MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr13.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr13.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	484-UNIMOD:21	0.05	49.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	329-UNIMOD:21	0.03	47.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	758-UNIMOD:21	0.03	47.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	21-UNIMOD:21	0.04	46.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	45.0	1	1	1
PRT	sp|Q6UXY1-2|BI2L2_HUMAN	Isoform 2 of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	231-UNIMOD:21	0.04	44.0	2	1	0
PRT	sp|P13671|CO6_HUMAN	Complement component C6 OS=Homo sapiens OX=9606 GN=C6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	158-UNIMOD:4,164-UNIMOD:4	0.02	44.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	360-UNIMOD:21,369-UNIMOD:4	0.04	44.0	2	1	0
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	455-UNIMOD:21,435-UNIMOD:21	0.06	44.0	2	2	1
PRT	sp|P07357|CO8A_HUMAN	Complement component C8 alpha chain OS=Homo sapiens OX=9606 GN=C8A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	115-UNIMOD:4,121-UNIMOD:4,130-UNIMOD:4	0.04	43.0	1	1	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	288-UNIMOD:21	0.08	43.0	10	1	0
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	1767-UNIMOD:21	0.01	43.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	635-UNIMOD:21,642-UNIMOD:4	0.03	42.0	1	1	1
PRT	sp|Q92610|ZN592_HUMAN	Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	691-UNIMOD:21,686-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	218-UNIMOD:21	0.06	42.0	8	2	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	563-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	948-UNIMOD:35	0.01	42.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	82-UNIMOD:21	0.16	42.0	1	1	1
PRT	sp|P32927|IL3RB_HUMAN	Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	665-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	805-UNIMOD:21	0.01	42.0	4	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	215-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|P01008|ANT3_HUMAN	Antithrombin-III OS=Homo sapiens OX=9606 GN=SERPINC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	68-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q13557-8|KCC2D_HUMAN	Isoform Delta 6 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	330-UNIMOD:21,331-UNIMOD:21	0.05	41.0	3	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1456-UNIMOD:21	0.01	41.0	2	1	0
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	284-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q12767|TMM94_HUMAN	Transmembrane protein 94 OS=Homo sapiens OX=9606 GN=TMEM94 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	445-UNIMOD:21	0.01	41.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2370-UNIMOD:4,2515-UNIMOD:21	0.02	41.0	2	2	2
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	41.0	1	1	1
PRT	sp|Q5SYE7|NHSL1_HUMAN	NHS-like protein 1 OS=Homo sapiens OX=9606 GN=NHSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	1249-UNIMOD:27,1275-UNIMOD:35,1278-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q0JRZ9|FCHO2_HUMAN	F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	488-UNIMOD:21	0.04	41.0	3	1	0
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.09	40.0	1	1	1
PRT	sp|Q9UMS6-5|SYNP2_HUMAN	Isoform 5 of Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	535-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	218-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	266-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	95-UNIMOD:21,97-UNIMOD:35,123-UNIMOD:35	0.10	40.0	1	1	0
PRT	sp|Q9NZN4|EHD2_HUMAN	EH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	468-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	295-UNIMOD:21,284-UNIMOD:21	0.01	40.0	3	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2860-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q9Y679|AUP1_HUMAN	Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	288-UNIMOD:21	0.07	40.0	5	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	496-UNIMOD:28,498-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	626-UNIMOD:21,634-UNIMOD:4,624-UNIMOD:21	0.04	39.0	4	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	99-UNIMOD:21,101-UNIMOD:4	0.06	39.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	852-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	623-UNIMOD:21,446-UNIMOD:21	0.06	39.0	2	2	2
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	8-UNIMOD:21	0.11	39.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	63-UNIMOD:21,74-UNIMOD:4,64-UNIMOD:21,120-UNIMOD:21	0.10	39.0	4	2	0
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	56-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	830-UNIMOD:21	0.03	39.0	3	1	0
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	385-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	197-UNIMOD:28,215-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1031-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	5841-UNIMOD:21,135-UNIMOD:21,5739-UNIMOD:21	0.01	38.0	4	4	4
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	44-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	239-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q8NEY1-7|NAV1_HUMAN	Isoform 7 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1116-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1278-UNIMOD:21	0.01	38.0	3	1	0
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1050-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1364-UNIMOD:21	0.01	38.0	1	1	0
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	324-UNIMOD:21	0.04	38.0	2	1	0
PRT	sp|P42684-10|ABL2_HUMAN	Isoform 10 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	56-UNIMOD:21,67-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	671-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|P07947|YES_HUMAN	Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	40-UNIMOD:21,42-UNIMOD:4,44-UNIMOD:21	0.06	38.0	2	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1348-UNIMOD:21,1342-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|P49848|TAF6_HUMAN	Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	634-UNIMOD:21,644-UNIMOD:4	0.04	38.0	1	1	0
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	206-UNIMOD:28,224-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q9NYJ8|TAB2_HUMAN	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Homo sapiens OX=9606 GN=TAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	524-UNIMOD:21,525-UNIMOD:35	0.03	37.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	138-UNIMOD:21	0.13	37.0	1	1	1
PRT	sp|P78524-2|DEN2B_HUMAN	Isoform 2 of DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	95-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1243-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	199-UNIMOD:21	0.11	37.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	131-UNIMOD:21	0.04	37.0	3	1	0
PRT	sp|Q92974-3|ARHG2_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	928-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q6IQ23|PKHA7_HUMAN	Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	117-UNIMOD:21,119-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q96D71-4|REPS1_HUMAN	Isoform 4 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	513-UNIMOD:21,454-UNIMOD:21	0.06	37.0	3	2	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	614-UNIMOD:21,613-UNIMOD:21	0.03	37.0	3	1	0
PRT	sp|Q96JP2|MY15B_HUMAN	Unconventional myosin-XVB OS=Homo sapiens OX=9606 GN=MYO15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q9UPN7|PP6R1_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	759-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q15124|PGM5_HUMAN	Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	122-UNIMOD:21,124-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q8N111|CEND_HUMAN	Cell cycle exit and neuronal differentiation protein 1 OS=Homo sapiens OX=9606 GN=CEND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	86-UNIMOD:21	0.20	37.0	1	1	1
