEEK	681	sp|Q9Y2K1-2|ZBTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9975	47.285	2	1602.7026	1602.7026	R	S	303	317
PSM	KTGSQYDIQDAIDK	682	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=12815	59.94	2	1660.7345	1660.7345	R	G	2523	2537
PSM	LCSSSDTLVSEGEENQKPK	683	sp|Q5T0W9|FA83B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=9735	46.161	2	2186.9403	2186.9403	R	K	800	819
PSM	LEEKSEDQDLQGLK	684	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=9925	47.052	2	1710.7713	1710.7713	R	D	21	35
PSM	LEGDSDDLLEDSDSEEHSR	685	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=11312	53.187	3	2226.8438	2226.8438	K	S	469	488
PSM	LEQTSVRDPSPEADAPVLGSPEK	686	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=13600	63.577	3	2501.1687	2501.1687	R	E	354	377
PSM	LGSEEPSKEPSSPSAQLR	687	sp|Q8NFW9-5|MYRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9087	43.274	2	1977.9045	1977.9045	R	D	532	550
PSM	LKSEDGVEGDLGETQSR	688	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=8326	39.917	3	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	689	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9170	43.649	3	1898.8259	1898.8259	R	T	133	150
PSM	LLDPEDISVDHPDEK	690	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=15382	72.292	2	1800.7819	1800.7819	K	S	250	265
PSM	LSEGSQPAEEEEDQETPSR	691	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5830	28.892	2	2116.9033	2116.9033	K	N	239	258
PSM	LSSASTGKPPLSVEDDFEK	692	sp|A0A1B0GTU1|ZC11B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=16205	76.561	2	2085.9507	2085.9507	R	L	758	777
PSM	MADEQGDMDLQISPDRK	693	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7890	38.022	2	2059.8228	2059.8228	K	T	2115	2132
PSM	MEPGEELEEEGSPGGR	694	sp|Q9H3H3-1|CK068_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=8863	42.259	2	1717.7101	1717.7101	-	E	1	17
PSM	NEEPSEEEIDAPKPK	695	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6773	33.089	2	1790.7612	1790.7612	K	K	49	64
PSM	NEEPSEEEIDAPKPK	696	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=7019	34.109	2	1790.7612	1790.7612	K	K	49	64
PSM	NQLTSNPENTVFDAK	697	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14284	66.884	2	1676.8006	1676.8006	K	R	82	97
PSM	QNSSDSISSLNSITSHSSIGSSK	698	sp|Q8NEY1-5|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=16025	75.605	3	2402.0599	2402.0599	R	D	788	811
PSM	QQIAEDPELTHSSSNK	699	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=6715	32.793	2	1862.8048	1862.8048	K	I	175	191
PSM	QSLSSADNLESDAQGHQVAAR	700	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=12006	56.219	2	2262.9866	2262.9866	R	F	345	366
PSM	RASVCAEAYNPDEEEDDAESR	701	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10007	47.428	3	2491.9435	2491.9435	R	I	112	133
PSM	RASVCAEAYNPDEEEDDAESR	702	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10776	50.794	3	2491.9435	2491.9435	R	I	112	133
PSM	RDSLGAYASQDANEQGQDLGK	703	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=11765	55.162	3	2301.9863	2301.9863	K	R	342	363
PSM	RNSSSPVSPASVPGQR	704	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=6276	30.898	2	1784.7608	1784.7608	R	R	655	671
PSM	SAEIASLTSGHENYGR	705	sp|A8TX70-2|CO6A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=12567	58.738	2	1770.7574	1770.7574	K	K	2255	2271
PSM	SDSELEVKPAESLLR	706	sp|Q92539|LPIN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=17801	85.663	2	1751.8343	1751.8343	K	S	243	258
PSM	SELSQSQHEVNEDSR	707	sp|P23508|CRCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=3706	19.8	2	1823.7323	1823.7323	R	S	115	130
PSM	SGPDCAGSLKEETGPSYQR	708	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=8027	38.618	3	2117.8725	2117.8725	R	A	148	167
PSM	SKSDATASISLSSNLK	709	sp|Q9UBF8-2|PI4KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=12579	58.792	2	1687.803	1687.8030	R	R	275	291
PSM	SLGSSHSNSSSSSLTEK	710	sp|Q5HYJ3-3|FA76B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=3112	17.197	2	1773.7418	1773.7418	K	D	148	165
PSM	SNGHASTDQLSEEK	711	sp|P51159-2|RB27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=1741	10.792	2	1581.6308	1581.6308	R	E	193	207
PSM	SPPASSAASADQHSQSGSSSDNTER	712	sp|Q8IY57-3|YAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=928	7.236	3	2540.0049	2540.0049	K	G	94	119
PSM	SRPTSEGSDIESTEPQK	713	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=5488	27.417	2	1926.8208	1926.8208	R	Q	254	271
PSM	SRSTTELDDYSTNK	714	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=6308	31.037	2	1695.6989	1695.6989	K	N	1087	1101
PSM	SSDAKPLPASYPAEPR	715	sp|Q9P266|JCAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=9802	46.491	2	1764.8084	1764.8084	R	E	982	998
PSM	SSESDHFSYVQLR	716	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=14952	70.161	2	1633.6774	1633.6774	R	N	920	933
PSM	SSQHGGSSTSLASTK	717	sp|O15075-3|DCLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=1139	8.1214	2	1513.641	1513.6410	R	V	39	54
PSM	SSSLGSTPHEELER	718	sp|Q9NRA8-2|4ET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=7937	38.227	2	1607.6828	1607.6828	R	L	188	202
PSM	SSSMSSIDLVSASDDVHR	719	sp|Q9Y5P4|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13547	63.326	3	1987.8194	1987.8194	R	F	375	393
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	720	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=17641	84.723	3	3904.8619	3904.8619	R	G	971	1007
PSM	SSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATR	721	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=16934	80.639	3	3842.8463	3842.8463	R	G	1176	1212
PSM	STIGVMVTASHNPEEDNGVK	722	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10990	51.718	2	2179.9457	2179.9457	K	L	55	75
PSM	SVELDLNQAHMEETPK	723	sp|Q14680-3|MELK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=12303	57.566	2	1935.8285	1935.8285	R	R	311	327
PSM	SVSESHTSCPAESASDAAPLQR	724	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8980	42.779	3	2365.9846	2365.9846	K	S	96	118
PSM	TAAAVAAQSGILDR	725	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12055	56.451	2	1342.7205	1342.7205	K	T	345	359
PSM	TKPSTVEVLESIDK	726	sp|Q9C0E8-2|LNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=16306	77.065	2	1624.7961	1624.7961	K	E	5	19
PSM	TLEVVSPSQSVTGSAGHTPYYQSPTDEK	727	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	23-UNIMOD:21	ms_run[2]:scan=15838	74.618	3	3044.3652	3044.3652	K	S	1317	1345
