MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	50.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	830-UNIMOD:21,832-UNIMOD:21	0.03	47.0	16	2	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	145-UNIMOD:28,164-UNIMOD:21,160-UNIMOD:21,171-UNIMOD:21	0.07	47.0	5	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	366-UNIMOD:21	0.05	45.0	3	1	0
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	34-UNIMOD:21	0.09	45.0	2	1	0
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	154-UNIMOD:21	0.07	44.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1243-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	44.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	16-UNIMOD:21	0.03	43.0	2	1	0
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	184-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	126-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	267-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	532-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.10	42.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1314-UNIMOD:21,1316-UNIMOD:4,390-UNIMOD:21	0.03	41.0	3	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q93073-2|SBP2L_HUMAN	Isoform 2 of Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	254-UNIMOD:21,275-UNIMOD:4	0.03	41.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	470-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q8N5H7-3|SH2D3_HUMAN	Isoform 3 of SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	86-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	859-UNIMOD:21	0.03	41.0	3	1	0
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.09	40.0	6	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	305-UNIMOD:35,217-UNIMOD:4,227-UNIMOD:35	0.12	40.0	2	2	2
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	86-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	112-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	314-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	72-UNIMOD:21	0.22	40.0	1	1	1
PRT	sp|Q9Y4F5-3|C170B_HUMAN	Isoform 3 of Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	585-UNIMOD:21,759-UNIMOD:21	0.03	40.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	928-UNIMOD:21,939-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.14	39.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	461-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9NRH2|SNRK_HUMAN	SNF-related serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SNRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	569-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	66-UNIMOD:21	0.06	39.0	3	1	0
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	207-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	324-UNIMOD:21,319-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q9UMS6-5|SYNP2_HUMAN	Isoform 5 of Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	206-UNIMOD:21,209-UNIMOD:21	0.03	39.0	3	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	345-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	496-UNIMOD:28,498-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9BV36-3|MELPH_HUMAN	Isoform 3 of Melanophilin OS=Homo sapiens OX=9606 GN=MLPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	214-UNIMOD:4,226-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	652-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	304-UNIMOD:4,305-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9P206-3|K1522_HUMAN	Isoform 3 of Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	982-UNIMOD:21,990-UNIMOD:21	0.02	38.0	4	1	0
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	358-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	88-UNIMOD:21	0.09	38.0	2	1	0
PRT	sp|Q7Z309-4|F122B_HUMAN	Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:21,134-UNIMOD:21	0.07	38.0	2	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	38.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1016-UNIMOD:21,1023-UNIMOD:35,1032-UNIMOD:35	0.02	38.0	1	1	1
PRT	sp|Q70CQ2-3|UBP34_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	3124-UNIMOD:21,3134-UNIMOD:4,3138-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|Q9Y2H2-4|SAC2_HUMAN	Isoform 4 of Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens OX=9606 GN=INPP5F	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	295-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	87-UNIMOD:4	0.17	38.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	264-UNIMOD:28	0.04	38.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	817-UNIMOD:21	0.01	38.0	1	1	0
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	206-UNIMOD:28,224-UNIMOD:21	0.01	38.0	3	1	0