PRT	sp|Q14699|RFTN1_HUMAN	Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	199-UNIMOD:21,211-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	662-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	567-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1314-UNIMOD:21,1316-UNIMOD:4,1177-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	979-UNIMOD:21,971-UNIMOD:21	0.02	36.0	4	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	211-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	109-UNIMOD:4,113-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1011-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	893-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q8IY26|PLPP6_HUMAN	Phospholipid phosphatase 6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	70-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	258-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9H334-7|FOXP1_HUMAN	Isoform 7 of Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	440-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q76L83-2|ASXL2_HUMAN	Isoform 2 of Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	270-UNIMOD:21,291-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1421-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q8IWS0-2|PHF6_HUMAN	Isoform 2 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	155-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1014-UNIMOD:21,1325-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	665-UNIMOD:21	0.04	36.0	1	1	0
PRT	sp|Q2PPJ7|RGPA2_HUMAN	Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	820-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	275-UNIMOD:21	0.09	36.0	1	1	0
PRT	sp|Q9BUL9|RPP25_HUMAN	Ribonuclease P protein subunit p25 OS=Homo sapiens OX=9606 GN=RPP25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	148-UNIMOD:28,162-UNIMOD:21	0.12	36.0	1	1	1
PRT	sp|O95104|SCAF4_HUMAN	SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	656-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	907-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q8IV56|PRR15_HUMAN	Proline-rich protein 15 OS=Homo sapiens OX=9606 GN=PRR15 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:21	0.19	35.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	173-UNIMOD:4,181-UNIMOD:21,194-UNIMOD:4,173-UNIMOD:385,182-UNIMOD:21	0.10	35.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	521-UNIMOD:21,527-UNIMOD:35,519-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	300-UNIMOD:21,309-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|O43707-3|ACTN4_HUMAN	Isoform 3 of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	197-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:4,71-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	73-UNIMOD:4,75-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	207-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8IY33|MILK2_HUMAN	MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	712-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:21,116-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	161-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	338-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O94806-2|KPCD3_HUMAN	Isoform 2 of Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	213-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1066-UNIMOD:21,1074-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	864-UNIMOD:21,859-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	703-UNIMOD:21,712-UNIMOD:4,717-UNIMOD:4	0.02	35.0	2	1	0
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	869-UNIMOD:21,868-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	103-UNIMOD:4,107-UNIMOD:4,118-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1428-UNIMOD:21,1442-UNIMOD:4	0.00	35.0	1	1	1
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	119-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	678-UNIMOD:21,683-UNIMOD:21,652-UNIMOD:21	0.07	34.0	2	2	1
PRT	sp|P29474-3|NOS3_HUMAN	Isoform eNOS13B of Nitric oxide synthase, endothelial OS=Homo sapiens OX=9606 GN=NOS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	53-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	521-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	527-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	246-UNIMOD:35	0.05	34.0	1	1	1
PRT	sp|P23327|SRCH_HUMAN	Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	431-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	132-UNIMOD:21	0.11	34.0	1	1	1
PRT	sp|Q99081|HTF4_HUMAN	Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	184-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|P02549-2|SPTA1_HUMAN	Isoform 2 of Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	251-UNIMOD:21,254-UNIMOD:35	0.08	34.0	1	1	1
PRT	sp|Q8TF74-2|WIPF2_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	25-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	112-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	169-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	98-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O75113|N4BP1_HUMAN	NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	300-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	155-UNIMOD:21,156-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	458-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1283-UNIMOD:21,1177-UNIMOD:21,1179-UNIMOD:35,1189-UNIMOD:35	0.03	34.0	2	2	2
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1168-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q15173|2A5B_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	12-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	186-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|E7EW31|PROB1_HUMAN	Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	820-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	85-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	66-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q6NZI2|CAVN1_HUMAN	Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	365-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q96QT4|TRPM7_HUMAN	Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1504-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	239-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	286-UNIMOD:21,283-UNIMOD:21	0.08	34.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	245-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	208-UNIMOD:21	0.10	34.0	1	1	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	164-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	230-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9UKN1-2|MUC12_HUMAN	Isoform 2 of Mucin-12 OS=Homo sapiens OX=9606 GN=MUC12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1051-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	225-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q16891-2|MIC60_HUMAN	Isoform 2 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	175-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8TBA6-2|GOGA5_HUMAN	Isoform 2 of Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	88-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P06702|S10A9_HUMAN	Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	63-UNIMOD:35	0.14	34.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	426-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	313-UNIMOD:4,322-UNIMOD:35	0.08	34.0	3	2	1
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	677-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|A0FGR8|ESYT2_HUMAN	Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	690-UNIMOD:35,691-UNIMOD:21,716-UNIMOD:35	0.04	34.0	1	1	0
PRT	sp|P16144-2|ITB4_HUMAN	Isoform Beta-4A of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1364-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|P13591-1|NCAM1_HUMAN	Isoform 2 of Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	774-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	626-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	114-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q14005-2|IL16_HUMAN	Isoform 2 of Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	863-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|O75791-2|GRAP2_HUMAN	Isoform 2 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	123-UNIMOD:21,131-UNIMOD:4,139-UNIMOD:35,144-UNIMOD:35	0.12	33.0	1	1	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	887-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q969H4-2|CNKR1_HUMAN	Isoform 2 of Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	293-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q4L235-3|ACSF4_HUMAN	Isoform 3 of Beta-alanine-activating enzyme OS=Homo sapiens OX=9606 GN=AASDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	649-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	437-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|O43379|WDR62_HUMAN	WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1348-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	515-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|Q7Z406-5|MYH14_HUMAN	Isoform 5 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	174-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	990-UNIMOD:35	0.02	33.0	2	2	2
PRT	sp|Q96CW1-2|AP2M1_HUMAN	Isoform 2 of AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	238-UNIMOD:21,244-UNIMOD:4,249-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	916-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	151-UNIMOD:21	0.10	33.0	1	1	1
