MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr15.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr15.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	417-UNIMOD:21,416-UNIMOD:21,419-UNIMOD:21	0.06	43.0	4	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	942-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|P08235-2|MCR_HUMAN	Isoform 2 of Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	250-UNIMOD:21,268-UNIMOD:35	0.03	43.0	2	1	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q9Y6R0|NUMBL_HUMAN	Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	263-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	21-UNIMOD:21,27-UNIMOD:21,25-UNIMOD:21	0.07	42.0	8	1	0
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	295-UNIMOD:21,294-UNIMOD:21	0.03	41.0	2	1	0
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	2	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	373-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|P48551|INAR2_HUMAN	Interferon alpha/beta receptor 2 OS=Homo sapiens OX=9606 GN=IFNAR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	400-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	328-UNIMOD:21,332-UNIMOD:21	0.05	41.0	3	1	0
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	199-UNIMOD:4,216-UNIMOD:21,217-UNIMOD:21,215-UNIMOD:21,214-UNIMOD:21,210-UNIMOD:21	0.05	41.0	9	1	0
PRT	sp|Q96NW4|ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1023-UNIMOD:21,962-UNIMOD:21	0.05	40.0	3	2	1
PRT	sp|Q8TEW8-5|PAR3L_HUMAN	Isoform 5 of Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	141-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	614-UNIMOD:21	0.03	40.0	3	1	0
PRT	sp|Q9NVZ3-4|NECP2_HUMAN	Isoform 4 of Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	155-UNIMOD:21	0.08	40.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	246-UNIMOD:35	0.05	39.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1001-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	363-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q8N4C8-5|MINK1_HUMAN	Isoform 5 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	706-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q15154-5|PCM1_HUMAN	Isoform 5 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1177-UNIMOD:35,1187-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P16157|ANK1_HUMAN	Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1666-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	688-UNIMOD:21,695-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	38.0	9	2	1
PRT	sp|Q8IY26|PLPP6_HUMAN	Phospholipid phosphatase 6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	8-UNIMOD:35,26-UNIMOD:21	0.11	38.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	817-UNIMOD:21	0.01	38.0	1	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	227-UNIMOD:21	0.01	37.0	3	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	37.0	3	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	109-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	805-UNIMOD:21	0.01	37.0	3	1	0
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	776-UNIMOD:21,788-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	240-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P00915|CAH1_HUMAN	Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	51-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1308-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q7KZI7-10|MARK2_HUMAN	Isoform 10 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	347-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q13029-5|PRDM2_HUMAN	Isoform 5 of PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	222-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1186-UNIMOD:21,1208-UNIMOD:35,1267-UNIMOD:21	0.04	36.0	2	2	2
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1456-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	37-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q9BX66-3|SRBS1_HUMAN	Isoform 3 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	281-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9P0L2|MARK1_HUMAN	Serine/threonine-protein kinase MARK1 OS=Homo sapiens OX=9606 GN=MARK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	394-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9BYB0-3|SHAN3_HUMAN	Isoform 2 of SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1517-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	830-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	36-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	662-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9P0K7-3|RAI14_HUMAN	Isoform 3 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	281-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	527-UNIMOD:21,538-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	230-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q53SF7|COBL1_HUMAN	Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	814-UNIMOD:21,819-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	437-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	211-UNIMOD:21,208-UNIMOD:21	0.09	34.0	2	1	0