PSM	TPAFAESVTEGDVR	728	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13737	64.272	2	1477.7049	1477.7049	K	W	75	89
PSM	TSSGTSLSAMHSSGSSGK	729	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=880	7.034	2	1763.7033	1763.7033	R	G	1315	1333
PSM	TSSKESSPIPSPTSDR	730	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=6987	33.973	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TTRTPEEGGYSYDISEK	731	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=10264	48.536	3	2011.8412	2011.8412	K	T	1946	1963
PSM	VALSDDETKETENMR	732	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=5654	28.092	2	1832.7499	1832.7499	R	K	198	213
PSM	VASGSDLHLTDIDSDSNR	733	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=14344	67.158	3	1980.8426	1980.8426	K	G	70	88
PSM	VQTTPKVEEEQDLK	734	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=7521	36.451	2	1722.8077	1722.8077	K	F	514	528
PSM	VTQGAASPGHGIQEK	735	sp|Q9HB58-5|SP110_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=2343	13.661	2	1558.7141	1558.7141	R	L	372	387
PSM	YGLQDSDEEEEEHPSK	736	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=6371	31.298	2	1970.7419	1970.7419	K	T	866	882
PSM	YLQEIYNSNNQK	737	sp|P02679-2|FIBG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9984	47.322	2	1512.7209	1512.7209	R	I	135	147
PSM	YNLDASEEEDSNKK	738	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=6096	30.072	2	1720.6829	1720.6829	K	K	183	197
PSM	YSEFTSTTSGTGHNQTR	739	sp|P48960-2|CD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=5264	26.459	2	1952.7902	1952.7902	K	A	717	734
PSM	TLTIVDTGIGMTK	740	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:35	ms_run[1]:scan=15877	74.810935	2	1364.722848	1364.722118	R	A	28	41
PSM	GVVDSDDLPLNVSR	741	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=26017	152.08735666666666	2	1485.750956	1484.747087	K	E	435	449
PSM	TTKTPEDGDYSYEIIEK	742	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=14313	67.02083	2	2068.916222	2067.892564	K	T	1929	1946
PSM	ILDSVGIEADDDR	743	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=12919	60.39765833333334	2	1416.671426	1416.673253	K	L	26	39
PSM	ILDSVGIEADDDR	744	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=12915	60.37923166666666	2	1416.671426	1416.673253	K	L	26	39
PSM	DSLRSTPSHGSVSSLNSTGSLSPK	745	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	22-UNIMOD:21	ms_run[1]:scan=11976	56.070393333333335	2	2481.145527	2480.154426	K	H	234	258
PSM	EIQNGNLHESDSESVPR	746	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=9339	44.369725	2	1990.832640	1989.842928	K	D	66	83
PSM	EIQNGNLHESDSESVPR	747	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=8375	40.14209	2	1990.835757	1989.842928	K	D	66	83
PSM	KETESEAEDNLDDLEK	748	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=13284	62.079273333333326	2	1943.794244	1943.788493	K	H	870	886
PSM	EHSLEDNSSPNSLEPLK	749	sp|Q9HCH5|SYTL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=12765	59.6632	2	1975.847739	1974.857182	K	H	314	331
PSM	EIQNGNLHESDSESVPR	750	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=8830	42.124990000000004	2	1990.832867	1989.842928	K	D	66	83
PSM	YNLDASEEEDSNKK	751	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=6012	29.698538333333335	2	1720.682868	1720.682906	K	K	183	197
PSM	AATSGVPSIYAPSTYAHLSPAK	752	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:21	ms_run[2]:scan=18357	89.026	2	2268.0828	2268.0828	K	T	158	180
PSM	AGLESGAEPGDGDSDTTKK	753	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=3558	19.178	2	1913.7892	1913.7892	K	K	481	500
PSM	APPGLTPAPASPPVLPR	754	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=17129	81.745	2	1716.8964	1716.8964	R	R	99	116
PSM	ASLEAAIADAEQR	755	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17505	83.956	2	1343.6681	1343.6681	R	G	329	342
PSM	ASSLNENVDHSALLK	756	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=12244	57.304	2	1676.7771	1676.7771	R	L	98	113
PSM	ASTSDYQVISDRQTPK	757	sp|Q8NFH5-3|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=8588	41.076	2	1874.8411	1874.8411	K	K	160	176
PSM	AVTPVPTKTEEVSNLK	758	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10571	49.87	2	1791.9019	1791.9019	R	T	447	463
PSM	DDISEIQSLASDHSGR	759	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=17889	86.142	2	1808.7578	1808.7578	R	S	287	303
PSM	DDKEEEEDGTGSPQLNNR	760	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=2748	15.499	2	2111.8281	2111.8281	K	-	393	411
PSM	DFVDDDDDDDLER	761	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12587	58.827	2	1582.5907	1582.5907	R	V	44	57
PSM	DGDDVIIIGVFK	762	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=22507	120.78	2	1289.6867	1289.6867	K	G	302	314
PSM	DHSPTPSVFNSDEER	763	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10074	47.707	2	1795.705	1795.7050	R	Y	416	431
PSM	DLDDIEDENEQLK	764	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13911	65.08	2	1574.6948	1574.6948	R	Q	313	326
PSM	DNPSPEPQLDDIKR	765	sp|Q96JC9-2|EAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=10659	50.269	2	1702.7563	1702.7563	K	E	61	75
PSM	DSDDVPMVLVGNK	766	sp|P01112-2|RASH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=13525	63.228	2	1403.6602	1403.6602	K	C	105	118
PSM	DVPPDILLDSPERK	767	sp|Q6KC79|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=16846	80.166	2	1672.8073	1672.8073	R	Q	309	323
PSM	DVTTPGHSTPVPDGK	768	sp|Q71F56|MD13L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=4189	21.952	2	1586.6978	1586.6978	K	N	755	770
PSM	EALGLGPPAAQLTPPPAPVGLR	769	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=21062	108.68	3	2201.161	2201.1610	R	G	451	473
PSM	EDDVGTGAGLLEIK	770	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17596	84.461	2	1415.7144	1415.7144	R	K	302	316
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	771	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=9327	44.327	3	3001.2673	3001.2673	R	E	120	150
PSM	EHSLEDNSSPNSLEPLK	772	sp|Q9HCH5-15|SYTL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=12539	58.623	2	1974.8572	1974.8572	K	H	172	189
PSM	EKYESFEDPAGTIDK	773	sp|Q6ZNJ1-2|NBEL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=14124	66.1	2	1807.7553	1807.7553	R	F	1955	1970