PRT	sp|P09493-9|TPM1_HUMAN	Isoform 9 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	215-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	287-UNIMOD:21,289-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	229-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|O75907|DGAT1_HUMAN	Diacylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=DGAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	17-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2159-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|O43852-12|CALU_HUMAN	Isoform 12 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	44-UNIMOD:21	0.31	33.0	1	1	1
PRT	sp|Q6AI39|BICRL_HUMAN	BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	675-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	687-UNIMOD:4,691-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8N108|MIER1_HUMAN	Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	483-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q8WY36|BBX_HUMAN	HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	241-UNIMOD:28,243-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q5VZ89|DEN4C_HUMAN	DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1278-UNIMOD:21	0.01	33.0	1	1	0
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	413-UNIMOD:21,419-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|P00918|CAH2_HUMAN	Carbonic anhydrase 2 OS=Homo sapiens OX=9606 GN=CA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	272-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q5TB80-2|CE162_HUMAN	Isoform 2 of Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	100-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P10636|TAU_HUMAN	Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	432-UNIMOD:4,437-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q8N350-4|CBARP_HUMAN	Isoform 2 of Voltage-dependent calcium channel beta subunit-associated regulatory protein OS=Homo sapiens OX=9606 GN=CBARP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	184-UNIMOD:4,199-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q9Y6R0|NUMBL_HUMAN	Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	263-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q9H0J9|PAR12_HUMAN	Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	258-UNIMOD:21,276-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q6UX15-3|LAYN_HUMAN	Isoform 3 of Layilin OS=Homo sapiens OX=9606 GN=LAYN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	146-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	113-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	320-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	72-UNIMOD:21	0.22	32.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.00	32.0	1	1	1
PRT	sp|Q16566|KCC4_HUMAN	Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	341-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	909-UNIMOD:21,924-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	78-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8NDX1-2|PSD4_HUMAN	Isoform 2 of PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	990-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	649-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1130-UNIMOD:21,1143-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	422-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	161-UNIMOD:21	0.09	32.0	1	1	1
PRT	sp|Q9H6Y2-2|WDR55_HUMAN	Isoform 2 of WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	86-UNIMOD:21,88-UNIMOD:4	0.15	32.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	613-UNIMOD:21	0.03	32.0	1	1	0
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1789-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	700-UNIMOD:21,708-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q9ULC8|ZDHC8_HUMAN	Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens OX=9606 GN=ZDHHC8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	671-UNIMOD:28,682-UNIMOD:21	0.03	32.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	25-UNIMOD:21	ms_run[2]:scan=11444	62.711	3	3053.4455	3053.4455	R	A	460	493
PSM	AHLTVGQAAAGGSGNLLTER	2	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	13-UNIMOD:21	ms_run[2]:scan=12536	68.743	2	2001.9633	2001.9633	R	S	317	337
PSM	RLSSASTGKPPLSVEDDFEK	3	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=12741	69.92	2	2242.0519	2242.0519	R	L	756	776
PSM	VAHEPVAPPEDKESESEAK	4	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:21	ms_run[2]:scan=4033	24.07	2	2127.9362	2127.9362	R	V	8	27
PSM	KVQVAALQASPPLDQDDR	5	sp|Q9UDY2-3|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11105	60.885	2	1950.0171	1950.0171	R	A	98	116
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	6	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6206	35.228705	3	3007.3316	3007.3290	K	S	145	174
PSM	AHSPGLLGPALGPPYPSGR	7	sp|Q6UXY1-2|BI2L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=15354	85.302	2	1922.9404	1922.9404	R	L	229	248
PSM	AHSPGLLGPALGPPYPSGR	8	sp|Q6UXY1-2|BI2L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=15512	86.312	2	1922.9404	1922.9404	R	L	229	248
PSM	KLECNGENDCGDNSDER	9	sp|P13671|CO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=985	7.6887	2	2010.7643	2010.7643	R	D	155	172
PSM	KSEAGHASSPDSEVTSLCQK	10	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7086	39.963	2	2196.9358	2196.9358	K	E	352	372
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	11	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=18534	106.18	3	3062.559	3062.5590	K	A	444	473
PSM	HLVCNGDQDCLDGSDEDDCEDVR	12	sp|P07357|CO8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:4,10-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=8360	46.607	3	2722.0177	2722.0177	R	A	112	135
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	13	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=16627	93.351	3	3011.4866	3011.4866	R	V	276	304
PSM	RFSVSPSSPSSQQTPPPVTPR	14	sp|Q14185|DOCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=9750	53.838	3	2318.1056	2318.1056	R	A	1754	1775
PSM	YKLDEDEDEDDADLSK	15	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8352	46.565	2	1898.7905	1898.7905	K	Y	167	183
PSM	HEPHQDSGEEAEGCPSAPEETPVDK	16	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=5564	31.782	3	2811.0967	2811.0967	K	K	629	654
PSM	HGLTSGSASPPPPALPLYPDPVR	17	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=17036	96.024	2	2405.1781	2405.1781	K	L	683	706
PSM	IYHLPDAESDEDEDFKEQTR	18	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=12664	69.504	2	2516.0381	2516.0381	K	L	210	230
PSM	KFSKEEPVSSGPEEAVGK	19	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=7221	40.679	2	1983.9191	1983.9191	R	S	561	579
PSM	MQAHIQDLEEQLDEEEGAR	20	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35	ms_run[2]:scan=14323	79.097	2	2255.9965	2255.9965	K	Q	948	967
PSM	RAPSTSPSFEGTQETYTVAHEENVR	21	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=11386	62.406	3	2872.2665	2872.2665	R	F	75	100
PSM	RPSQGAAGSPSLESGGGPAPPALGPR	22	sp|P32927|IL3RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=11501	63.012	3	2450.1703	2450.1704	R	V	657	683
PSM	SAPTAPTPPPPPPPATPR	23	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=8277	46.176	2	1827.892	1827.8921	R	K	799	817
PSM	SPLDKDTYPPSASVVGASVGGHR	24	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=11843	64.916	3	2376.1111	2376.1111	R	H	215	238
PSM	KATEDEGSEQKIPEATNR	25	sp|P01008|ANT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=3489	21.265	2	2081.9267	2081.9267	K	R	61	79
PSM	KPDGVKESTESSNTTIEDEDVK	26	sp|Q13557-8|KCC2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=5593	31.926	3	2487.0902	2487.0902	K	A	323	345
PSM	RNSVERPAEPVAGAATPSLVEQQK	27	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10326	56.891	3	2613.2912	2613.2912	R	M	1454	1478
PSM	RSSEEVDGQHPAQEEVPESPQTSGPEAENR	28	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21	ms_run[2]:scan=6940	39.166	3	3355.4226	3355.4226	R	C	266	296
PSM	SAPTAPTPPPPPPPATPR	29	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=8473	47.184	2	1827.892	1827.8921	R	K	799	817
PSM	VEPPHSSHEDLTDGLSTR	30	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=9226	51.083	2	2055.8899	2055.8899	K	S	439	457
PSM	VHSPSGALEECYVTEIDQDK	31	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4	ms_run[2]:scan=14543	80.462	2	2276.0267	2276.0267	K	Y	2360	2380
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	32	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16034	89.57328166666666	3	3442.4035	3442.4027	K	L	104	135
PSM	ESSAAQAGSHATHPGTSVLEGGAAGSMSPSR	33	sp|Q5SYE7|NHSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:27,27-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=8639	48.04193166666666	3	2972.2728	2972.2715	K	V	1249	1280
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	34	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	12-UNIMOD:21	ms_run[1]:scan=18680	107.25375	3	3063.546977	3062.559037	K	A	477	506