PRT	sp|Q9Y6R1-3|S4A4_HUMAN	Isoform 3 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	218-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O15117-3|FYB1_HUMAN	Isoform 3 of FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	219-UNIMOD:21,226-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	966-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1173-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	8-UNIMOD:21	0.11	34.0	1	1	1
PRT	sp|Q5VZ89-3|DEN4C_HUMAN	Isoform 3 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1099-UNIMOD:21,1105-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	447-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	331-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	39-UNIMOD:385,39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1176-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	332-UNIMOD:21,5841-UNIMOD:21	0.01	33.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1268-UNIMOD:21	0.00	33.0	1	1	1
PRT	sp|P35749-4|MYH11_HUMAN	Isoform 4 of Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1034-UNIMOD:21,1035-UNIMOD:35	0.01	33.0	2	2	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1612-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	87-UNIMOD:21	0.17	33.0	2	1	0
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	218-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|Q9ULC5-3|ACSL5_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens OX=9606 GN=ACSL5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	44-UNIMOD:21,39-UNIMOD:21	0.24	33.0	2	1	0
PRT	sp|Q9NZN5-2|ARHGC_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1157-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	207-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	108-UNIMOD:4,128-UNIMOD:21	0.22	33.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	635-UNIMOD:21,2779-UNIMOD:21	0.01	33.0	2	2	2
PRT	sp|P48553|TPC10_HUMAN	Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	709-UNIMOD:21,714-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	645-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	122-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q68EM7-2|RHG17_HUMAN	Isoform 2 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	596-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q5BJD5-3|TM41B_HUMAN	Isoform 3 of Transmembrane protein 41B OS=Homo sapiens OX=9606 GN=TMEM41B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	17-UNIMOD:21	0.16	33.0	1	1	1
PRT	sp|P40763-2|STAT3_HUMAN	Isoform Del-701 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	687-UNIMOD:4,704-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	33.0	1	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	8	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	163-UNIMOD:21,164-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|P22466|GALA_HUMAN	Galanin peptides OS=Homo sapiens OX=9606 GN=GAL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	72-UNIMOD:35,76-UNIMOD:21	0.13	32.0	2	1	0
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q63ZY3-3|KANK2_HUMAN	Isoform 3 of KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	540-UNIMOD:21,369-UNIMOD:35,375-UNIMOD:21	0.05	32.0	2	2	2
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1327-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	391-UNIMOD:35,404-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	237-UNIMOD:21,235-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	112-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	32.0	2	1	0
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	94-UNIMOD:21,138-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|Q9H0E3-2|SP130_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	415-UNIMOD:35,416-UNIMOD:35,420-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q15746-11|MYLK_HUMAN	Isoform 9 of Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	851-UNIMOD:21,856-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	297-UNIMOD:35,300-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P53814-5|SMTN_HUMAN	Isoform B2 of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	523-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q6N043-3|Z280D_HUMAN	Isoform 3 of Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	104-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q9NR16|C163B_HUMAN	Scavenger receptor cysteine-rich type 1 protein M160 OS=Homo sapiens OX=9606 GN=CD163L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1402-UNIMOD:21,1411-UNIMOD:35,1414-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q92794|KAT6A_HUMAN	Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1861-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|O75907|DGAT1_HUMAN	Diacylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=DGAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	18-UNIMOD:21,17-UNIMOD:21	0.05	32.0	3	1	0