PSM	ELVSSSSSGSDSDSEVDKK	774	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=4010	21.156	2	2021.8314	2021.8314	K	L	6	25
PSM	ETNLDSLPLVDTHSK	775	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=16418	77.748	2	1747.803	1747.8030	R	R	425	440
PSM	ETPRPEGGSPSPAGTPPQPK	776	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5093	25.768	2	2145.9133	2145.9133	R	R	476	496
PSM	FDDGAGGDNEVQR	777	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4108	21.592	2	1378.5749	1378.5749	R	T	285	298
PSM	FEDGVLDPDYPR	778	sp|P04004|VTNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16196	76.512	2	1421.6463	1421.6463	R	N	230	242
PSM	FIYVDVLSEDEEKPK	779	sp|O94885|SASH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=19162	94.251	2	1889.87	1889.8700	K	R	607	622
PSM	FLNRSPEESFDIK	780	sp|Q96S38-2|KS6C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=16937	80.654	2	1740.7161	1740.7161	K	E	407	420
PSM	GAKLTPEEEEILNK	781	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=14130	66.127	2	1649.7913	1649.7913	K	K	126	140
PSM	GASSAGEASEKEPLK	782	sp|O00192-2|ARVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=3921	20.755	2	1539.6818	1539.6818	R	L	850	865
PSM	GDDGPDIADEESRGLEGK	783	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=10686	50.396	2	1938.7844	1938.7844	K	A	1823	1841
PSM	GEELGKSSDLEDNR	784	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=6211	30.617	2	1627.6727	1627.6727	K	S	304	318
PSM	GGIDNPAITSDQELDDKK	785	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=11160	52.505	2	1994.8834	1994.8834	K	M	1209	1227
PSM	GKSSPICSTTGDDK	786	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1175	8.2657	2	1531.6226	1531.6226	K	L	647	661
PSM	GPVEGYEENEEFLR	787	sp|Q9UI30-2|TR112_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16030	75.629	2	1666.7475	1666.7475	K	T	64	78
PSM	GTLDEEDEEADSDTDDIDHR	788	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=10208	48.303	3	2355.85	2355.8500	R	V	232	252
PSM	GVVDSDDLPLNVSR	789	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=24261	136.33	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	790	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=26280	154.14	2	1484.7471	1484.7471	K	E	435	449
PSM	GYTSDSEVYTDHGR	791	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=8047	38.705	2	1665.6308	1665.6308	R	P	1315	1329
PSM	HAPSPEPAVQGTGVAGVPEESGDAAAIPAK	792	sp|P13051|UNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=14604	68.438	3	2889.3546	2889.3546	R	K	20	50
PSM	HGSGADSDYENTQSGDPLLGLEGK	793	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=17887	86.13	3	2526.0548	2526.0548	R	R	590	614
PSM	IAQEIASLSKEDVSK	794	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=11651	54.682	2	1696.8284	1696.8284	K	E	455	470
PSM	IDVDTEDVGDER	795	sp|Q9Y2W6-3|TDRKH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9264	44.067	2	1361.5947	1361.5947	R	V	86	98
PSM	IEEVLSPEGSPSKSPSK	796	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=9911	46.99	2	1849.871	1849.8710	K	K	636	653
PSM	IFDIDEAEEGVK	797	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17008	81.049	2	1363.6507	1363.6507	K	D	88	100
PSM	IFTSIGEDYDER	798	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14777	69.29	2	1443.6518	1443.6518	R	V	106	118
PSM	ILACDDLDEAAR	799	sp|Q9P2R7-2|SUCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=11940	55.924	2	1360.6293	1360.6293	K	M	405	417
PSM	IMVDMLDSDGSGK	800	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8241	39.549	2	1398.6007	1398.6007	K	L	501	514
PSM	IQFENNEDQDVNPLK	801	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15501	72.906	2	1801.8483	1801.8483	K	L	488	503
PSM	KCSLPAEEDSVLEK	802	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12406	58.034	2	1683.7427	1683.7427	K	L	634	648
PSM	KESLDVYELDAK	803	sp|Q13510-2|ASAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=15026	70.56	2	1488.6749	1488.6749	R	Q	315	327
PSM	KGTVEGFEPADNK	804	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=7052	34.256	2	1470.6392	1470.6392	K	C	43	56
PSM	KSSELDASDSSSSSNLSLAK	805	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=9929	47.072	3	2091.9209	2091.9209	R	V	288	308
PSM	LDSSEMDHSENEDYTMSSPLPGK	806	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10203	48.28	2	2680.0194	2680.0194	R	K	1174	1197
PSM	LEEKSEDQDLQGLK	807	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=11490	53.981	2	1710.7713	1710.7713	R	D	21	35
PSM	LEGPVSPDVEPGKEETEESK	808	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=10745	50.65	2	2234.9832	2234.9832	K	K	1666	1686
PSM	LKSEDGVEGDLGETQSR	809	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=7251	35.108	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	810	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=9409	44.665	3	1898.8259	1898.8259	R	T	133	150
PSM	LNTFGDEVFNDPK	811	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16704	79.342	2	1494.6991	1494.6991	R	V	256	269
PSM	LPIEETLEDSPQTR	812	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15253	71.648	2	1626.8101	1626.8101	K	S	7	21
PSM	LPNLSSPSAEGPPGPPSGPAPR	813	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=15012	70.485	3	2161.0205	2161.0205	R	K	412	434
PSM	LSKSDEQLSSLDR	814	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=10219	48.348	2	1556.7083	1556.7083	K	D	318	331
PSM	LSLQGHPTDLQTSNVK	815	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=12442	58.197	2	1816.872	1816.8720	R	N	390	406
PSM	LTEVPVEPVLTVHPESK	816	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=17910	86.265	2	1952.986	1952.9860	K	S	537	554
PSM	LTVSDGESGEEKK	817	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=2864	16.038	2	1457.6287	1457.6287	K	T	1277	1290
PSM	LYGSAGPPPTGEEDTAEKDEL	818	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13944	65.228	3	2174.9855	2174.9855	K	-	634	655
PSM	MESSFGSPSKQESSESLPK	819	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=9570	45.366	2	2136.8922	2136.8922	K	E	471	490
PSM	MEVEDGLGSPKPEEIK	820	sp|Q71F56|MD13L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=10041	47.568	2	1852.8166	1852.8166	K	D	915	931
PSM	NLVVGDETTSSLR	821	sp|Q05707|COEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12266	57.403	2	1389.71	1389.7100	R	V	740	753