PSM	APEPHVEEDDDDELDSK	35	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6629	37.452	2	1938.7967	1938.7967	K	L	5	22
PSM	APPPVAYNPIHSPSYPLAALK	36	sp|Q9UMS6-5|SYNP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=18436	105.43	2	2282.1501	2282.1501	R	S	524	545
PSM	ELEKPIQSKPQSPVIQAAAVSPK	37	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=10463	57.591	2	2524.3302	2524.3302	R	F	207	230
PSM	HGLTSGSASPPPPALPLYPDPVR	38	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=17138	96.699	3	2405.1781	2405.1781	K	L	683	706
PSM	IYHLPDAESDEDEDFKEQTR	39	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=12259	67.207	2	2516.0381	2516.0381	K	L	210	230
PSM	KPEDVLDDDDAGSAPLK	40	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10059	55.411	2	1783.8476	1783.8476	R	S	141	158
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	41	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=16782	94.366	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	42	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=17249	97.428	3	3011.4866	3011.4866	R	V	276	304
PSM	PSQLQAHTPASQQTPPLPPYASPR	43	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=12376	67.858	3	2648.2748	2648.2748	K	S	253	277
PSM	SAPTAPTPPPPPPPATPR	44	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=8089	45.167	2	1827.892	1827.8921	R	K	799	817
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	45	sp|A0FGR8-5|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,3-UNIMOD:35,29-UNIMOD:35	ms_run[2]:scan=7336	41.271	3	3164.3428	3164.3428	K	A	95	127
PSM	SKYDEIFYNLAPADGKLSGSK	46	sp|Q9NZN4|EHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:21	ms_run[2]:scan=17236	97.351	2	2382.1145	2382.1145	K	A	451	472
PSM	TITSAHTSSTSTSLESDSASPGVSDHGR	47	sp|Q5TH69|BIG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	20-UNIMOD:21	ms_run[2]:scan=6529	36.944	3	2854.2254	2854.2254	K	G	276	304
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	48	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=8132	45.388	3	2919.2268	2919.2268	R	S	2860	2891
PSM	RFSVSPSSPSSQQTPPPVTPR	49	sp|Q14185|DOCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21	ms_run[1]:scan=9982	55.01795500000001	3	2319.109105	2318.105626	R	A	1754	1775
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	50	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21	ms_run[1]:scan=16939	95.37471500000001	3	3013.491642	3011.486600	R	V	276	304
PSM	QRSPSPAPAPAPAAAAGPPTR	51	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=7272	40.923386666666666	2	2029.9752	2029.9730	R	K	496	517
PSM	FNHDGEEEEEDDDYGSR	52	sp|Q6PJT7-10|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4160	24.656	2	2041.741	2041.7410	K	T	271	288
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	53	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=12438	68.218	3	2762.2735	2762.2735	K	Q	609	638
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	54	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=12798	70.253	3	2762.2735	2762.2735	K	Q	609	638
PSM	KPDGVKESTESSNTTIEDEDVK	55	sp|Q13557-8|KCC2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=5781	32.941	3	2487.0902	2487.0902	K	A	323	345
PSM	RNSVERPAEPVAGAATPSLVEQQK	56	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=10526	57.9	3	2613.2912	2613.2912	R	M	1454	1478
PSM	RVSVCAETYNPDEEEEDTDPR	57	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10011	55.17	3	2590.0167	2590.0167	R	V	97	118
PSM	SKEDVTVSPSQEINAPPDENKR	58	sp|Q5T0W9|FA83B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=8189	45.706	3	2519.1541	2519.1541	K	T	845	867
PSM	SLRGSDALSETSSVSHIEDLEK	59	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=15045	83.495	3	2439.1166	2439.1166	R	V	619	641
PSM	SLSTSGESLYHVLGLDK	60	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=21069	124.67	2	1884.887	1884.8870	R	N	8	25
PSM	SPKPAAPAAPPFSSSSGVLGTGLCELDR	61	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=19571	113.56	3	2848.3467	2848.3467	R	L	51	79
PSM	SPLLAGGSPPQPVVPAHK	62	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=12309	67.475	2	1830.9393	1830.9393	R	D	49	67
PSM	STAQQELDGKPASPTPVIVASHTANK	63	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=9466	52.301	3	2726.3276	2726.3276	R	E	818	844
PSM	VHAYFAPVTPPPSVGGSR	64	sp|Q96IG2-2|FXL20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=13506	74.248	2	1917.9138	1917.9138	K	Q	377	395
PSM	QQQLEEEAAKPPEPEKPVSPPPIESK	65	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13584	74.72518166666667	3	2944.4127	2944.4102	K	H	197	223
PSM	EAAAQEAGADTPGKGEPPAPKSPPK	66	sp|O95466|FMNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	22-UNIMOD:21	ms_run[2]:scan=5434	31.13	3	2480.1584	2480.1584	K	A	1010	1035
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	67	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=12977	71.266	3	2762.2735	2762.2735	K	Q	609	638
PSM	GHYEVTGSDDETGKLQGSGVSLASK	68	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=10945	60.094	3	2601.1596	2601.1596	K	K	5834	5859
PSM	KGLPLGSAVSSPVLFSPVGR	69	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=18991	109.42	2	2047.0867	2047.0867	R	R	35	55
PSM	KVSKQEEASGGPTAPK	70	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=896	7.306	2	1692.8084	1692.8084	R	A	237	253
PSM	RQNSSDSISSLNSITSHSSIGSSK	71	sp|Q8NEY1-7|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=12278	67.313	3	2558.161	2558.1610	K	D	1113	1137
PSM	RSSLPLDHGSPAQENPESEK	72	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=7584	42.559	3	2257.0012	2257.0012	R	S	1276	1296
PSM	SKSFDYGNLSHAPVSGAAASTVSPSR	73	sp|P31629|ZEP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=12733	69.872	3	2672.2232	2672.2232	R	E	1048	1074
PSM	SPSGSQRPSVSDDTEHLVNGR	74	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=8149	45.483	2	2304.0132	2304.0132	R	M	1356	1377
PSM	SVAPASPPPPDGPLAHR	75	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=8528	47.467	2	1744.8298	1744.8298	R	L	319	336
PSM	TGGSSPEALHRPYGCDVEPQALNEAIR	76	sp|P42684-10|ABL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=14470	79.997	3	3003.3546	3003.3546	K	W	53	80
PSM	TITSAHTSSTSTSLESDSASPGVSDHGR	77	sp|Q5TH69|BIG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=6748	38.11	3	2854.2254	2854.2254	K	G	276	304
PSM	YPESNRTPVKPSSVEEEDSFFR	78	sp|Q9UHB7|AFF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=14081	77.694	3	2679.1854	2679.1854	K	Q	668	690
PSM	YRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAK	79	sp|P07947|YES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	25-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=11031	60.534	3	3598.5923	3598.5923	K	G	16	49
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	80	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	26-UNIMOD:21	ms_run[1]:scan=16188	90.51252666666667	3	3418.607188	3417.603086	R	E	1323	1356
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	81	sp|P49848|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	16-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=12625	69.24147166666667	3	2762.268292	2762.273496	K	Q	619	648
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	82	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=12762	70.029445	3	2972.4262	2971.4212	K	H	206	232
PSM	DLDEDELLGNLSETELK	83	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20060	117.08	2	1931.9211	1931.9211	K	Q	14	31
PSM	KLSMGSDDAAYTQALLVHQK	84	sp|Q9NYJ8|TAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13140	72.162	2	2271.0606	2271.0606	R	A	522	542
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	85	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=16287	91.155	3	3656.5163	3656.5163	K	E	120	152
PSM	KSQQLSENSLDSLHR	86	sp|P78524-2|DEN2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=8815	48.942	3	1820.8418	1820.8418	R	M	94	109
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	87	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:21	ms_run[2]:scan=9067	50.284	3	2868.339	2868.3390	R	S	1220	1248
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	88	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:21	ms_run[2]:scan=10591	58.241	3	3134.4962	3134.4962	K	R	178	209
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	89	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=15939	88.983	3	2948.4532	2948.4532	R	R	129	157
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	90	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=16099	89.985	3	2948.4532	2948.4532	R	R	129	157
PSM	LKGEIDASVPELEGDLR	91	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16017	89.458	2	1839.9578	1839.9578	K	G	1795	1812
PSM	LKSEDGVEGDLGETQSR	92	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7905	44.211	2	1898.8259	1898.8259	R	T	133	150