PRT	sp|Q8N960-2|CE120_HUMAN	Isoform 2 of Centrosomal protein of 120 kDa OS=Homo sapiens OX=9606 GN=CEP120	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	354-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q7Z3J2-2|VP35L_HUMAN	Isoform 2 of VPS35 endosomal protein sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	214-UNIMOD:21,216-UNIMOD:21,217-UNIMOD:21	0.07	32.0	4	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.11	32.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q8IY33|MILK2_HUMAN	MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	723-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	665-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q8N111|CEND_HUMAN	Cell cycle exit and neuronal differentiation protein 1 OS=Homo sapiens OX=9606 GN=CEND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	86-UNIMOD:21	0.20	31.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	626-UNIMOD:21,544-UNIMOD:21	0.05	31.0	3	2	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	181-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q8NHM5-4|KDM2B_HUMAN	Isoform 4 of Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	416-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	263-UNIMOD:21,270-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	202-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|P55317-2|FOXA1_HUMAN	Isoform 2 of Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	274-UNIMOD:21,268-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	994-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q14141-2|SEPT6_HUMAN	Isoform I of Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	388-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	342-UNIMOD:21,350-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P29474-3|NOS3_HUMAN	Isoform eNOS13B of Nitric oxide synthase, endothelial OS=Homo sapiens OX=9606 GN=NOS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	114-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	522-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	294-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	419-UNIMOD:21,455-UNIMOD:21	0.06	31.0	2	2	2
PRT	sp|Q8NBJ4-2|GOLM1_HUMAN	Isoform 2 of Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	245-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	362-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q14802|FXYD3_HUMAN	FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	81-UNIMOD:21,84-UNIMOD:21	0.23	31.0	3	1	0
PRT	sp|Q6P3W7|SCYL2_HUMAN	SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	708-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	385-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.21	31.0	2	2	2
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	227-UNIMOD:35,231-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q15661-2|TRYB1_HUMAN	Isoform 2 of Tryptase alpha/beta-1 OS=Homo sapiens OX=9606 GN=TPSAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	206-UNIMOD:28,224-UNIMOD:21,1952-UNIMOD:21	0.02	31.0	2	2	2
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	462-UNIMOD:21	0.05	31.0	1	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	52-UNIMOD:27,57-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|O00255|MEN1_HUMAN	Menin OS=Homo sapiens OX=9606 GN=MEN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	492-UNIMOD:21	0.02	31.0	1	1	0
PRT	sp|P16333|NCK1_HUMAN	Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	85-UNIMOD:21	0.06	31.0	2	2	1
PRT	sp|Q9BXD5|NPL_HUMAN	N-acetylneuraminate lyase OS=Homo sapiens OX=9606 GN=NPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	271-UNIMOD:21,274-UNIMOD:21,278-UNIMOD:35,289-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	963-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	888-UNIMOD:35,892-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	281-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	30.0	1	1	0
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	173-UNIMOD:4,181-UNIMOD:21,194-UNIMOD:4,108-UNIMOD:21	0.18	30.0	2	2	2