PSM	NSLEPQTTVVHNATDGIK	822	sp|Q13555-9|KCC2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=14275	66.842	2	2002.9361	2002.9361	K	G	337	355
PSM	QKSDAEEDGGTVSQEEEDR	823	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=3610	19.406	3	2187.8441	2187.8441	K	K	444	463
PSM	QPASAQSTPSTTPHSSPK	824	sp|Q96A73-2|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=1099	7.9564	2	1887.8364	1887.8364	R	Q	149	167
PSM	RASVCAEAYNPDEEEDDAESR	825	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8777	41.905	3	2491.9435	2491.9435	R	I	112	133
PSM	RVSVCAETYNPDEEEEDTDPR	826	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11126	52.363	3	2590.0167	2590.0167	R	V	97	118
PSM	SASTEKLEQGTSALIR	827	sp|Q8IWC1-2|MA7D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=15081	70.822	2	1769.8561	1769.8561	R	Q	183	199
PSM	SDNHSPAVVTTTVSSK	828	sp|O75179-6|ANR17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=5599	27.876	2	1708.7669	1708.7669	K	K	1384	1400
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	829	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=16668	79.161	3	2927.271	2927.2710	K	K	226	252
PSM	SLEPAENVHGAGGGAFPASQTPSK	830	sp|P12931|SRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=12484	58.374	3	2388.0747	2388.0747	R	P	17	41
PSM	SMSVDETDKSPCEAGR	831	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21,2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2509	14.381	2	1863.7016	1863.7016	K	V	324	340
PSM	SNTISKPYISNTLPSDAPK	832	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=14662	68.731	2	2112.014	2112.0140	R	K	273	292
PSM	SPSTTYLHTPTPSEDAAIPSK	833	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=14643	68.619	3	2279.0359	2279.0359	R	S	775	796
PSM	SSDGSLSHEEDLAK	834	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=6966	33.878	2	1553.6247	1553.6247	R	V	238	252
PSM	SSGESSPSEHSSSGVSTPCLK	835	sp|Q9Y3M8-5|STA13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=7221	34.975	3	2185.8835	2185.8835	K	E	321	342
PSM	SSGSEGTPADTGDLSPGHGASAPSVSR	836	sp|Q6NUJ5-2|PWP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:21	ms_run[2]:scan=9585	45.425	3	2563.0824	2563.0824	R	E	433	460
PSM	SSPSLLIESDSPDKYK	837	sp|Q6ZNL6|FGD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=15413	72.448	2	1844.8445	1844.8445	K	K	632	648
PSM	SSSLGSTPHEELER	838	sp|Q9NRA8-2|4ET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=7296	35.309	2	1607.6828	1607.6828	R	L	188	202
PSM	STPSHGSVSSLNSTGSLSPK	839	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=9728	46.125	3	2008.9103	2008.9103	R	H	238	258
PSM	STSGGTAALGCLVK	840	sp|P01857|IGHG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=13480	63.007	2	1320.6708	1320.6708	K	D	17	31
PSM	STSSAMSGSHQDLSVIQPIVK	841	sp|Q96QF0-8|RAB3I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=16137	76.207	3	2267.0505	2267.0505	K	D	66	87
PSM	SYIGSNHSSLGSMSPSNMEGYSK	842	sp|P78310-7|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9701	45.971	3	2530.9982	2530.9982	R	T	252	275
PSM	TCVADESAENCDK	843	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1604	10.199	2	1497.5712	1497.5712	K	S	76	89
PSM	TEDLEATSEHFK	844	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=7802	37.67	2	1485.6025	1485.6025	K	T	48	60
PSM	TESNQEVANPEHYIK	845	sp|P06730|IF4E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=13158	61.488	2	1837.7884	1837.7884	K	H	22	37
PSM	TETQEKNPLPSK	846	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=3440	18.68	2	1450.6705	1450.6705	K	E	21	33
PSM	TEVALAKDMESPTK	847	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5106	25.816	2	1614.7212	1614.7212	K	L	270	284
PSM	TGRDTPENGETAIGAENSEK	848	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=5058	25.639	3	2154.9066	2154.9067	K	I	475	495
PSM	TIEEYAICPDLR	849	sp|Q15124|PGM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=17249	82.432	2	1478.7075	1478.7075	K	I	158	170
PSM	TSLYSEDDCKSLR	850	sp|O00763|ACACB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8889	42.366	2	1652.6753	1652.6753	R	E	1404	1417
PSM	TSSAFVGKTPEASPEPK	851	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=7662	37.072	2	1811.8343	1811.8343	K	D	303	320
PSM	VAASGAQDPEKSPDR	852	sp|Q1MSJ5-2|CSPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=1030	7.6773	2	1606.6988	1606.6988	R	L	119	134
PSM	VDEEPTTLPSGEAKPR	853	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=7991	38.46	2	1804.8244	1804.8244	R	K	305	321
PSM	VDSTTCLFPVEEK	854	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=17722	85.181	2	1603.6841	1603.6841	R	A	241	254
PSM	VEMYSGSDDDDDFNKLPK	855	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=13662	63.897	2	2169.845	2169.8450	K	K	131	149
PSM	VLNNMEIGTSLFDEEGAK	856	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:35	ms_run[2]:scan=18710	91.326	2	1981.9303	1981.9303	K	I	219	237
PSM	VNSNSLDLPSSSDTTHASK	857	sp|Q8NEY1-5|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=9385	44.558	3	2038.8845	2038.8845	K	V	413	432
PSM	VNVDEVGGEALGR	858	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12807	59.902	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	859	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13039	60.929	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	860	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13255	61.936	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	861	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13467	62.95	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	862	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13754	64.355	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	863	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13971	65.357	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	864	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17449	83.633	2	1313.6575	1313.6575	K	L	19	32
PSM	VSTHSQEMDSGTEYGMGSSTK	865	sp|Q9UKE5-8|TNIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,8-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=2338	13.639	2	2329.8716	2329.8716	R	A	858	879
PSM	VSVVSPDHVSDSTVSAR	866	sp|Q6NV74|K121L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=10714	50.518	2	1820.8306	1820.8306	K	I	181	198
PSM	VVDALGNAIDGK	867	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12570	58.754	2	1170.6245	1170.6245	R	G	150	162