PSM	LQDSSDPDTGSEEEGSSRLSPPHSPR	93	sp|Q92974-3|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:21	ms_run[2]:scan=7641	42.821	3	2846.1992	2846.1992	R	D	909	935
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	94	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=17405	98.44	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	95	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=17555	99.462	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	96	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=17703	100.48	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	97	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=16461	92.307	3	3011.4866	3011.4866	R	V	276	304
PSM	NQRPSSMVSETSTAGTASTLEAKPGPK	98	sp|Q6IQ23|PKHA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=7691	43.052	3	2827.3059	2827.3059	R	I	113	140
PSM	RSSLPLDHGSPAQENPESEK	99	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7389	41.549	3	2257.0012	2257.0012	R	S	1276	1296
PSM	SAPTAPTPPPPPPPATPR	100	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=7893	44.157	2	1827.892	1827.8921	R	K	799	817
PSM	SHSGTSPDNTAPPPPPPR	101	sp|Q96D71-4|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3356	20.511	2	1890.8262	1890.8262	R	P	508	526
PSM	SPPDQPAVPHPPPSTPIK	102	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=9192	50.913	2	1940.9397	1940.9397	K	L	600	618
PSM	VHIPQGEAQEEEEEEEEEEEQEEQEVETR	103	sp|Q96JP2|MY15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13631	74.993	3	3525.4663	3525.4663	K	A	993	1022
PSM	VSGEEELHTGPPAPQGPLSVPQGLPTQSLASPPAR	104	sp|Q9UPN7|PP6R1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	31-UNIMOD:21	ms_run[2]:scan=17617	99.873	3	3580.7563	3580.7563	R	D	729	764
PSM	AAGGIILTASHCPGGPGGEFGVK	105	sp|Q15124|PGM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=15498	86.22036	2	2233.046667	2232.039854	K	F	113	136
PSM	ADPALLNNHSNLKPAPTVPSSPDATPEPK	106	sp|Q8N111|CEND_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	20-UNIMOD:21	ms_run[1]:scan=12222	67.00412333333333	3	3058.466683	3057.480846	K	G	67	96
PSM	GDHASLENEKPGTGDVCSAPAGR	107	sp|Q14699|RFTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=6443	36.55	3	2404.0115	2404.0115	R	N	195	218
PSM	GPKPEPPGSGSPAPPR	108	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=3487	21.258	2	1606.7505	1606.7505	R	R	652	668
PSM	HGGPGPGGPEPELSPITEGSEAR	109	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=12012	65.844	3	2307.0169	2307.0169	R	A	554	577
PSM	HLGGSGSVVPGSPCLDR	110	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=10512	57.84	2	1773.7869	1773.7869	R	H	1303	1320
PSM	IYHLPDAESDEDEDFKEQTR	111	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=13664	75.187	3	2516.0381	2516.0381	K	L	210	230
PSM	KLSMGSDDAAYTQALLVHQK	112	sp|Q9NYJ8|TAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13094	71.896	3	2271.0606	2271.0606	R	A	522	542
PSM	KPSVGVPPPASPSYPR	113	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=8939	49.578	2	1714.8444	1714.8444	R	A	969	985
PSM	LLKPGEEPSEYTDEEDTK	114	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=8623	47.956	2	2158.9195	2158.9195	R	D	200	218
PSM	NKQDDDLNCEPLSPHNITPEPVSK	115	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=12098	66.326	3	2826.2532	2826.2532	K	L	101	125
PSM	RDSGRPPGDSSGQAVAPSEGANK	116	sp|Q12774|ARHG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=2538	16.124	3	2319.0241	2319.0241	R	H	1009	1032
PSM	RDSLGAYASQDANEQGQDLGKR	117	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9382	51.879	3	2458.0874	2458.0874	K	D	891	913
PSM	RGSFPLAAAGPSQSPAPPLPEEDR	118	sp|Q8IY26|PLPP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=15327	85.14	3	2526.1904	2526.1904	R	M	68	92
PSM	RPESPPSILTPPVVPTADK	119	sp|P55198|AF17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=15721	87.609	2	2080.0606	2080.0606	K	V	255	274
PSM	RYSDKYNVPISSDIAQNQEFYK	120	sp|Q9H334-7|FOXP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=15682	87.385	3	2744.2483	2744.2483	R	N	438	460
PSM	SPGVEKPIVKPTAGAGPQETNMK	121	sp|Q76L83-2|ASXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=6274	35.595	3	2431.1818	2431.1818	K	E	270	293
PSM	SPKPAAPAAPPFSSSSGVLGTGLCELDR	122	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=19412	112.45	3	2848.3467	2848.3467	R	L	51	79
PSM	SPLDKDTYPPSASVVGASVGGHR	123	sp|Q96T37-4|RBM15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=11656	63.88	3	2376.1111	2376.1111	R	H	215	238
PSM	SSPKEELHPAAPSQLAPSFSSSSSSSSGPR	124	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=12575	68.945	3	3078.3932	3078.3932	R	S	1421	1451
PSM	TAHNSEAADLEESFNEHELEPSSPK	125	sp|Q8IWS0-2|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:21	ms_run[2]:scan=15007	83.273	3	2847.1872	2847.1872	K	S	134	159
PSM	TGSDHTNPTSPLLVKPSDLLEENK	126	sp|Q96D71-4|REPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=16842	94.745	2	2671.2742	2671.2742	R	I	446	470
PSM	TLENPVNVYNPSHSDSLASQQSVASHPR	127	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=12901	70.823	3	3113.4204	3113.4204	R	Q	1001	1029
PSM	YPESNRTPVKPSSVEEEDSFFR	128	sp|Q9UHB7|AFF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=14257	78.707	3	2679.1854	2679.1854	K	Q	668	690
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	129	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=17720	100.59805333333333	3	3096.566316	3095.580500	R	A	655	686
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	130	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=18010	102.49837833333333	3	3012.490623	3011.486600	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	131	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=17861	101.49045333333333	3	3012.490497	3011.486600	R	V	276	304
PSM	RSSSPAELDLKDDLQQTQGK	132	sp|Q2PPJ7|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=12490	68.48472166666667	3	2296.079291	2295.074385	R	C	818	838
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	133	sp|O75381|PEX14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	29-UNIMOD:21	ms_run[1]:scan=7298	41.05546	3	3201.375407	3200.389524	K	E	247	279
PSM	QPGYQPPNPHPGPSSPPAAPASK	134	sp|Q9BUL9|RPP25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=9394	51.93381	2	2341.0538	2341.0523	R	R	148	171
PSM	KPENEVAQNGGAETSHTEPVSPIPK	135	sp|O95104|SCAF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	21-UNIMOD:21	ms_run[1]:scan=7807	43.694001666666665	2	2696.233585	2695.249055	K	P	636	661
PSM	ALPTSKPEGSLHSSPVGPSSSK	136	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=6571	37.151	2	2229.0678	2229.0678	R	G	895	917
PSM	AQFSVAGVHTVPGSPQAR	137	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=11674	63.981	2	1887.8993	1887.8993	R	H	1164	1182
PSM	ATLLPEAGRSPEEAGFPGDPHEDK	138	sp|Q8IV56|PRR15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=13630	74.99	3	2599.1592	2599.1592	R	Q	105	129
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	139	sp|Q9Y478|AAKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,9-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=12163	66.683	3	3213.342	3213.3420	K	F	173	200
PSM	DLTHSDSESSLHMSDR	140	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3809	22.922	2	1911.7306	1911.7306	R	Q	515	531
PSM	FTGSFDDDPDPHRDPYGEEVDR	141	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=11661	63.904	3	2645.0344	2645.0344	R	R	1324	1346
PSM	GEQEHSQQKEEEEEMAVVPQGLFR	142	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15102	83.83	3	2909.2539	2909.2539	K	G	295	319
PSM	IYHLPDAESDEDEDFKEQTR	143	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=12859	70.602	2	2516.0381	2516.0381	K	L	210	230
PSM	KAGTQIENIDEDFR	144	sp|O43707-3|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11842	64.912	2	1634.79	1634.7900	R	D	66	80
PSM	KPSVGVPPPASPSYPR	145	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=9330	51.6	2	1714.8444	1714.8444	R	A	969	985
PSM	KSEAPAEVTHFSPK	146	sp|Q6PID6|TTC33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=6569	37.144	2	1606.7392	1606.7392	K	S	186	200
PSM	KSSGEIVYCGQVFEKSPLR	147	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=13205	72.532	3	2263.0708	2263.0708	K	V	56	75
PSM	LGPGRPLPTFPTSECTSDVEPDTR	148	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=15283	84.881	3	2708.2153	2708.2153	K	E	59	83
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	149	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=15772	87.958	3	2948.4532	2948.4532	R	R	129	157
PSM	LNHVAAGLVSPSLK	150	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=11721	64.252	2	1484.7752	1484.7752	K	S	198	212
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	151	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=18154	103.51	3	3011.4866	3011.4866	R	V	276	304
PSM	PGRPLSPANVPALPGETVTSPVR	152	sp|Q8IY33|MILK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=16342	91.495	3	2391.2312	2391.2312	K	L	707	730
PSM	RASVCAEAYNPDEEEDDAESR	153	sp|P31323|KAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8640	48.046	3	2491.9435	2491.9435	R	I	112	133