PRT	sp|Q8WXH0-12|SYNE2_HUMAN	Isoform 12 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	23-UNIMOD:21,28-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	641-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|P78536|ADA17_HUMAN	Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	735-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	378-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	544-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q7Z3V4-2|UBE3B_HUMAN	Isoform 2 of Ubiquitin-protein ligase E3B OS=Homo sapiens OX=9606 GN=UBE3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	419-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5T5C0-2|STXB5_HUMAN	Isoform 2 of Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	723-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q96PY6-4|NEK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	786-UNIMOD:4,799-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	384-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	297-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	265-UNIMOD:35,267-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1090-UNIMOD:35,1101-UNIMOD:21,1085-UNIMOD:28	0.01	30.0	2	1	0
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	596-UNIMOD:21,599-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:21,116-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|Q92796-3|DLG3_HUMAN	Isoform 3 of Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	222-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|O00255-3|MEN1_HUMAN	Isoform 3 of Menin OS=Homo sapiens OX=9606 GN=MEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	452-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q9UQ88-4|CD11A_HUMAN	Isoform SV3 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	726-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	467-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q8NFZ4|NLGN2_HUMAN	Neuroligin-2 OS=Homo sapiens OX=9606 GN=NLGN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	713-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P16157-10|ANK1_HUMAN	Isoform Er9 of Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1666-UNIMOD:21	0.01	30.0	1	1	0
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	433-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	11-UNIMOD:21,26-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	391-UNIMOD:21,400-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	324-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|O00499-6|BIN1_HUMAN	Isoform II2 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	300-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	2033-UNIMOD:21,2152-UNIMOD:21,2160-UNIMOD:4	0.02	30.0	2	2	1
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	753-UNIMOD:28,755-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	155-UNIMOD:21,473-UNIMOD:21	0.05	30.0	2	2	2
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	6350-UNIMOD:4,6361-UNIMOD:21,6367-UNIMOD:35	0.00	30.0	1	1	1
PRT	sp|Q9NZ52|GGA3_HUMAN	ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	530-UNIMOD:21,537-UNIMOD:21,543-UNIMOD:21,544-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	295-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q92608|DOCK2_HUMAN	Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1730-UNIMOD:35,1731-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	337-UNIMOD:21,339-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	462-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P40692-2|MLH1_HUMAN	Isoform 2 of DNA mismatch repair protein Mlh1 OS=Homo sapiens OX=9606 GN=MLH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	236-UNIMOD:21,240-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q9Y2J4-3|AMOL2_HUMAN	Isoform 3 of Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	600-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|O95503|CBX6_HUMAN	Chromobox protein homolog 6 OS=Homo sapiens OX=9606 GN=CBX6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	106-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	310-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	143-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	320-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	18-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	533-UNIMOD:35,542-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1015-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P55201-4|BRPF1_HUMAN	Isoform 4 of Peregrin OS=Homo sapiens OX=9606 GN=BRPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	462-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	41-UNIMOD:21	0.15	29.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	126-UNIMOD:21,120-UNIMOD:21,123-UNIMOD:21	0.04	29.0	2	2	2
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1163-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	210-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P35568|IRS1_HUMAN	Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	530-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	778-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	487-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.16	29.0	1	1	1