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	128-UNIMOD:28	0.13	38.0	1	1	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	251-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1261-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q96D71-4|REPS1_HUMAN	Isoform 4 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	118-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	304-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	218-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P09493-9|TPM1_HUMAN	Isoform 9 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	138-UNIMOD:21	0.13	37.0	1	1	1
PRT	sp|Q13557-8|KCC2D_HUMAN	Isoform Delta 6 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	330-UNIMOD:21	0.05	37.0	2	1	0
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	199-UNIMOD:21	0.11	37.0	2	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1153-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	121-UNIMOD:21,133-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	448-UNIMOD:21	0.03	37.0	2	1	0
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	516-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	623-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9Y2I9-3|TBC30_HUMAN	Isoform 3 of TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	581-UNIMOD:21,585-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	299-UNIMOD:21,308-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q6UXM1-2|LRIG3_HUMAN	Isoform 2 of Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens OX=9606 GN=LRIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1013-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9NSI8|SAMN1_HUMAN	SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	90-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	346-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q08426-2|ECHP_HUMAN	Isoform 2 of Peroxisomal bifunctional enzyme OS=Homo sapiens OX=9606 GN=EHHADH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	452-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9BRP0-2|OVOL2_HUMAN	Isoform 2 of Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	137-UNIMOD:21	0.13	36.0	1	1	1
PRT	sp|O14558|HSPB6_HUMAN	Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	16-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	134-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	805-UNIMOD:21	0.01	36.0	1	1	0
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	874-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O43294|TGFI1_HUMAN	Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	192-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q9UDW1|QCR9_HUMAN	Cytochrome b-c1 complex subunit 9 OS=Homo sapiens OX=9606 GN=UQCR10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.29	35.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	518-UNIMOD:21,527-UNIMOD:21	0.03	35.0	3	1	0
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	16-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1644-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	594-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	567-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	83-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	310-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	28-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	168-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q99788-2|CML1_HUMAN	Isoform B of Chemokine-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	347-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P02671|FIBA_HUMAN	Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	603-UNIMOD:35,609-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9Y6R1-4|S4A4_HUMAN	Isoform 4 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	257-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1257-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1278-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	405-UNIMOD:21,419-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	812-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	180-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	525-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	197-UNIMOD:28,215-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P55287|CAD11_HUMAN	Cadherin-11 OS=Homo sapiens OX=9606 GN=CDH11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	714-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q2WGJ9|FR1L6_HUMAN	Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FER1L6 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	27-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	289-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	888-UNIMOD:35,895-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	136-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.12	34.0	1	1	1