PSM	REEDEPEERSGDETPGSEVPGDK	154	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=5013	29.065	3	2623.0559	2623.0559	K	A	152	175
PSM	RIPSIVSSPLNSPLDR	155	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=16246	90.907	2	1829.9401	1829.9401	K	S	327	343
PSM	RLSNVSLPGPGLSVPR	156	sp|O94806-2|KPCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=15909	88.797	2	1727.9084	1727.9084	R	P	211	227
PSM	RPESPPSILTPPVVPTADK	157	sp|P55198|AF17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=15878	88.622	2	2080.0606	2080.0606	K	V	255	274
PSM	RPGGSSPLNAVPCEGPPGSEPPR	158	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10693	58.788	3	2394.0788	2394.0788	K	R	1062	1085
PSM	RPPGPTTSPASTSLSSPGQR	159	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=6588	37.234	2	2059.9688	2059.9688	R	D	852	872
PSM	RPPGPTTSPASTSLSSPGQR	160	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=6772	38.242	2	2059.9688	2059.9688	R	D	852	872
PSM	RPSLPSSPSPGLPK	161	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=10646	58.549	2	1498.7545	1498.7545	K	A	118	132
PSM	RSSLPLDHGSPAQENPESEK	162	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=7196	40.545	3	2257.0012	2257.0012	R	S	1276	1296
PSM	RTSMGGTQQQFVEGVR	163	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7909	44.232	2	1875.8299	1875.8299	R	M	550	566
PSM	SASPHDVDLCLVSPCEFEHR	164	sp|Q66K74-2|MAP1S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=16833	94.694	2	2434.0083	2434.0083	R	K	703	723
PSM	SPPDQPAVPHPPPSTPIK	165	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=9001	49.906	2	1940.9397	1940.9397	K	L	600	618
PSM	SPPDQPAVPHPPPSTPIK	166	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=9092	50.408	2	1940.9397	1940.9397	K	L	600	618
PSM	STAQQELDGKPASPTPVIVASHTANK	167	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=9273	51.296	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	168	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=9693	53.528	3	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	169	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=8726	48.489	2	1744.8298	1744.8298	R	L	319	336
PSM	THYSNIEANESEEVR	170	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5920	33.718	2	1776.7915	1776.7915	R	Q	85	100
PSM	VASEAPLEHKPQVEASSPR	171	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=5923	33.734	2	2111.0048	2111.0048	K	L	853	872
PSM	VGEVCHITCKPEYAYGSAGSPPK	172	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,9-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=9845	54.324	3	2586.1284	2586.1284	K	I	99	122
PSM	YRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAK	173	sp|P07947|YES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	27-UNIMOD:4,29-UNIMOD:21	ms_run[2]:scan=11488	62.942	3	3598.5923	3598.5923	K	G	16	49
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	174	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21	ms_run[1]:scan=16144	90.23684	3	3012.491773	3011.486600	R	V	276	304
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	175	sp|Q9Y478|AAKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=14430	79.75514	3	3196.3157	3196.3150	K	F	173	200
PSM	RVSTDLPEGQDVYTAACNSVIHR	176	sp|Q15751|HERC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=16140	90.21823833333333	3	2668.195837	2667.211230	R	C	1426	1449
PSM	RIDFTPVSPAPSPTR	177	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=11897	65.21198666666668	2	1719.829436	1719.834536	K	G	108	123
PSM	AAPEASSPPASPLQHLLPGK	178	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=16932	95.338	2	2126.9803	2126.9803	K	A	673	693
PSM	APASLLPPAPEHSPPSSPLTQPPEGPK	179	sp|P29474-3|NOS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=15694	87.44	3	2778.363	2778.3630	R	F	41	68
PSM	AQNEFKDEAQSLSHSPK	180	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:21	ms_run[2]:scan=8154	45.504	2	1994.8735	1994.8735	R	R	507	524
PSM	AVSPPHLDGPPSPR	181	sp|P29590-2|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=8908	49.423	2	1505.7028	1505.7028	K	S	516	530
PSM	DASDDLDDLNFFNQK	182	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19769	115.03	2	1755.7588	1755.7588	K	K	65	80
PSM	DPDAQPGGELMLGGTDSK	183	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=9840	54.297	2	1802.7993	1802.7993	R	Y	236	254
PSM	EEDEEVSAELGHQAPSHR	184	sp|P23327|SRCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=6970	39.316	2	2098.8593	2098.8593	R	Q	425	443
PSM	EILAGKPAAQKSPSDLLDASAVSATSR	185	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=14259	78.714	3	2762.3852	2762.3852	R	Y	121	148
PSM	GFTDSPHYSDHLNDSR	186	sp|Q99081|HTF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=8045	44.941	2	1926.7534	1926.7534	R	L	75	91
PSM	GKGGVTGSPEASISGSKGDLK	187	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=6493	36.787	2	2010.9623	2010.9623	K	S	5724	5745
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	188	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=13739	75.633	3	2842.2698	2842.2698	R	E	181	208
PSM	HEDFEEAFTAQEEK	189	sp|P02549-2|SPTA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12031	65.944	2	1708.7217	1708.7217	K	I	518	532
PSM	HKSGSMEEDVDTSPGGDYYTSPSSPTSSSR	190	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=8402	46.808	3	3243.2823	3243.2823	R	N	249	279
PSM	HSSSAPPPPPPGR	191	sp|Q8TF74-2|WIPF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=1163	8.609	2	1362.6082	1362.6082	K	R	22	35
PSM	IHIDPEIQDGSPTTSR	192	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=10084	55.554	2	1844.8306	1844.8306	R	R	102	118
PSM	IRLDETDDPDDYGDR	193	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9220	51.056	2	1793.7704	1793.7704	K	E	399	414
PSM	ISEKEHSLEDNSSPNSLEPLK	194	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=10315	56.838	3	2432.1108	2432.1108	R	H	168	189
PSM	KGAAEEAELEDSDDEEKPVK	195	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=5828	33.236	3	2267.9682	2267.9682	K	Q	87	107
PSM	KQFSLENVQEGEILHDAK	196	sp|O75113|N4BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=14999	83.23	3	2164.0202	2164.0202	K	T	297	315
PSM	KQFSLENVQEGEILHDAK	197	sp|O75113|N4BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=15048	83.509	2	2164.0202	2164.0202	K	T	297	315
PSM	KSLGDDISSETSGDFR	198	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11827	64.837	2	1712.7853	1712.7853	K	K	138	154
PSM	KSSTVATLQGTPDHGDPR	199	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=5031	29.147	2	1945.8895	1945.8895	R	T	154	172
PSM	KSSTVATLQGTPDHGDPR	200	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5351	30.697	3	1945.8895	1945.8895	R	T	154	172
PSM	LKDEDDEDDCFILEK	201	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4	ms_run[2]:scan=12253	67.173	2	1882.8142	1882.8142	K	A	449	464
PSM	LKEDILENEDEQNSPPKK	202	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=8017	44.788	3	2205.0202	2205.0202	R	G	1270	1288
PSM	LKPGGVGAPSSSSPSPSPSAR	203	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=5402	30.963	2	2001.9521	2001.9521	K	P	1159	1180
PSM	LPPASTPTSPSSPGLSPVPPPDKVDGFSR	204	sp|Q15173|2A5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=15213	84.494	3	2966.4427	2966.4427	K	R	5	34
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	205	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=16310	91.3	3	3011.4866	3011.4866	R	V	276	304
PSM	LVSNHSLHETSSVFVDSLTK	206	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=15898	88.735	2	2279.0835	2279.0835	R	A	2513	2533
PSM	PIPNQPPTAAHTANFLLNASGSTSTPAPSR	207	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	25-UNIMOD:21	ms_run[2]:scan=16318	91.347	3	3094.4873	3094.4873	R	T	162	192
PSM	PKTPPTAPEPAAAVQAPLPR	208	sp|E7EW31|PROB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=12041	66.003	3	2088.0769	2088.0769	K	E	818	838
PSM	PRPEAEPPSPPSGDLR	209	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=8180	45.656	2	1780.8145	1780.8145	K	L	77	93
PSM	RDSSESQLASTESDKPTTGR	210	sp|Q96B23-2|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=4230	24.991	3	2230.9703	2230.9703	R	V	64	84
PSM	RGSSPDVHALLEITEESDAVLVDK	211	sp|Q6NZI2|CAVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=22418	135.03	3	2659.2742	2659.2742	R	S	363	387
PSM	RPASPSSPEHLPATPAESPAQR	212	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8175	45.628	3	2442.073	2442.0730	K	F	231	253
PSM	RPSTEDTHEVDSK	213	sp|Q96QT4|TRPM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=718	6.4275	2	1579.6515	1579.6515	R	A	1502	1515
PSM	RSSDGSLSHEEDLAK	214	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5286	30.358	2	1709.7258	1709.7258	K	V	237	252
PSM	SASPHDVDLCLVSPCEFEHR	215	sp|Q66K74-2|MAP1S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=16919	95.25	3	2434.0083	2434.0083	R	K	703	723
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	216	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=7669	42.95	3	2455.0765	2455.0765	R	S	283	308