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	877-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	859-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|O14656-2|TOR1A_HUMAN	Isoform 2 of Torsin-1A OS=Homo sapiens OX=9606 GN=TOR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	51-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|A6NEL2|SWAHB_HUMAN	Ankyrin repeat domain-containing protein SOWAHB OS=Homo sapiens OX=9606 GN=SOWAHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	258-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	821-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q7Z401|MYCPP_HUMAN	C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	897-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q13477-4|MADCA_HUMAN	Isoform 4 of Mucosal addressin cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=MADCAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	176-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	265-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|O15061|SYNEM_HUMAN	Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1181-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P51957-3|NEK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	550-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	428-UNIMOD:4,433-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	979-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	365-UNIMOD:21,369-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	667-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q5HYK7-3|SH319_HUMAN	Isoform 3 of SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	148-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8N468-2|MFD4A_HUMAN	Isoform 2 of Major facilitator superfamily domain-containing protein 4A OS=Homo sapiens OX=9606 GN=MFSD4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	403-UNIMOD:35,412-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8IWA5-3|CTL2_HUMAN	Isoform 3 of Choline transporter-like protein 2 OS=Homo sapiens OX=9606 GN=SLC44A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	686-UNIMOD:35,687-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q86SJ2|AMGO2_HUMAN	Amphoterin-induced protein 2 OS=Homo sapiens OX=9606 GN=AMIGO2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	434-UNIMOD:35,442-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q9Y3Q8-2|T22D4_HUMAN	Isoform 2 of TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	25-UNIMOD:21	0.12	28.0	1	1	1
PRT	sp|A6NDB9|PALM3_HUMAN	Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	124-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|O14558|HSPB6_HUMAN	Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	16-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|Q8IUW3|SPA2L_HUMAN	Spermatogenesis-associated protein 2-like protein OS=Homo sapiens OX=9606 GN=SPATA2L PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	317-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1121-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	328-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9BWT3-2|PAPOG_HUMAN	Isoform 2 of Poly(A) polymerase gamma OS=Homo sapiens OX=9606 GN=PAPOLG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	686-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	160-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9BZF9-2|UACA_HUMAN	Isoform 2 of Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1340-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1084-UNIMOD:21	0.00	28.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	95-UNIMOD:21,97-UNIMOD:35,123-UNIMOD:35	0.10	28.0	1	1	1
PRT	sp|Q5VWN6-2|TASO2_HUMAN	Isoform 2 of Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1232-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	556-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q96CC6|RHDF1_HUMAN	Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	51-UNIMOD:21,52-UNIMOD:35,61-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9H2S9-2|IKZF4_HUMAN	Isoform 2 of Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	200-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	479-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	587-UNIMOD:21,596-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P49916|DNLI3_HUMAN	DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	227-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P55317|FOXA1_HUMAN	Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	307-UNIMOD:21	0.04	28.0	1	1	0
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	290-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9UPQ3|AGAP1_HUMAN	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	415-UNIMOD:21,417-UNIMOD:4,421-UNIMOD:21,425-UNIMOD:21,429-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|O15031|PLXB2_HUMAN	Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	968-UNIMOD:21,978-UNIMOD:21,979-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|O00429-5|DNM1L_HUMAN	Isoform 5 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	533-UNIMOD:21,534-UNIMOD:21,559-UNIMOD:21,560-UNIMOD:21	0.05	28.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=12038	70.03	3	2574.2228	2574.2228	K	K	408	434