PSM	VVHASGDASYSAGDSGDAAAQPAFTGIK	868	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=14634	68.577	3	2729.197	2729.1970	R	G	641	669
PSM	VVVDGSGQCHSTDTVK	869	sp|Q9HAU4|SMUF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3600	19.359	2	1767.7499	1767.7499	K	N	39	55
PSM	YVMLPVADQDQCIR	870	sp|P00738-2|HPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15363	72.195	2	1722.8069	1722.8069	K	H	239	253
PSM	QLHEYETELEDER	871	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28	ms_run[1]:scan=17369	83.19135333333334	2	1672.7252	1672.7211	R	K	1597	1610
PSM	QRGSETGSETHESDLAPSDK	872	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5244	26.379105	3	2192.8861	2192.8854	R	E	1103	1123
PSM	VQVAALQASPPLDQDDR	873	sp|Q9UDY2|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15333	72.05422666666668	2	1821.926435	1821.922091	K	A	122	139
PSM	AASDTERDGLAPEKTSPDR	874	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=6482	31.786393333333336	3	2136.9330	2136.9319	M	D	2	21
PSM	QQIAEDPELTHSSSNK	875	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=10608	50.043398333333336	2	1845.7824	1845.7777	K	I	175	191
PSM	SLIIDEGEDDLGR	876	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=16318	77.11423166666667	2	1431.692415	1430.688903	R	G	197	210
PSM	QPSPSHDGSLSPLQDR	877	sp|Q96A00|PP14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=13238	61.856231666666666	2	1782.7581	1782.7569	R	A	126	142
PSM	KGSSTDISEDWEK	878	sp|Q9NW68|BSDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=10363	48.961715000000005	2	1562.6572	1560.6342	K	D	385	398
PSM	KGSITEYTAAEEK	879	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=8067	38.785848333333334	2	1507.668107	1505.665071	R	E	112	125
PSM	GSGHPAYAEVEPVGEK	880	sp|Q6UX71|PXDC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:21	ms_run[1]:scan=9226	43.89692	2	1707.750368	1705.734881	R	E	505	521
PSM	TTKSPSDSGYSYETIGK	881	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=9965	47.24379666666667	2	1899.820360	1899.813920	R	T	1912	1929
PSM	EIQNGNLHESDSESVPR	882	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=9788	46.433155	2	1990.833257	1989.842928	K	D	66	83
PSM	VKVEAPSSSPAPAPSPVLQR	883	sp|O43151|TET3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=15137	71.09751333333332	2	2176.015038	2176.033052	K	E	490	510
PSM	LPTFLFMKRPGPDSSPAR	884	sp|P30926|ACHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=15137	71.09751333333332	2	2177.012580	2175.994164	K	A	341	359
PSM	PSEEAPKCSQDQGVLASELAQNK	885	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=14357	67.20917333333333	3	2566.151541	2565.141813	K	E	120	143
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	886	sp|Q9BTA9|WAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=5733	28.41818	3	2845.230121	2844.242407	R	S	523	551
PSM	AALEDTLAETEAR	887	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13770	64.432	2	1388.6783	1388.6783	K	F	318	331
PSM	ADGATSDDLDLHDDR	888	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=8195	39.331	2	1694.6421	1694.6421	K	L	805	820
PSM	ADLINNLGTIAK	889	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17823	85.783	2	1241.698	1241.6980	K	S	101	113
PSM	AEAAAAPTVAPGPAQPGHVSPTPATTSPGEK	890	sp|Q9Y6R0|NUMBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	26-UNIMOD:21	ms_run[2]:scan=10680	50.368	3	2944.3968	2944.3968	K	G	244	275
PSM	AEEEHLSSSGGLAK	891	sp|Q52LW3-2|RHG29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=5133	25.921	2	1493.6399	1493.6399	R	N	349	363
PSM	AGAGSATLSMAYAGAR	892	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35	ms_run[2]:scan=9599	45.486	2	1469.6933	1469.6933	K	F	242	258
PSM	AGTQIENIDEDFR	893	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16231	76.688	2	1506.6951	1506.6951	K	D	67	80
PSM	AGTQIENIEEDFR	894	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18668	91.064	2	1520.7107	1520.7107	K	D	48	61
PSM	AHTSSTQLQEELEK	895	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=10790	50.848	2	1679.7404	1679.7404	R	V	891	905
PSM	ALDIYSAVDDASHEK	896	sp|Q16568|CART_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=15303	71.898	2	1712.7295	1712.7295	R	E	37	52
PSM	ALPSEDEEGQDDKDFYLR	897	sp|Q8NF91-4|SYNE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=15817	74.514	2	2205.9103	2205.9103	R	G	8231	8249
PSM	ALQPLEEGEDEEK	898	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9610	45.539	2	1485.6835	1485.6835	R	V	336	349
PSM	AMVSPFHSPPSTPSSPGVR	899	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,8-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12959	60.576	3	2112.8741	2112.8741	K	S	113	132
PSM	ASDTCLDVIGGRDTPGAK	900	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=12043	56.393	2	1911.8398	1911.8398	K	V	2889	2907
PSM	ASPDQNASTHTPQSSVK	901	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=1185	8.3089	2	1833.7894	1833.7894	K	T	298	315
PSM	ASSEDTLNKPGSTAASGVVR	902	sp|Q5M775-2|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=8455	40.492	2	2025.9368	2025.9368	R	L	53	73
PSM	ASSHSSQTQGGGSVTK	903	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=473	4.8776	2	1597.6733	1597.6733	R	K	402	418
PSM	AVEFSSGAKSPSK	904	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=3544	19.112	2	1373.6228	1373.6228	K	S	1250	1263
PSM	CTLPEHESPSQDISDACEAESTER	905	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13801	64.563	3	2827.095	2827.0950	R	C	670	694
PSM	DDGTGQLLLPLSDAR	906	sp|Q15149-6|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19975	100.07	2	1569.7999	1569.7999	R	K	3871	3886
PSM	DEASEQSDEEDSVQSLHGVR	907	sp|Q6WN34|CRDL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=11465	53.871	2	2295.9129	2295.9129	K	H	176	196
PSM	DGEQPQILLEDSSAGEDSVHDR	908	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=15762	74.215	3	2476.0391	2476.0391	K	F	43	65
PSM	DGKSPTVPCLQEEAGEPLGGK	909	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=15618	73.481	3	2248.0083	2248.0083	R	G	492	513
PSM	DKEVSDDEAEEK	910	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=841	6.8658	2	1472.5556	1472.5556	R	E	227	239
PSM	DMESPTKLDVTLAK	911	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=13370	62.459	2	1642.7525	1642.7525	K	D	277	291
PSM	DNVESAQASEVKPLR	912	sp|Q12864|CAD17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=8626	41.238	2	1721.7985	1721.7985	K	S	817	832