PSM	SHTSLKDELSDVSQGGSK	217	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=9637	53.232	2	1953.8681	1953.8681	R	A	242	260
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	218	sp|O75381-2|PEX14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=6860	38.696	3	3200.3895	3200.3895	K	E	204	236
PSM	SRDESASETSTPSEHSAAPSPQVEVR	219	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:21	ms_run[2]:scan=6424	36.447	3	2820.2199	2820.2199	R	T	145	171
PSM	SSLKSDPEGENIHAGLLK	220	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=10771	59.178	3	1973.9459	1973.9459	K	K	442	460
PSM	SSSPAPADIAQTVQEDLR	221	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=19143	110.49	2	1963.8888	1963.8888	K	T	230	248
PSM	STIFHSSPDASGTTPSSAHSTTSGR	222	sp|Q9UKN1-2|MUC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=6492	36.784	3	2555.0926	2555.0926	K	G	1046	1071
PSM	STTPPPAEPVSLPQEPPKPR	223	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11110	60.913	2	2204.0878	2204.0878	K	V	225	245
PSM	TDHPEIGEGKPTPALSEEASSSSIR	224	sp|Q16891-2|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=10436	57.458	3	2674.2123	2674.2123	K	E	160	185
PSM	VGSRTPVEASHPVENASVPR	225	sp|Q8TBA6-2|GOGA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=6517	36.893	2	2168.0375	2168.0375	K	P	86	106
PSM	VIEHIMEDLDTNADK	226	sp|P06702|S10A9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35	ms_run[2]:scan=9239	51.137	2	1757.8142	1757.8142	K	Q	58	73
PSM	VLPPPAGYVPIRTPAR	227	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=13867	76.414	2	1782.9546	1782.9546	K	K	414	430
PSM	VLPPPAGYVPIRTPAR	228	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=14037	77.421	2	1782.9546	1782.9546	K	K	414	430
PSM	SHCIAEVENDEMPADLPSLAADFVESK	229	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=21075	124.718465	3	2990.335172	2989.332119	K	D	311	338
PSM	QQQLEEEAAKPPEPEKPVSPPPIESK	230	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13416	73.71661666666667	3	2944.4127	2944.4102	K	H	197	223
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	231	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:21	ms_run[1]:scan=14529	80.37076166666667	3	2776.222808	2775.240222	R	D	662	687
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	232	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	20-UNIMOD:21	ms_run[1]:scan=16345	91.5166	3	3418.607140	3417.603086	R	E	1323	1356
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	233	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=16859	94.86827333333333	3	3012.490298	3011.486600	R	V	276	304
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	234	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=12588	69.015785	3	2971.4230	2971.4211	K	H	206	232
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	235	sp|A0FGR8|ESYT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:35,4-UNIMOD:21,29-UNIMOD:35	ms_run[1]:scan=7810	43.709428333333335	3	3165.329061	3164.342775	K	A	688	720
PSM	SPSGSQRPSVSDDTEHLVNGR	236	sp|P16144-2|ITB4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=8207	45.80364166666667	2	2305.002014	2304.013182	R	M	1356	1377
PSM	AAFSKDESKEPIVEVR	237	sp|P13591-1|NCAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=9426	52.091	2	1883.903	1883.9030	K	T	767	783
PSM	EDGLLPKPLSSGGEEEEKPR	238	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=12227	67.031	3	2246.0468	2246.0468	K	G	617	637
PSM	EHAVEGDCDFQLLK	239	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=12911	70.873	2	1659.7563	1659.7563	K	L	107	121
PSM	GAQRLSLQPSSGEAAKPLGK	240	sp|Q14005-2|IL16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=8789	48.806	3	2074.0572	2074.0572	K	H	858	878
PSM	GFAFVTFDDHDSVDK	241	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16276	91.085	2	1698.7526	1698.7526	R	I	147	162
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	242	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=12257	67.196	3	2762.2735	2762.2735	K	Q	609	638
PSM	GGSLDINDGHCGTGLGSEMNAALMHR	243	sp|O75791-2|GRAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,11-UNIMOD:4,19-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=11366	62.309	3	2781.1306	2781.1306	R	R	121	147
PSM	GRLDSSEMDHSENEDYTMSSPLPGK	244	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,8-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=8839	49.077	3	2893.1419	2893.1419	K	K	1172	1197
PSM	HSISGPISTSKPLTALSDK	245	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=12712	69.758	3	2018.0085	2018.0085	R	R	886	905
PSM	IPIPETPPQTPPQVLDSPHQR	246	sp|Q969H4-2|CNKR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=14573	80.65	3	2426.1995	2426.1995	K	S	277	298
PSM	KLSDINQEEASGTSLHQK	247	sp|Q4L235-3|ACSF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=7217	40.659	3	2063.9525	2063.9525	R	A	647	665
PSM	KSEAGHASSPDSEVTSLCQK	248	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6987	39.4	3	2196.9358	2196.9358	K	E	352	372
PSM	KSEHPESSLSSEEETAGVENVK	249	sp|Q92932-2|PTPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=8679	48.242	3	2452.0643	2452.0643	K	S	427	449
PSM	LLPQLTYLDGYDRDDK	250	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17368	98.197	2	1923.9578	1923.9578	K	E	138	154
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	251	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=17098	96.424	3	3011.4866	3011.4866	R	V	276	304
PSM	PRPEAEPPSPPSGDLR	252	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=8378	46.693	2	1780.8145	1780.8145	K	L	77	93
PSM	PSLPAPESPGLPAHPSNPQLPEAR	253	sp|O43379|WDR62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=14119	77.908	3	2538.2268	2538.2268	R	P	1341	1365
PSM	RAEDGSVIDYELIDQDAR	254	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15106	83.85	2	2063.976	2063.9760	R	D	197	215
PSM	RPEGPGAQAPSSPR	255	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=1665	11.215	2	1485.6726	1485.6726	R	V	504	518
PSM	RPSLPSSPSPGLPK	256	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=11044	60.594	2	1498.7545	1498.7545	K	A	118	132
PSM	RQEEEAGALEAGEEAR	257	sp|Q7Z406-5|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5585	31.881	2	1743.8024	1743.8024	R	R	1396	1412
PSM	RSYEDDDDMDLQPNK	258	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35	ms_run[2]:scan=4521	26.495	2	1855.753	1855.7530	K	Q	166	181
PSM	RVIENADGSEEETDTR	259	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2672	16.841	2	1819.8184	1819.8184	R	D	1946	1962
PSM	SGKQSIAIDDCTFHQCVR	260	sp|Q96CW1-2|AP2M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=10415	57.338	3	2200.9395	2200.9395	K	L	234	252
PSM	SGRESVSTASDQPSHSLER	261	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=4293	25.314	2	2108.9124	2108.9124	R	Q	912	931
PSM	SHCIAEVENDEMPADLPSLAADFVESK	262	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=20946	123.71	3	2989.3321	2989.3321	K	D	311	338
PSM	SHTSLKDELSDVSQGGSK	263	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=9619	53.142	3	1953.8681	1953.8681	R	A	242	260
PSM	SKSYNTPLLNPVQEHEAEGAAAGGTSIR	264	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=14258	78.711	3	2976.3978	2976.3978	R	R	151	179
PSM	SLEAQAEKYSQKEDR	265	sp|P09493-9|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=4838	28.118	2	1860.8255	1860.8255	K	Y	206	221
PSM	SRTASLTSAASVDGNR	266	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=7353	41.359	2	1751.7241	1751.7241	R	S	285	301
PSM	SSSPEDPERDEEVLNHVLR	267	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=15583	86.762	2	2287.0118	2287.0118	R	D	229	248
PSM	TGSRPSSHGGGGPAAAEEEVR	268	sp|O75907|DGAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=3976	23.798	2	2087.9022	2087.9022	R	D	12	33
PSM	TITSAHTSSTSTSLESDSASPGVSDHGR	269	sp|Q5TH69|BIG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	20-UNIMOD:21	ms_run[2]:scan=6547	37.034	3	2854.2254	2854.2254	K	G	276	304
PSM	TLHSDDEGTVLDDSR	270	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6464	36.647	2	1658.7384	1658.7384	R	A	40	55
PSM	TSSKESSPIPSPTSDRK	271	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=4359	25.654	2	1882.8674	1882.8674	R	A	2159	2176
PSM	VEPPHSSHEDLTDGLSTR	272	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=7817	43.747	2	2055.8899	2055.8899	K	S	439	457
PSM	VEPPHSSHEDLTDGLSTR	273	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=8776	48.736	2	2055.8899	2055.8899	K	S	439	457
PSM	VFDEFKPLVEEPQNLIK	274	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19915	116.04	2	2044.0881	2044.0881	K	Q	397	414
PSM	VHNDAQSFDYDHDAFLGAEEAK	275	sp|O43852-12|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=14302	78.975	3	2558.0387	2558.0387	K	T	38	60
PSM	VVGSSPGHPAVQVESHSGGQK	276	sp|Q6AI39|BICRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=4142	24.572	3	2122.9797	2122.9797	K	R	671	692
PSM	YCRPESQEHPEADPGSAAPYLK	277	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=9867	54.432	3	2581.0945	2581.0945	K	T	686	708