PSM	LKDLGHPVEEEDELESGDQEDEDDESEDPGK	2	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=9965	57.747	3	3563.4108	3563.4108	K	D	927	958
PSM	SHSPAHASNVGSPLSSPLSSMK	3	sp|P08235-2|MCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8686	50.713	2	2273.0148	2273.0148	R	S	248	270
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	4	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5830	34.64461	3	3007.3351	3007.3290	K	S	145	174
PSM	KAEAAAAPTVAPGPAQPGHVSPTPATTSPGEK	5	sp|Q9Y6R0|NUMBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	21-UNIMOD:21	ms_run[2]:scan=7597	44.655	3	3072.4917	3072.4917	K	G	243	275
PSM	RKPSVPDSASPADDSFVDPGER	6	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=10607	61.348	3	2408.0645	2408.0645	K	L	18	40
PSM	KADTTTPTTIDPIHEPPSLPPEPK	7	sp|O60885-2|BRD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=13115	77.297	3	2661.2939	2661.2939	R	T	291	315
PSM	KEEEEEEEEYDEGSNLKK	8	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=4498	27.332	2	2212.9495	2212.9495	K	Q	230	248
PSM	KSNLDEEVNVIPPHTPVR	9	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=10610	61.364	2	2123.0412	2123.0412	R	T	359	377
PSM	RKSPLQDPFPEEDYSSTEGSGGR	10	sp|P48551|INAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=11215	64.951	3	2618.1286	2618.1286	R	I	398	421
PSM	SLNSTPPPPPAPAPAPPPALAR	11	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=12143	70.688	2	2195.114	2195.1140	R	P	328	350
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	12	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=10668	61.738	3	2814.2433	2814.2433	R	G	194	223
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	13	sp|Q96NW4|ANR27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=12048	70.09	3	3054.4408	3054.4408	R	S	1021	1050
PSM	RKPSVPDSASPADDSFVDPGER	14	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=9631	55.905	3	2408.0645	2408.0645	K	L	18	40
PSM	RSSDPVPGPPADTQPSASHPGGQSLK	15	sp|Q8TEW8-5|PAR3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=7519	44.22	3	2649.2184	2649.2184	R	L	139	165
PSM	SPPDQPAVPHPPPSTPIK	16	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=8736	50.983	2	1940.9397	1940.9397	K	L	600	618
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	17	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=11013	63.76	3	2814.2433	2814.2433	R	G	194	223
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	18	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=11182	64.765	3	2814.2433	2814.2433	R	G	194	223
PSM	VRPASTGGLSLLPPPPGGK	19	sp|Q9NVZ3-4|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=13967	83.213	2	1879.9921	1879.9921	R	T	151	170
PSM	DPDAQPGGELMLGGTDSK	20	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=9317	54.15	2	1802.7993	1802.7993	R	Y	236	254
PSM	EDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR	21	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	32-UNIMOD:21	ms_run[2]:scan=9828	57.018	3	3548.6573	3548.6573	R	G	970	1004
PSM	GHTDTEGRPPSPPPTSTPEK	22	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=3554	22.22	2	2166.9583	2166.9583	R	C	353	373
PSM	RKPSVPDSASPADDSFVDPGER	23	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=10070	58.314	3	2408.0645	2408.0645	K	L	18	40
PSM	RKPSVPDSASPADDSFVDPGER	24	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=10242	59.322	3	2408.0645	2408.0645	K	L	18	40
PSM	RKPSVPDSASPADDSFVDPGER	25	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=10423	60.336	3	2408.0645	2408.0645	K	L	18	40
PSM	SDSVLPASHGHLPQAGSLER	26	sp|Q8N4C8-5|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=10853	62.841	2	2136.9953	2136.9953	R	N	690	710
PSM	TEYMAFPKPFESSSSIGAEKPR	27	sp|Q15154-5|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=13064	76.96	3	2554.1451	2554.1451	K	N	1174	1196
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	28	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=11841	68.829	3	2814.2433	2814.2433	R	G	194	223
PSM	RQDDATGAGQDSENEVSLVSGHQR	29	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=7533	44.296726666666665	3	2636.115533	2635.125980	K	G	1655	1679
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	30	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=12200	71.047	3	2574.2228	2574.2228	K	K	408	434
PSM	GVPHPEDDHSQVEGPESLR	31	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=8053	47.249	2	2163.9222	2163.9222	K	-	679	698
PSM	KEEEEEEEEYDEGSNLKK	32	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=4473	27.196	3	2212.9495	2212.9495	K	Q	230	248
PSM	RAPSVANVGSHCDLSLK	33	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9341	54.294	2	1889.8819	1889.8819	R	I	2141	2158
PSM	SLNSTPPPPPAPAPAPPPALAR	34	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11980	69.675	2	2195.114	2195.1140	R	P	328	350