PRT	sp|O95684-2|FR1OP_HUMAN	Isoform 2 of FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	160-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|P01008|ANT3_HUMAN	Antithrombin-III OS=Homo sapiens OX=9606 GN=SERPINC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	68-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	131-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	458-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	135-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|Q9C004|SPY4_HUMAN	Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	115-UNIMOD:35,125-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	211-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	163-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q86UZ6|ZBT46_HUMAN	Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	176-UNIMOD:21,189-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	285-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1050-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1160-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q6ZS30-1|NBEL1_HUMAN	Isoform 1 of Neurobeachin-like protein 1 OS=Homo sapiens OX=9606 GN=NBEAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	721-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	385-UNIMOD:21	0.05	34.0	1	1	0
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2145-UNIMOD:21,2153-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	281-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1826-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	107-UNIMOD:28,109-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q96IG2|FXL20_HUMAN	F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	417-UNIMOD:21	0.04	34.0	1	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	565-UNIMOD:4	0.02	34.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15856	89.76643666666666	3	3442.4017	3442.4027	K	L	104	135
PSM	STAQQELDGKPASPTPVIVASHTANK	2	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	13-UNIMOD:21	ms_run[2]:scan=9858	54.14	3	2726.3276	2726.3276	R	E	818	844
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	3	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=5835	33.394555	3	3007.3313	3007.3290	K	S	145	174
PSM	FASDDEHDEHDENGATGPVK	4	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=4342	25.781	2	2248.8546	2248.8546	K	R	364	384
PSM	KTDTVVESSVSGDHSGTLR	5	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21	ms_run[2]:scan=6728	38.103	2	2053.9317	2053.9317	R	R	33	52
PSM	GLRDSHSSEEDEASSQTDLSQTISK	6	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=9281	51.17	3	2786.188	2786.1880	R	K	150	175
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	7	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	24-UNIMOD:21	ms_run[2]:scan=9072	50.13	3	2868.339	2868.3390	R	S	1220	1248
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	8	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6090	34.76414833333333	3	3007.3318	3007.3290	K	S	145	174
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	9	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13319	73.247	3	3072.3942	3072.3933	R	T	553	583
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	10	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=3458	21.157	2	2540.1908	2540.1908	R	E	7	32
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	11	sp|Q69YN4-4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=13943	77.07	3	2842.2698	2842.2698	R	E	181	208
PSM	GQVGGQVSVEVDSAPGTDLAK	12	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12590	69.01	2	2013.0015	2013.0015	R	I	227	248
PSM	KGNAEGSSDEEGKLVIDEPAK	13	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=8458	47.049	2	2252.021	2252.0210	K	E	119	140
PSM	RSSEEVDGQHPAQEEVPESPQTSGPEAENR	14	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:21	ms_run[2]:scan=7670	42.911	3	3355.4226	3355.4226	R	C	266	296
PSM	AQGEPVAGHESPKIPYEK	15	sp|O94979-7|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=8111	45.209	2	2015.9354	2015.9354	R	Q	522	540
PSM	KPEDVLDDDDAGSAPLK	16	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10066	55.197	2	1783.8476	1783.8476	R	S	141	158
PSM	STAQQELDGKPASPTPVIVASHTANK	17	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=10418	57.166	3	2726.3276	2726.3276	R	E	818	844
PSM	YKLDEDEDEDDADLSK	18	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8320	46.301	2	1898.7905	1898.7905	K	Y	167	183
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	19	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6279	35.78075833333333	3	3007.3318	3007.3290	K	S	145	174
PSM	HLGGSGSVVPGSPCLDR	20	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=10644	58.318	2	1773.7869	1773.7869	R	H	1303	1320
PSM	IQEIIEQLDVTTSEYEK	21	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18383	109.01	2	2037.0154	2037.0154	R	E	371	388