PSM	DSHSSEEDEASSQTDLSQTISK	913	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=9502	45.063	3	2459.9813	2459.9813	R	K	153	175
PSM	DSSGQHVDVSPTSQR	914	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=3290	17.979	2	1678.6948	1678.6948	K	L	550	565
PSM	DVPPDILLDSPERK	915	sp|Q6KC79|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=16669	79.164	2	1672.8073	1672.8073	R	Q	309	323
PSM	EDALDDSVSSSSVHASPLASSPVR	916	sp|Q7Z3J3|RGPD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=16005	75.5	3	2492.1068	2492.1068	R	K	1256	1280
PSM	EERSPQTLAPVGEDAMK	917	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=8107	38.955	2	1952.8551	1952.8551	K	T	1240	1257
PSM	EIENLTQQYEEK	918	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11777	55.211	2	1522.7151	1522.7151	K	A	1400	1412
PSM	EIIDASDKEGMSPAK	919	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4778	24.51	2	1685.7219	1685.7219	K	R	82	97
PSM	EKEEVAEEAQSGGD	920	sp|O76070|SYUG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2111	12.518	2	1476.6216	1476.6216	K	-	114	128
PSM	EKEISDDEAEEEK	921	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=2596	14.799	2	1629.6295	1629.6295	R	G	222	235
PSM	ELSLAGNELGDEGAR	922	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14594	68.387	2	1529.7322	1529.7322	K	L	288	303
PSM	ETPHSPGVEDAPIAK	923	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=7726	37.339	2	1626.7291	1626.7291	R	V	184	199
PSM	EVQDLFEAQGNDR	924	sp|Q9H3U1-3|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14017	65.575	2	1519.6903	1519.6903	K	L	85	98
PSM	FAMEPEEFDSDTLR	925	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35	ms_run[2]:scan=15591	73.348	2	1701.7192	1701.7192	K	E	486	500
PSM	FGDLDEQEFVYK	926	sp|Q8NF50-4|DOCK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18254	88.409	2	1488.6773	1488.6773	K	E	1704	1716
PSM	FGESEEVEMEVESDEEDDKQEK	927	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=13552	63.347	3	2712.0157	2712.0157	K	A	252	274
PSM	FNADEFEDMVAEK	928	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:35	ms_run[2]:scan=16166	76.362	2	1559.645	1559.6450	K	R	176	189
PSM	GATAEGGETITEIKPK	929	sp|Q68DA7-3|FMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=10603	50.021	2	1680.7971	1680.7971	K	D	286	302
PSM	GEGPDVDVTLPK	930	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13975	65.377	2	1225.619	1225.6190	K	A	4331	4343
PSM	GGETPEGLATSVVHYGAGAK	931	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=18329	88.842	2	1979.899	1979.8990	R	E	735	755
PSM	GGSPIIQEPEEPSEHR	932	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=9463	44.894	2	1840.7993	1840.7993	R	E	3821	3837
PSM	GGVTGSPEASISGSKGDLK	933	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=9789	46.437	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GILAADESTGSIAK	934	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11391	53.534	2	1331.6933	1331.6933	K	R	29	43
PSM	GKDSLSDDGVDLK	935	sp|P07948-2|LYN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=9731	46.141	2	1427.6181	1427.6181	K	T	8	21
PSM	GNAEGSSDEEGKLVIDEPAK	936	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=11538	54.196	3	2123.926	2123.9260	K	E	120	140
PSM	GPATVEDLPSAFEEK	937	sp|O14908-2|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17784	85.555	2	1588.7621	1588.7621	R	A	152	167
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	938	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[2]:scan=16974	80.857	3	3813.4633	3813.4633	R	G	16	49
PSM	GSDALSETSSVSHIEDLEK	939	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=17431	83.546	2	2082.8994	2082.8994	R	V	622	641
PSM	GSKSEDSELPPQTASEAPSEGSR	940	sp|Q5TCZ1-2|SPD2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=7613	36.863	3	2425.0282	2425.0282	K	R	601	624
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	941	sp|Q53TN4-3|CYBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=9490	45.008	3	2741.0946	2741.0946	R	K	189	214
PSM	GTGSGGQLQDLDCSSSDDEGAAQNSTKPSATK	942	sp|P08240-2|SRPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=9999	47.395	3	3248.3413	3248.3413	R	G	255	287
PSM	GTSPRPPEGGLGYSQLGDDDLK	943	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=16000	75.473	3	2338.0478	2338.0478	R	E	122	144
PSM	GTSPRPPEGGLGYSQLGDDDLK	944	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=16275	76.919	3	2338.0478	2338.0478	R	E	122	144
PSM	GVVDSDDLPLNVSR	945	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=23798	132.14	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	946	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24498	138.43	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	947	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19084	93.765	2	1484.7471	1484.7471	K	E	435	449
PSM	HTSAEEEEPPPVK	948	sp|Q9BZ95-3|NSD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=3453	18.732	2	1528.6447	1528.6447	R	I	455	468
PSM	IEDVGSDEEDDSGKDK	949	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=2985	16.606	2	1816.6888	1816.6888	K	K	250	266
PSM	IEVDEGFCSPKPSEIK	950	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=14477	67.803	2	1913.8482	1913.8482	K	D	882	898
PSM	IISNASCTTNCLAPLAK	951	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=14224	66.593	2	1832.9125	1832.9125	K	V	104	121
PSM	IIYGGSVTGATCK	952	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=9009	42.903	2	1325.6649	1325.6649	R	E	244	257
PSM	IQALQQQADEAEDR	953	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8725	41.668	2	1613.7645	1613.7645	K	A	14	28
PSM	IQVLQQQADDAEER	954	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10283	48.611	3	1641.7958	1641.7958	K	A	14	28
PSM	KCSLPAEEDSVLEK	955	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10916	51.369	2	1683.7427	1683.7427	K	L	634	648
PSM	KGSSTDISEDWEK	956	sp|Q9NW68-9|BSDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=10342	48.873	2	1560.6345	1560.6345	K	D	290	303
PSM	KQSTDEEVTSLAK	957	sp|P23193-2|TCEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7975	38.398	2	1514.6865	1514.6865	R	S	34	47
PSM	KSGSQDFPQCNTIENTGTK	958	sp|P28290-2|ITPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=9824	46.597	3	2190.9253	2190.9253	R	Q	437	456
PSM	KTLDELSQGTTTVK	959	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=9468	44.917	2	1599.7757	1599.7757	R	E	1542	1556