PSM	SMEGRPLGVSASSSSSSPGSPAHGGGGGGSR	35	sp|Q8IY26|PLPP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=4004	24.693	3	2852.2145	2852.2145	R	F	7	38
PSM	SAPTAPTPPPPPPPATPR	36	sp|Q14202|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=7760	45.57903833333334	2	1828.898980	1827.892051	R	K	811	829
PSM	ELEKPIQSKPQSPVIQAAAVSPK	37	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:21	ms_run[2]:scan=10052	58.221	3	2524.3302	2524.3302	R	F	207	230
PSM	HIKEEPLSEEEPCTSTAIASPEK	38	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9878	57.294	2	2661.1881	2661.1881	K	K	495	518
PSM	KLSVPTSDEEDEVPAPKPR	39	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=9538	55.384	2	2173.0304	2173.0304	K	G	103	122
PSM	KSNLDEEVNVIPPHTPVR	40	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=10779	62.38	2	2123.0412	2123.0412	R	T	359	377
PSM	RKPSVPDSASPADDSFVDPGER	41	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=9881	57.309	3	2408.0645	2408.0645	K	L	18	40
PSM	SAPTAPTPPPPPPPATPR	42	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=7942	46.609	2	1827.892	1827.8921	R	K	799	817
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	43	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=10837	62.75	3	2814.2433	2814.2433	R	G	194	223
PSM	VRSPDEALPGGLSGCSSGSGHSPYALER	44	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=12660	74.162	3	2922.2967	2922.2968	R	A	774	802
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	45	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=12110	70.49	2	2574.2228	2574.2228	K	K	408	434
PSM	APEPHVEEDDDDELDSK	46	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6249	37.113	2	1938.7967	1938.7967	K	L	5	22
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	47	sp|Q9BUJ2-5|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21	ms_run[2]:scan=9864	57.209	3	3407.6452	3407.6452	R	N	215	246
PSM	GIRPFPSEETTENDDDVYR	48	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11042	63.918	2	2239.0029	2239.0029	K	S	125	144
PSM	GLQAQIASSGLTVEVDAPK	49	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15157	92.107	2	1883	1883.0000	K	S	223	242
PSM	HDTSLKPISVSYNPATAK	50	sp|P00915|CAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=10600	61.308	3	2007.9667	2007.9667	K	E	41	59
PSM	HIKEEPLSEEEPCTSTAIASPEK	51	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10060	58.255	3	2661.1881	2661.1881	K	K	495	518
PSM	HPPLYQAGLTPPLSPPK	52	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=14240	85.146	2	1891.9597	1891.9597	R	S	1295	1312
PSM	PRPSADLTNSSAPSPSHK	53	sp|Q7KZI7-10|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=3855	23.919	2	1927.8789	1927.8789	K	V	344	362
PSM	RKPSQTLQPSEDLADGK	54	sp|Q13029-5|PRDM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=6491	38.456	2	1948.9255	1948.9255	K	A	217	234
PSM	RKSEDGTPAEDGTPAATGGSQPPSMGR	55	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[2]:scan=3275	20.702	3	2752.176	2752.1760	K	K	1184	1211
PSM	RNSVERPAEPVAGAATPSLVEQQK	56	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9877	57.29	3	2613.2912	2613.2912	R	M	1454	1478
PSM	RSNSAPLIHGLSDTSPVFQAEAPSAR	57	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=15363	93.671	3	2787.3341	2787.3341	R	R	34	60
PSM	RVGEQDSAPTQEKPTSPGK	58	sp|Q9BX66-3|SRBS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=1494	10.548	2	2090.9634	2090.9634	R	A	266	285
PSM	SRPSSDLNNSTLQSPAHLK	59	sp|Q9P0L2|MARK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=8699	50.778	3	2131.0059	2131.0059	R	V	390	409
PSM	SRSPSPSPLPSPASGPGPGAPGPR	60	sp|Q9BYB0-3|SHAN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9422	54.775	3	2289.0903	2289.0903	R	R	1515	1539
PSM	STAQQELDGKPASPTPVIVASHTANK	61	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=8774	51.195	3	2726.3276	2726.3276	R	E	818	844
PSM	FLQEHGSDSFLAEHK	62	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=10455	60.489	2	1823.788	1823.7880	K	L	28	43
PSM	GPKPEPPGSGSPAPPR	63	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=3269	20.673	2	1606.7505	1606.7505	R	R	652	668
PSM	KAPPPPISPTQLSDVSSPR	64	sp|Q9P0K7-3|RAI14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=11281	65.368	3	2053.0245	2053.0245	R	S	266	285
PSM	KPGDGEVSPSTEDAPFQHSPLGK	65	sp|O60318|GANP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=11462	66.442	3	2459.1006	2459.1006	K	A	520	543
PSM	RAPSVANVGSHCDLSLK	66	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9526	55.306	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RAPSVANVGSHCDLSLK	67	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9707	56.332	2	1889.8819	1889.8819	R	I	2141	2158
PSM	SSSPAPADIAQTVQEDLR	68	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=17486	110.45	2	1963.8888	1963.8888	K	T	230	248
PSM	TEHQVPSSVSSPDDAMVSPLKPAPK	69	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=8974	52.291	3	2699.2514	2699.2514	R	M	804	829