PSM	RASHPTAESSSEQGASEADIDSDSGYCSPK	22	sp|Q93073-2|SBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=7534	42.265	3	3205.2779	3205.2779	R	H	249	279
PSM	THSAASSSQGASVNPEPLHSSLDK	23	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=7894	44.094	3	2486.1075	2486.1075	K	L	468	492
PSM	VHAAPAAPSATALPASPVAR	24	sp|Q8N5H7-3|SH2D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=9544	52.519	2	1933.9775	1933.9775	R	R	71	91
PSM	STAQQELDGKPASPTPVIVASHTANK	25	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21	ms_run[1]:scan=9660	53.13415500000001	3	2727.331014	2726.327640	R	E	847	873
PSM	APEPHVEEDDDDELDSK	26	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6730	38.117	2	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	27	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6926	39.126	2	1938.7967	1938.7967	K	L	5	22
PSM	DLYANTVLSGGTTMYPGIADR	28	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:35	ms_run[2]:scan=16973	97.956	2	2230.0576	2230.0576	K	M	292	313
PSM	FTDKDQQPSGSEGEDDDAEAALKK	29	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=7370	41.399	3	2660.1127	2660.1127	K	E	78	102
PSM	HDYDDSSEEQSAEIR	30	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=4688	27.527	2	1779.7184	1779.7184	K	G	55	70
PSM	IHIDPEIQDGSPTTSR	31	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=10109	55.497	2	1844.8306	1844.8306	R	R	102	118
PSM	KDPEDTGAEKSPTTSADLK	32	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=3367	20.676	2	2068.9202	2068.9202	K	S	304	323
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIK	33	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=14026	77.595	3	2857.4627	2857.4627	K	K	69	99
PSM	PLGAAPQAEHQGLPVPGSPGGQK	34	sp|Q9Y4F5-3|C170B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:21	ms_run[2]:scan=11223	61.34	2	2272.1001	2272.1001	R	W	568	591
PSM	STAQQELDGKPASPTPVIVASHTANK	35	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=9798	53.86	2	2726.3276	2726.3276	R	E	818	844
PSM	TAFDEAIAELDTLSEESYK	36	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=23315	151.21	2	2130.9845	2130.9845	K	D	194	213
PSM	WAHDKFSGEEGEIEDDESGTENR	37	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=10947	59.954	3	2796.0226	2796.0226	K	E	922	945
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	38	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,27-UNIMOD:21	ms_run[1]:scan=6485	36.832505	3	3007.3317	3007.3290	K	S	145	174
PSM	ETDLLLDDSLVSIFGNR	39	sp|P30044-4|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23318	151.23	2	1905.9684	1905.9684	K	R	71	88
PSM	HLGGSGSVVPGSPCLDR	40	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=10446	57.312	2	1773.7869	1773.7869	R	H	1303	1320
PSM	KESKEEETSIDVAGK	41	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=3954	23.818	2	1728.7819	1728.7819	K	P	459	474
PSM	RDSSEGPPGSEGDGGGQSKPSNASGGVDK	42	sp|Q9NRH2|SNRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=2003	13.512	3	2795.1632	2795.1632	R	A	567	596
PSM	RDSSESQLASTESDKPTTGR	43	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=4171	24.915	2	2230.9703	2230.9703	R	V	64	84
PSM	RDSSESQLASTESDKPTTGR	44	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=4452	26.349	3	2230.9703	2230.9703	R	V	64	84
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	45	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=9256	51.069	3	2686.2501	2686.2501	R	R	207	233
PSM	STAQQELDGKPASPTPVIVASHTANK	46	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=11689	63.893	3	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	47	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=8508	47.309	2	1744.8298	1744.8298	R	L	319	336
PSM	TAKPFPGSVNQPATPFSPTR	48	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=13106	71.951	2	2179.0463	2179.0463	R	N	193	213
PSM	TAKPFPGSVNQPATPFSPTR	49	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=13273	72.96	2	2179.0463	2179.0463	R	N	193	213
PSM	THTDSSEKELEPEAAEEALENGPK	50	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=14235	78.849	3	2690.1596	2690.1596	K	E	340	364
PSM	STAQQELDGKPASPTPVIVASHTANK	51	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	13-UNIMOD:21	ms_run[1]:scan=11205	61.250075	3	2727.332282	2726.327640	R	E	847	873
PSM	QRSPSPAPAPAPAAAAGPPTR	52	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=7232	40.703415	2	2029.9746	2029.9730	R	K	496	517
PSM	AEGLEEADTGASGCHSHPEEQPTSISPSR	53	sp|Q9BV36-3|MELPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:4,26-UNIMOD:21	ms_run[2]:scan=7958	44.401	3	3115.2826	3115.2826	K	H	201	230
PSM	APEPHVEEDDDDELDSK	54	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6528	37.07	2	1938.7967	1938.7967	K	L	5	22
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	55	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=17050	98.553	3	3095.5805	3095.5805	R	A	642	673