PSM	LAQAEEQLEQETR	960	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10631	50.144	2	1543.7478	1543.7478	K	E	1840	1853
PSM	LDSSACLHAVGDK	961	sp|O94808|GFPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=7179	34.784	2	1451.6116	1451.6116	R	A	242	255
PSM	LEASDCDHQQNSPTLER	962	sp|Q9HAN9|NMNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5251	26.404	2	2078.8365	2078.8365	K	P	106	123
PSM	LEGLTDEINFLR	963	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=22077	117.11	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEGPVSPDVEPGKEETEESK	964	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=10720	50.544	3	2234.9832	2234.9832	K	K	1666	1686
PSM	LFESSENIEDSNNPK	965	sp|P34910|EVI2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10626	50.121	2	1721.7744	1721.7744	K	T	291	306
PSM	LKFSDDEEEEEVVK	966	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=14009	65.537	3	1774.755	1774.7550	K	D	385	399
PSM	LKSEDGVEGDLGETQSR	967	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=8788	41.954	3	1898.8259	1898.8259	R	T	133	150
PSM	LPSSETHPEESMYK	968	sp|Q8TBP0-3|TBC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5885	29.169	2	1729.6906	1729.6906	K	R	19	33
PSM	LQAALDDEEAGGR	969	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7253	35.12	2	1343.6317	1343.6317	R	P	38	51
PSM	LQSIGTENTEENR	970	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5049	25.604	2	1489.7009	1489.7009	R	R	44	57
PSM	MDDDSYSHHSGLEYADPEK	971	sp|P51636-2|CAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=10121	47.897	3	2370.8025	2370.8025	-	F	1	20
PSM	MDTIDQDDELIR	972	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=12979	60.663	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MKSVGDDEELQQNESGTSPK	973	sp|P15822|ZEP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=5593	27.854	3	2273.9359	2273.9359	K	S	1034	1054
PSM	NFQLEEEEQNEAK	974	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10789	50.845	2	1606.7111	1606.7111	K	L	168	181
PSM	NSGVNYLILDDDDR	975	sp|O75815-2|BCAR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17946	86.483	2	1607.7427	1607.7427	R	E	146	160
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	976	sp|Q96FS4|SIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:21	ms_run[2]:scan=11421	53.668	3	2720.1814	2720.1814	K	G	866	892
PSM	QENSNACHEMDDIAVPQEALSSSPR	977	sp|Q13342-2|SP140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,10-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=13755	64.358	3	2880.1692	2880.1692	K	C	163	188
PSM	QNCELFEQLGEYK	978	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=19540	96.924	2	1656.7454	1656.7454	K	F	414	427
PSM	RDSDGVDGFEAEGK	979	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7782	37.593	2	1560.6093	1560.6093	R	K	1052	1066
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEER	980	sp|P13807-2|GYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=16253	76.799	3	3071.3932	3071.3932	K	N	644	673
PSM	SASQSSLDKLDQELK	981	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=14298	66.955	2	1727.7979	1727.7979	R	E	714	729
PSM	SDLVNEEATGQFR	982	sp|P06731-2|CEAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12457	58.256	2	1464.6845	1464.6845	K	V	127	140
PSM	SDPYHATSGALSPAK	983	sp|P17302|CXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=7008	34.059	2	1580.6872	1580.6872	K	D	244	259
PSM	SEAPAEVTHFSPK	984	sp|Q6PID6|TTC33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=9867	46.783	2	1478.6443	1478.6443	K	S	187	200
PSM	SEHPESSLSSEEETAGVENVK	985	sp|Q92932-2|PTPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=11540	54.203	3	2323.9693	2323.9693	K	S	428	449
PSM	SESQESLVTSPSKPK	986	sp|Q76L83|ASXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=5224	26.299	2	1682.7764	1682.7764	K	S	515	530
PSM	SESQKEDPFNIAEPR	987	sp|Q9Y2X9-2|ZN281_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=15604	73.413	2	1825.7884	1825.7884	K	V	582	597
PSM	SGELEQEEERLSK	988	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=8992	42.837	2	1612.6982	1612.6982	K	E	322	335
PSM	SGPPAPEEEEEEER	989	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4866	24.875	2	1583.6587	1583.6587	K	Q	1319	1333
PSM	SHSDPGITTSSDTADFR	990	sp|P81408-2|F189B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=10345	48.884	2	1872.7527	1872.7527	R	D	395	412
PSM	SKSTAALSGEAASCSPIIMPYK	991	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,14-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=15671	73.758	3	2364.0742	2364.0743	R	A	94	116
PSM	SLQATESELRASQEK	992	sp|Q5TZA2-2|CROCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=8652	41.338	2	1755.804	1755.8040	R	I	911	926
PSM	SLSKSDSDLLTCSPTEDATMGSR	993	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14775	69.278	3	2553.0612	2553.0612	R	S	622	645
PSM	SMVDASEEKTPEQIMQEK	994	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=6065	29.927	3	2190.9062	2190.9062	K	Q	59	77
PSM	SNSVEKPVSSILSR	995	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=14474	67.787	3	1581.7764	1581.7764	R	T	329	343
PSM	SPTSDDISLLHESQSDR	996	sp|Q9Y3C5|RNF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=13576	63.456	2	1965.8317	1965.8317	K	A	7	24
PSM	SRVAPAEPQEAPDSTAAGGSASK	997	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=5399	27.063	3	2263.0118	2263.0118	R	R	350	373
PSM	STPSHGSVSSLNSTGSLSPK	998	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=9754	46.256	2	2008.9103	2008.9103	R	H	238	258
PSM	SVAPASPPPPDGPLAHR	999	sp|Q2M2I3|FA83E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10307	48.715	2	1824.7961	1824.7961	R	L	319	336
PSM	TASRPDDIPDSPSSPK	1000	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=7322	35.424	2	1748.7618	1748.7618	R	V	1233	1249
PSM	TGLFQTSKEDELSESK	1001	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=14734	69.088	2	1877.8296	1877.8296	R	E	44	60
PSM	TIQEVLEEQSEDEDR	1002	sp|P18858-2|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16023	75.593	2	1818.8119	1818.8119	R	E	132	147
PSM	TLSDPPSPLPHGPPNK	1003	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=13028	60.882	2	1812.7849	1812.7849	R	G	837	853
PSM	TNSPDLDTQSLSHSSGTDR	1004	sp|Q6H8Q1-4|ABLM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=8784	41.934	2	2096.8648	2096.8648	R	D	209	228