PSM	KPSVGVPPPASPSYPR	278	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=8742	48.56158666666666	2	1714.845817	1714.844372	R	A	969	985
PSM	VNSNGKESPGSSEFFQEAVSHGK	279	sp|Q8N108|MIER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=12784	70.155185	3	2501.096558	2501.086012	R	F	481	504
PSM	QKSPLFQFAEISSSTSHSDASTK	280	sp|Q8WY36|BBX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18091	103.08101166666667	3	2545.1388	2545.1369	R	Q	241	264
PSM	RSSLPLDHGSPAQENPESEK	281	sp|Q5VZ89|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=7788	43.57996333333334	3	2256.997691	2257.001220	R	S	1276	1296
PSM	NVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLAR	282	sp|Q9BR76|COR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=12583	68.98989499999999	3	3617.678688	3617.678119	R	A	410	447
PSM	ILNNGHAFNVEFDDSQDK	283	sp|P00918|CAH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=15011	83.29292166666667	2	2063.926453	2061.939198	R	A	59	77
PSM	AFVDFLSDEIKEER	284	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19480	112.91	2	1696.8308	1696.8308	K	K	81	95
PSM	ALASEKSPTADAKPAPK	285	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=2279	14.737	2	1760.871	1760.8710	K	R	266	283
PSM	ALHSNQANAELTDDEHENESK	286	sp|Q5TB80-2|CE162_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=4278	25.235	3	2430.9925	2430.9925	K	H	89	110
PSM	AQNEFKDEAQSLSHSPK	287	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=8094	45.191	3	1994.8735	1994.8735	R	R	507	524
PSM	DADDAVYELNGK	288	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9770	53.945	2	1308.5834	1308.5834	R	E	47	59
PSM	DLTHSDSESSLHMSDR	289	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3618	21.909	2	1911.7306	1911.7306	R	Q	515	531
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	290	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=17449	98.749	3	3095.5805	3095.5805	R	A	642	673
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	291	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=13914	76.684	3	2842.2698	2842.2698	R	E	181	208
PSM	GVVDSDDLPLNVSR	292	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14041	77.444	2	1484.7471	1484.7471	K	E	435	449
PSM	HGLTSGSASPPPPALPLYPDPVR	293	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=17292	97.707	3	2405.1781	2405.1781	K	L	683	706
PSM	HPTPGSSDPLIQPSSPAVCPEPPSSPK	294	sp|P10636|TAU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=12429	68.167	3	2845.2994	2845.2994	K	Y	414	441
PSM	IHVSDQELQSANASVDDSR	295	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9649	53.301	3	2069.9614	2069.9614	K	L	767	786
PSM	IVTIHECDSGEASSATTPHPATSPK	296	sp|Q8N350-4|CBARP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=7465	41.941	3	2672.1789	2672.1789	K	A	178	203
PSM	IYHLPDAESDEDEDFK	297	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=13886	76.515	2	2001.7881	2001.7881	K	E	210	226
PSM	IYHLPDAESDEDEDFKEQTR	298	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=12457	68.306	2	2516.0381	2516.0381	K	L	210	230
PSM	IYHLPDAESDEDEDFKEQTR	299	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=13138	72.156	3	2516.0381	2516.0381	K	L	210	230
PSM	IYHLPDAESDEDEDFKEQTR	300	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=13322	73.163	3	2516.0381	2516.0381	K	L	210	230
PSM	KAEAAAAPTVAPGPAQPGHVSPTPATTSPGEK	301	sp|Q9Y6R0|NUMBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:21	ms_run[2]:scan=8081	45.129	3	3072.4917	3072.4917	K	G	243	275
PSM	KDSSGSVSPNTLSQEEGDQICLYHIR	302	sp|Q9H0J9|PAR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=15951	89.051	3	2999.3332	2999.3332	R	K	256	282
PSM	KPDGVKESTESSNTTIEDEDVK	303	sp|Q13557-8|KCC2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=5392	30.911	3	2487.0902	2487.0902	K	A	323	345
PSM	KPSVGVPPPASPSYPR	304	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=9130	50.595	2	1714.8444	1714.8444	R	A	969	985
PSM	KQSEADLAETRPDLK	305	sp|Q6UX15-3|LAYN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=7552	42.387	2	1779.8404	1779.8404	R	N	144	159
PSM	KQSFDDNDSEELEDKDSK	306	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=5273	30.293	2	2207.8743	2207.8743	K	S	105	123
PSM	KSDIDEIVLVGGSTR	307	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13723	75.547	2	1587.8468	1587.8468	K	I	353	368
PSM	KSLGDDISSETSGDFR	308	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11848	64.943	2	1712.7853	1712.7853	K	K	138	154
PSM	KSPVGKSPPSTGSTYGSSQK	309	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=3602	21.832	3	2058.9623	2058.9623	K	E	314	334
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIK	310	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=13972	77.034	3	2857.4627	2857.4627	K	K	69	99
PSM	KYTGEDFDEDLR	311	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9718	53.659	2	1486.6576	1486.6576	R	T	2966	2978
PSM	LGSASSSHGSIQESHK	312	sp|Q16566|KCC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=1338	9.5071	2	1690.7312	1690.7312	R	A	339	355
PSM	LPSSPVYEDAASFK	313	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=14569	80.624	2	1589.7015	1589.7015	R	A	415	429
PSM	PTTPLSVGTIVPPPRPASR	314	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:21	ms_run[2]:scan=14834	82.241	2	2022.0663	2022.0663	R	P	418	437
PSM	RLEEGTEETSETLEK	315	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5573	31.824	2	1749.8269	1749.8269	R	L	798	813
PSM	RLSVSESSHTESDSSPPMTVR	316	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=6237	35.393	3	2384.0315	2384.0315	K	R	907	928
PSM	RPEGPGAQAPSSPR	317	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=1839	12.227	2	1485.6726	1485.6726	R	V	504	518
PSM	RPEGPGAQAPSSPR	318	sp|P40222|TXLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=1998	13.24	2	1485.6726	1485.6726	R	V	504	518
PSM	SASTESGFHNHTDTAEGDVIAAAR	319	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=11038	60.569	3	2523.0663	2523.0663	R	D	78	102
PSM	SGEHDFGAAFDGDGDR	320	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9440	52.158	2	1651.6499	1651.6499	K	N	296	312
PSM	SHSSPSLHQDEAPTTAK	321	sp|Q8NDX1-2|PSD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=3149	19.415	3	1871.8051	1871.8051	K	V	988	1005
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	322	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=7610	42.675	2	2455.0765	2455.0765	R	S	283	308
PSM	SPEKIEEVLSPEGSPSKSPSK	323	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	18-UNIMOD:21	ms_run[2]:scan=10666	58.66	3	2291.0934	2291.0934	K	K	632	653
PSM	SRPALSPLGDIDFCPPNPGPDGPR	324	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=19007	109.53	3	2611.189	2611.1890	R	R	1130	1154
PSM	TGSDHTNPTSPLLVKPSDLLEENK	325	sp|Q96D71-4|REPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=16742	94.118	3	2671.2742	2671.2742	R	I	446	470
PSM	VAELSSDDFHLDR	326	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12677	69.571	2	1502.7001	1502.7001	R	H	298	311
PSM	VASEAPLEHKPQVEASSPR	327	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=6335	35.933	2	2111.0048	2111.0048	K	L	853	872
PSM	VKVEPADSVESSPPSITHSPQNELK	328	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=11460	62.792	3	2754.3113	2754.3113	K	G	408	433
PSM	VTHETSAHEGQTEAPSIDEK	329	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=3787	22.798	3	2244.9536	2244.9536	R	V	146	166
PSM	VVGSVGQHTGEPVEELALSHCGR	330	sp|Q9H6Y2-2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	19-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12361	67.776	3	2497.1421	2497.1421	R	F	68	91
PSM	YKDDDDDQLFYTR	331	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10926	59.98	2	1692.7267	1692.7267	K	L	185	198
PSM	SPPDQPAVPHPPPSTPIK	332	sp|P35611|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=9062	50.256593333333335	2	1940.931185	1940.939729	K	L	600	618
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	333	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=18838	108.34518999999999	3	3063.545907	3062.559037	K	A	477	506
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	334	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=18400	105.17353333333332	3	3063.561239	3062.559037	K	A	477	506
PSM	LSPFHGSSPPQSTPLSPPPLTPK	335	sp|Q9H7D0|DOCK5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=15305	85.01457666666667	3	2448.211890	2448.209028	R	A	1774	1797
PSM	QVSASELHTSGILGPETLR	336	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18632	106.91058999999998	2	2056.9832	2056.9825	R	D	2716	2735
PSM	KPTDGASSSNCVTDISHLVR	337	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=13494	74.17005	3	2224.007637	2222.999112	R	K	698	718
PSM	QGLPSPPGTPHSPSYAGPK	338	sp|Q9ULC8|ZDHC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=12496	68.51148	2	1936.8742	1936.8715	R	A	671	690
PSM	KLEDEILVMDDQNNK	339	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:35	ms_run[1]:scan=10514	57.847546666666666	2	1819.852195	1818.866944	K	L	982	997