PSM	GLQAQIASSGLTVEVDAPK	56	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16301	92.935	2	1883	1883.0000	K	S	223	242
PSM	GSRPPLILQSQSLPCSSPR	57	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=13897	76.76	2	2159.0558	2159.0558	K	D	290	309
PSM	KPSVGVPPPASPSYPR	58	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=9441	51.986	2	1714.8444	1714.8444	R	A	980	996
PSM	KTGSYGALAEITASK	59	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=13023	71.503	2	1575.7546	1575.7546	R	E	355	370
PSM	LCYVALDFEQEMATAASSSSLEK	60	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=18167	107.29	3	2565.1615	2565.1615	K	S	216	239
PSM	LFIGGLSFETTEESLR	61	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20381	125.62	2	1797.9149	1797.9149	K	N	11	27
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	62	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=4517	26.662	3	3024.3561	3024.3561	K	S	73	102
PSM	RIDFTPVSPAPSPTR	63	sp|Q7Z309-4|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=11933	65.274	2	1719.8345	1719.8345	K	G	127	142
PSM	RTSMGGTQQQFVEGVR	64	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7891	44.078	2	1875.8299	1875.8299	R	M	550	566
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	65	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,9-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=6575	37.348	3	3165.2289	3165.2289	K	D	1015	1044
PSM	RVSSDEEHTVDSCISDMK	66	sp|Q70CQ2-3|UBP34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=6895	38.953	2	2189.8606	2189.8606	R	T	3122	3140
PSM	SQSLSSTDSSVHAPSEITVAHGSGLGK	67	sp|Q9Y2H2-4|SAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11757	64.268	3	2718.2498	2718.2498	R	G	295	322
PSM	STAQQELDGKPASPTPVIVASHTANK	68	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=10059	55.153	3	2726.3276	2726.3276	R	E	818	844
PSM	VYACEVTHQGLSSPVTK	69	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=9293	51.218	2	1874.9196	1874.9196	K	S	84	101
PSM	QTAVLQQQVTVNTEELK	70	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=16451	94.05707333333332	2	1910.9952	1910.9944	R	G	264	281
PSM	SAPTAPTPPPPPPPATPR	71	sp|Q14202|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=8146	45.39264	2	1828.893562	1827.892051	R	K	811	829
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	72	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=12842	70.46546166666667	3	2971.4222	2971.4211	K	H	206	232
PSM	QATTIIADNIIFLSDQTK	73	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=23400	151.807785	2	1974.0321	1974.0304	R	E	128	146
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	74	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21	ms_run[1]:scan=7440	41.7888	3	3201.374285	3200.389524	K	E	247	279
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	75	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:21	ms_run[2]:scan=16172	91.974	3	3417.6031	3417.6031	R	E	1242	1275
PSM	HAASYSSDSENQGSYSGVIPPPPGR	76	sp|Q96D71-4|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=11383	62.206	3	2639.1289	2639.1289	R	G	112	137
PSM	HQEVQDQDPVFQGSDSSGYQSDHK	77	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:21	ms_run[2]:scan=7945	44.34	3	2797.1253	2797.1253	K	K	284	308
PSM	IYHLPDAESDEDEDFK	78	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=13978	77.289	2	2001.7881	2001.7881	K	E	210	226
PSM	KATDAEADVASLNR	79	sp|P09493-9|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7213	40.606	2	1459.7267	1459.7267	K	R	77	91
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	80	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=16096	91.424	3	3656.5163	3656.5163	K	E	120	152
PSM	KPDGVKESTESSNTTIEDEDVK	81	sp|Q13557-8|KCC2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=5745	32.909	3	2487.0902	2487.0902	K	A	323	345
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	82	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:21	ms_run[2]:scan=10570	57.93	3	3134.4962	3134.4962	K	R	178	209
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	83	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:21	ms_run[2]:scan=10762	58.95	3	3134.4962	3134.4962	K	R	178	209
PSM	PASPTPVIVASHTANK	84	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7298	41.045	2	1668.8236	1668.8236	K	E	828	844
PSM	PDERPSSPIPLLPPPK	85	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=13650	75.295	2	1818.9281	1818.9281	R	K	1147	1163
PSM	PGPPTPAAAHSIPYNSCR	86	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=9658	53.122	2	1971.8662	1971.8662	R	E	117	135
PSM	RAEDGSVIDYELIDQDAR	87	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15119	84.71	2	2063.976	2063.9760	R	D	197	215
PSM	RIDFTPVSPAPSPTR	88	sp|Q7Z309-4|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=11672	63.795	2	1719.8345	1719.8345	K	G	127	142