PSM	TQEISRPNSPSEGEGESSDSR	1005	sp|Q9P2R6-2|RERE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=4029	21.242	3	2327.9503	2327.9503	K	S	117	138
PSM	TSSKESSPIPSPTSDR	1006	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=7445	36.062	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TTAAHSLVGTPYYMSPER	1007	sp|Q8TDX7|NEK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12718	59.444	2	2075.9024	2075.9024	K	I	190	208
PSM	TTSREEVDEAASTLTR	1008	sp|Q9UKT5-2|FBX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=13321	62.24	2	1844.8153	1844.8153	R	L	46	62
PSM	VADAKGDSESEEDEDLEVPVPSR	1009	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=14095	65.964	3	2552.0803	2552.0803	R	F	71	94
PSM	VASVFANADKGDDEK	1010	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=10625	50.118	2	1644.7032	1644.7032	R	N	1097	1112
PSM	VEEEDGKTATQPLLK	1011	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=8522	40.804	2	1736.8234	1736.8234	K	K	977	992
PSM	VEPGLGADNSVVR	1012	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10020	47.475	2	1311.6783	1311.6783	K	F	1020	1033
PSM	VIENADGSEEETDTR	1013	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=3810	20.298	2	1743.6836	1743.6836	R	D	1947	1962
PSM	VKEPSVQEATSTSDILK	1014	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=14311	67.014	3	1910.9238	1910.9238	K	V	230	247
PSM	VNVDEVGGEALGR	1015	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14179	66.368	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1016	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14600	68.419	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1017	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17091	81.511	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVEDAGGETLGR	1018	sp|P69892|HBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9413	44.677	2	1315.6368	1315.6368	K	L	19	32
PSM	VVESLDVGQDR	1019	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9095	43.316	2	1215.6095	1215.6095	R	V	447	458
PSM	YAGVFAENAEDADGK	1020	sp|Q96EU7|C1GLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11787	55.253	2	1555.6791	1555.6791	K	D	229	244
PSM	YEELFPAFSDSR	1021	sp|P54920|SNAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20177	101.58	2	1459.662	1459.6620	K	E	228	240
PSM	YELQQLEGSSDR	1022	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12696	59.351	2	1423.6579	1423.6579	K	I	323	335
PSM	YICENQDSISSK	1023	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=5456	27.295	2	1442.6348	1442.6348	K	L	287	299
PSM	YLAEVAAGDDKK	1024	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=4544	23.547	2	1358.6119	1358.6119	R	G	128	140
PSM	YNILGTNTIMDK	1025	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35	ms_run[2]:scan=15096	70.892	2	1397.6861	1397.6861	K	M	506	518
PSM	YQSSPAKPDSSFYK	1026	sp|P02730-2|B3AT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=9319	44.294	2	1683.7182	1683.7182	R	G	282	296
PSM	YSGAYGASVSDEELKR	1027	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=11360	53.402	2	1810.7775	1810.7775	R	R	49	65
PSM	YYRPTEVDFLQGDCTK	1028	sp|O60547-2|GMDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17281	82.631	2	2070.8758	2070.8758	K	A	293	309
PSM	ETNLDSLPLVDTHSK	1029	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:27,6-UNIMOD:21	ms_run[1]:scan=19701	98.04756166666667	2	1729.7960	1729.7919	R	R	425	440
PSM	GYGYGQGAGTLSTDK	1030	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=8713	41.606341666666665	2	1473.686839	1473.673587	K	G	70	85
PSM	QLEYQQLEDDKLSQK	1031	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,13-UNIMOD:21	ms_run[1]:scan=17004	81.02533833333332	2	1926.8664	1926.8607	K	S	76	91
PSM	VNVDEVGGEALGR	1032	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=15745	74.135565	2	1314.665680	1313.657543	K	L	19	32
PSM	ILDSVGIEADDDR	1033	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12412	58.057435	2	1416.676176	1416.673253	K	L	26	39
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1034	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=5781	28.63929166666667	3	3007.3392	3007.3292	K	S	145	174
PSM	EGEEPTKGNSGSEACTSSFLR	1035	sp|Q9H2Y7|ZN106_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11622	54.557095	3	2323.971799	2321.947136	K	L	1293	1314
PSM	ETPHSPGVEDAPIAK	1036	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:27,5-UNIMOD:21	ms_run[1]:scan=10107	47.836954999999996	2	1608.7216	1608.7180	R	V	486	501
PSM	ETPHSPGVEDAPIAK	1037	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=8898	42.402235	2	1626.732069	1626.729068	R	V	486	501
PSM	DSPSKSSAEAQTPEDTPNK	1038	sp|O43493|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1893	11.45348	2	2068.871938	2067.863389	K	S	65	84
PSM	TPAFAESVTEGDVR	1039	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13712	64.1647	2	1477.705854	1477.704888	K	W	75	89
PSM	ISLNSLCYGDMDK	1040	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=15821	74.53349666666666	2	1531.672715	1530.669431	K	T	196	209
PSM	LDETDDPDDYGDR	1041	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=6625	32.40889666666667	2	1524.585154	1524.585226	R	E	401	414
PSM	SSDAKPLPASYPAEPR	1042	sp|Q9P266|JCAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=9745	46.20937166666667	3	1765.816162	1764.808381	R	E	982	998
PSM	YGLQDSDEEEEEHPSK	1043	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=7557	36.60685833333333	2	1971.737103	1970.741877	K	T	883	899
PSM	EIQNGNLHESDSESVPR	1044	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=9101	43.343138333333336	2	1990.833063	1989.842928	K	D	66	83
PSM	LYPIANGNNQSPVDIK	1045	sp|P00915|CAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=16302	77.05031666666666	2	1742.887807	1741.899899	K	T	20	36
PSM	NLTSSSLNDISDKPEK	1046	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=11358	53.394508333333334	2	1827.819507	1826.829904	R	D	252	268
PSM	EIQNGNLHESDSESVPR	1047	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=8544	40.89615666666666	2	1990.835757	1989.842928	K	D	66	83
PSM	MTILTYPFKNLPTASK	1048	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,2-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=15923	75.06691833333333	3	2082.901675	2079.879451	-	W	1	17
PSM	GIPSTSVPTLESAAAITTK	1049	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=8285	39.73601666666667	2	2164.857649	2162.859183	R	T	299	318