PSM	RVSEVEEEKEPVPQPLPSDDTR	89	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10504	57.609	3	2615.2116	2615.2116	R	V	446	468
PSM	SDSIRPALNSPVERPSSDQEEGETSAQTER	90	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=8981	49.662	3	3351.4852	3351.4852	R	V	507	537
PSM	SLRGSDALSETSSVSHIEDLEK	91	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=15011	84.051	3	2439.1166	2439.1166	R	V	619	641
PSM	STAQQELDGKPASPTPVIVASHTANK	92	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=9325	51.379	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	93	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=9469	52.128	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	94	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=10228	56.158	3	2726.3276	2726.3276	R	E	818	844
PSM	TAKPFPGSVNQPATPFSPTR	95	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=13436	73.979	2	2179.0463	2179.0463	R	N	193	213
PSM	TKSHPGCGDTVGLIDEQNEASK	96	sp|Q9Y2I9-3|TBC30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=8485	47.195	3	2422.0472	2422.0472	R	T	579	601
PSM	DKKSPLIESTANMDNNQSQK	97	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=3564	21.707816666666666	3	2344.035659	2343.041371	R	T	296	316
PSM	STAQQELDGKPASPTPVIVASHTANK	98	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=10807	59.20821333333333	3	2727.319908	2726.327640	R	E	847	873
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	99	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21	ms_run[1]:scan=3966	23.876091666666667	3	2541.181868	2540.190812	R	E	7	32
PSM	FASDDEHDEHDENGATGPVK	100	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=4467	26.415025	2	2249.844421	2248.854615	K	R	364	384
PSM	AHSSPDLDSGSEEDGKER	101	sp|Q6UXM1-2|LRIG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=2190	14.543	3	1994.7855	1994.7855	K	T	1011	1029
PSM	ALSEEKDEEDGENAHPYR	102	sp|Q9NSI8|SAMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5424	31.207	2	2167.8695	2167.8695	K	N	88	106
PSM	APEPHVEEDDDDELDSK	103	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5943	33.936	2	1938.7967	1938.7967	K	L	5	22
PSM	ILDSVGIEADDDRLNK	104	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12074	66.039	2	1771.8952	1771.8952	K	V	26	42
PSM	KATDGVTLTGINQTGDQSLPSKPSSVSSYEK	105	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	28-UNIMOD:21	ms_run[2]:scan=13659	75.344	3	3274.5606	3274.5606	K	T	319	350
PSM	KDASDDLDDLNFFNQK	106	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17506	102.06	2	1883.8537	1883.8537	K	K	64	80
PSM	KGQGLTGPTLLPGTPAR	107	sp|Q08426-2|ECHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=12449	68.187	2	1742.908	1742.9080	R	K	439	456
PSM	KPSVGVPPPASPSYPR	108	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=8987	49.688	2	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	109	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9236	50.976	2	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	110	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9634	52.988	2	1714.8444	1714.8444	R	A	980	996
PSM	LTSAHQENTSLSEEEERK	111	sp|Q9BRP0-2|OVOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=4149	24.796	3	2166.943	2166.9430	K	-	126	144
PSM	RASAPLPGLSAPGR	112	sp|O14558|HSPB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=10496	57.573	2	1428.7239	1428.7239	R	L	14	28
PSM	RASEEEENKASEEYIQR	113	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5660	32.447	3	2146.9168	2146.9168	R	L	132	149
PSM	SAPTAPTPPPPPPPATPR	114	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=8346	46.425	2	1827.892	1827.8921	R	K	799	817
PSM	SLSEEKEDHSDGLAGLK	115	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=8802	48.748	2	1893.8357	1893.8357	R	G	874	891
PSM	STAQQELDGKPASPTPVIVASHTANK	116	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=8916	49.322	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	117	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=12416	68.002	3	2726.3276	2726.3276	R	E	818	844
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	118	sp|O43294|TGFI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	23-UNIMOD:21	ms_run[1]:scan=10626	58.22266666666666	3	3273.538841	3272.535066	R	G	170	202
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	119	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13144	72.18751833333333	3	3072.3942	3072.3933	R	T	553	583
PSM	AFDQGADAIYDHINEGK	120	sp|Q9UDW1|QCR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14228	78.809	2	1862.8435	1862.8435	R	L	35	52
PSM	APEPHVEEDDDDELDSK	121	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6267	35.72	2	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	122	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6643	37.705	3	1938.7967	1938.7967	K	L	5	22
PSM	AVSPPHLDGPPSPR	123	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=9887	54.276	2	1505.7028	1505.7028	K	S	516	530
PSM	AVSPPHLDGPPSPR	124	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=10078	55.288	2	1505.7028	1505.7028	K	S	516	530
PSM	DKYEPAAVSEQGDKK	125	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=3029	18.852	2	1743.7717	1743.7717	R	G	8	23
PSM	ERPDLEAPAPGSPFR	126	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=12067	66.01	2	1717.7825	1717.7825	R	V	1633	1648
PSM	FTASAGIQVVGDDLTVTNPK	127	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17168	99.488	2	2032.0477	2032.0477	K	R	307	327
PSM	GNFGGSFAGSFGGAGGHAPGVAR	128	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=14866	83.11	2	2113.912	2113.9120	R	K	589	612
PSM	HGGPGPGGPEPELSPITEGSEAR	129	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=12144	66.409	3	2307.0169	2307.0169	R	A	554	577
PSM	IDASKNEEDEGHSNSSPR	130	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=707	6.4167	2	2050.8229	2050.8229	K	H	68	86
PSM	KASSEGGTAAGAGLDSLHK	131	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=6478	36.795	2	1835.8415	1835.8415	K	N	308	327
PSM	KPDGVKESTESSNTTIEDEDVK	132	sp|Q13557-8|KCC2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=5622	32.248	3	2487.0902	2487.0902	K	A	323	345
PSM	KYSEVDDSLPSGGEKPSK	133	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=7517	42.17	2	2001.8932	2001.8932	R	N	26	44
PSM	LAPITSDPTEATAVGAVEASFK	134	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19514	118.47	2	2174.1107	2174.1107	R	C	386	408
PSM	LEAELGNMQGLVEDFK	135	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:35	ms_run[2]:scan=16248	92.54	2	1807.8662	1807.8662	K	N	161	177
PSM	LPSVEEAEVPKPLPPASK	136	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=13433	73.958	2	1967.0017	1967.0017	R	D	62	80
PSM	LVNALSEDTGHSSYPSHR	137	sp|Q99788-2|CML1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=7821	43.752	2	2048.8953	2048.8953	R	S	332	350
PSM	MADEAGSEADHEGTHSTK	138	sp|P02671|FIBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=615	5.8962	2	1967.7204	1967.7204	K	R	603	621
PSM	NLTSSSLNDISDKPEK	139	sp|Q9Y6R1-4|S4A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=8894	49.206	2	1826.8299	1826.8299	R	D	252	268
PSM	PTLSATPNHVEHTLSVSSDSGNSTASTK	140	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=11502	62.857	3	2904.3138	2904.3138	R	T	387	415
PSM	RDSSESQLASTESDKPTTGR	141	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=4158	24.842	3	2230.9703	2230.9703	R	V	64	84
PSM	RPSVNGEPGSVPPPR	142	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=5600	32.152	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RSSLPLDHGSPAQENPESEK	143	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=7050	39.788	3	2257.0012	2257.0012	R	S	1276	1296
PSM	SKDHFGLEGDEESTMLEDSVSPK	144	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=14142	78.288	3	2632.0888	2632.0888	K	K	405	428
PSM	SPQPARPGSAAVPGAAFAPIPR	145	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=14728	82.117	2	2194.1048	2194.1048	R	S	804	826
PSM	STAQQELDGKPASPTPVIVASHTANK	146	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=9269	51.122	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	147	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=10030	54.996	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	148	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=10621	58.2	3	2726.3276	2726.3276	R	E	818	844
PSM	VKETQEDKLEGGAAK	149	sp|O43491-2|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=2334	15.269	2	1681.7924	1681.7924	K	R	177	192
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	150	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	23-UNIMOD:21	ms_run[2]:scan=6638	37.682	3	2664.2293	2664.2293	R	R	503	531
PSM	QQQLEEEAAKPPEPEKPVSPPPIESK	151	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13723	75.72674	3	2944.4107	2944.4102	K	H	197	223
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	152	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=12667	69.45959166666667	3	2972.4272	2971.4212	K	H	206	232
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	153	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=12497	68.45100166666667	3	2971.4222	2971.4211	K	H	206	232
PSM	PGLRPAPNSVDVDDFINTR	154	sp|P55287|CAD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=16930	97.65398666666667	3	2163.018970	2162.015748	R	I	706	725
PSM	AAKDSQGDTEALQEEPSHQEGPR	155	sp|Q2WGJ9|FR1L6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=5156	29.884	3	2559.0875	2559.0875	K	G	23	46
PSM	AEEQQLPPPLSPPSPSTPNHR	156	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=11967	65.454	3	2358.1005	2358.1005	K	R	279	300
PSM	AHFNAMFQPSSPTR	157	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=8783	48.642	2	1685.7021	1685.7021	R	R	883	897
PSM	AVSPPHLDGPPSPR	158	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=8991	49.708	2	1505.7028	1505.7028	K	S	516	530
PSM	AYLPVNESFGFTADLR	159	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19696	119.93	2	1798.889	1798.8890	K	S	786	802
PSM	DKSPVREPIDNLTPEER	160	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=10318	56.634	2	2073.9732	2073.9732	K	D	134	151
PSM	EAFSLFDKDGDGTITTK	161	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15231	85.401	2	1843.884	1843.8840	K	E	15	32
PSM	GPTTGEGALDLSDVHSPPKSPEGK	162	sp|O95684-2|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:21	ms_run[2]:scan=10751	58.888	3	2455.1268	2455.1268	K	T	141	165
PSM	KATEDEGSEQKIPEATNR	163	sp|P01008|ANT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=3344	20.559	2	2081.9267	2081.9267	K	R	61	79
PSM	KDVIELTDDSFDK	164	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13315	73.223	2	1523.7355	1523.7355	K	N	157	170
PSM	KPLAAPGDGEGLGQTAQPSPPAR	165	sp|Q9Y4F5-3|C170B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:21	ms_run[2]:scan=9286	51.187	2	2294.1056	2294.1056	R	D	741	764
PSM	KTDTVVESSVSGDHSGTLR	166	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=6669	37.829	3	2053.9317	2053.9317	R	R	33	52
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	167	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=15542	87.546	3	2948.4532	2948.4532	R	R	129	157
PSM	LKDEDDEDDCFILEK	168	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4	ms_run[2]:scan=12342	67.547	2	1882.8142	1882.8142	K	A	449	464
PSM	LKSEDGVEGDLGETQSR	169	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7875	44.006	2	1898.8259	1898.8259	R	T	133	150
PSM	LLDHMAPPPVADQASPR	170	sp|Q9C004|SPY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8350	46.444	2	1909.8757	1909.8757	R	A	111	128
PSM	LLKPGEEPSEYTDEEDTK	171	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=8643	47.977	2	2158.9195	2158.9195	R	D	200	218
PSM	NLSDSEKELYIQHAK	172	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=8821	48.842	2	1853.8561	1853.8561	K	E	159	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	173	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=4718	27.675	3	3024.3561	3024.3561	K	S	73	102
PSM	RTSPANSSGDSAIASCHDGGSSYGK	174	sp|Q86UZ6|ZBT46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4058	24.343	3	2548.0286	2548.0286	R	E	174	199
PSM	RVSEVEEEKEPVPQPLPSDDTR	175	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=10311	56.604	3	2615.2116	2615.2116	R	V	446	468
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	176	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7588	42.501	3	2455.0765	2455.0765	R	S	283	308
PSM	SKSFDYGNLSHAPVSGAAASTVSPSR	177	sp|P31629|ZEP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=12839	70.45	3	2672.2232	2672.2232	R	E	1048	1074
PSM	SLSVPAASTAKPPPLPR	178	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=13115	72.01	2	1767.9284	1767.9284	K	S	1160	1177
PSM	STAQQELDGKPASPTPVIVASHTANK	179	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=11872	64.925	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	180	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=11001	60.233	3	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	181	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=8719	48.33	2	1744.8298	1744.8298	R	L	319	336
PSM	TTTPPPSQIPDPPFSSPITPHR	182	sp|Q6ZS30-1|NBEL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=16051	91.111	3	2449.1679	2449.1679	R	T	719	741
PSM	VHAYFAPVTPPPSVGGSR	183	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=13805	76.214	2	1917.9138	1917.9138	K	Q	377	395
PSM	VHSPSGAVEECHVSELEPDK	184	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9455	52.053	3	2284.9671	2284.9671	K	Y	2143	2163
PSM	VPVCQPLKEEDDDEGPVDK	185	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=8686	48.176	3	2167.9943	2167.9943	K	S	278	297
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	186	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6696	37.95937166666667	3	3007.3314	3007.3290	K	S	145	174
PSM	SKTPVQAAAVSIVEKPVTR	187	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=12796	70.21323666666667	3	2061.106600	2060.103106	R	K	1824	1843
PSM	QASTDAGTAGALTPQHVR	188	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=9403	51.79573	2	1842.8240	1842.8256	R	A	107	125
PSM	VHAYFAPVTPPPSVGGSR	189	sp|Q96IG2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=13469	74.18303833333333	2	1918.918121	1917.913849	K	Q	409	427
PSM	FEEAAFTCEYKYDGQR	190	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:4	ms_run[1]:scan=12829	70.39300166666668	2	2013.857282	2012.857442	R	A	558	574
PSM	RPSVNGEPGSVPPPR	191	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=5793	33.16126166666666	2	1625.761794	1624.772270	R	A	1255	1270
PSM	FASDDEHDEHDENGATGPVK	192	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=4839	28.306683333333332	2	2249.839922	2248.854615	K	R	364	384