PSM	RQDDATGAGQDSENEVSLVSGHQR	70	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=7715	45.306125	3	2636.115238	2635.125980	K	G	1655	1679
PSM	HIKEEPLSEEEPCTSTAIASPEK	71	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9868	57.233	3	2661.1881	2661.1881	K	K	495	518
PSM	HIVSNDSSDSDDESHEPK	72	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=1144	8.6128	3	2076.791	2076.7910	K	G	428	446
PSM	LLKPGEEPSEYTDEEDTK	73	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=8156	47.855	3	2158.9195	2158.9195	R	D	200	218
PSM	NLTSSSLNDISDKPEK	74	sp|Q9Y6R1-3|S4A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=8379	49.059	2	1826.8299	1826.8299	R	D	208	224
PSM	PAFGQKPPLSTENSHEDESPMK	75	sp|O15117-3|FYB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=7547	44.368	3	2521.0832	2521.0832	K	N	206	228
PSM	PRLSLHEEEGSSGSEQK	76	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=5249	31.379	2	1948.8528	1948.8528	K	Q	963	980
PSM	RTHSDASDDEAFTTSK	77	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=2560	16.744	3	1846.7371	1846.7371	R	T	1170	1186
PSM	SLSTSGESLYHVLGLDK	78	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=19179	124.51	2	1884.887	1884.8870	R	N	8	25
PSM	STAQQELDGKPASPTPVIVASHTANK	79	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=9490	55.103	3	2726.3276	2726.3276	R	E	818	844
PSM	THSFENVSCHLPDSR	80	sp|Q5VZ89-3|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8857	51.651	2	1864.7564	1864.7564	R	T	1097	1112
PSM	TKPTQAAGPSSPQKPPTPEETK	81	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=3429	21.522	3	2356.1312	2356.1312	K	A	437	459
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	82	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=10493	60.717	3	2814.2433	2814.2433	R	G	194	223
PSM	VRPASTGGLSLLPPPPGGK	83	sp|Q9NVZ3-4|NECP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=14112	84.226	2	1879.9921	1879.9921	R	T	151	170
PSM	VNHEPEPAGGATPGATLPKSPSQLR	84	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	20-UNIMOD:21	ms_run[1]:scan=10190	59.013328333333334	3	2591.243249	2590.254081	R	K	312	337
PSM	CRNSIASCADEQPHIGNYR	85	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=10878	62.99916833333334	3	2309.9283	2309.9302	R	L	39	58
PSM	LKEEQHGISVTGLQSPDR	86	sp|Q9NZN5|ARHGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=8946	52.13025	3	2073.991673	2072.989199	K	D	1162	1180
PSM	AGLRVSAPEVSVGHK	87	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=9334	54.249	2	1585.7978	1585.7978	K	G	327	342
PSM	DASDDLDDLNFFNQK	88	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18044	115.09	2	1755.7588	1755.7588	K	K	65	80
PSM	GVVDSDDLPLNVSR	89	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13145	77.487	2	1484.7471	1484.7471	K	E	435	449
PSM	HGSFHEDEDPIGSPR	90	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=6881	40.627	2	1758.6999	1758.6999	R	L	1266	1281
PSM	HISTLNIQLSDSK	91	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10533	60.921	2	1454.7729	1454.7729	R	K	1365	1378
PSM	HVFGESDELIGQK	92	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9693	56.266	2	1457.7151	1457.7151	R	V	138	151
PSM	IILNSHSPAGSAAISQQDFHPK	93	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=11451	66.383	3	2397.1478	2397.1478	R	C	1606	1628
PSM	ILGSASPEEEQEKPILDRPTR	94	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=10430	60.371	2	2444.1948	2444.1948	R	I	82	103
PSM	IYHLPDAESDEDEDFK	95	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=12972	76.316	2	2001.7881	2001.7881	K	E	210	226
PSM	KNSEPGSPHSLEALR	96	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=7544	44.352	2	1700.7883	1700.7883	R	D	26	41
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	97	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=10523	60.867	3	2637.3415	2637.3415	R	R	31	56
PSM	LKEEQHGISVTGLQSPDR	98	sp|Q9NZN5-2|ARHGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=8772	51.183	2	2072.9892	2072.9892	K	D	1143	1161
PSM	LNHVAAGLVSPSLK	99	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=11088	64.194	2	1484.7752	1484.7752	K	S	198	212
PSM	LRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGR	100	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4,32-UNIMOD:21	ms_run[2]:scan=9563	55.533	3	3372.5154	3372.5154	R	K	97	131
PSM	RLSESLHVVDENK	101	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=8518	49.82	2	1604.756	1604.7560	R	N	633	646
PSM	RQESSSSLEMPSGVALEEGAHVLR	102	sp|P48553|TPC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14025	83.588	3	2664.2215	2664.2215	R	C	705	729
PSM	RRPSDENTIAPSEVQK	103	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=3888	24.072	2	1905.8946	1905.8946	R	W	638	654
PSM	RVTQHESDNENEIQIQNK	104	sp|Q5VZL5-2|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=4362	26.588	2	2261.0074	2261.0074	R	L	116	134
PSM	SPPDQPAVPHPPPSTPIK	105	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=8548	49.98	2	1940.9397	1940.9397	K	L	600	618
PSM	SPPDQPAVPHPPPSTPIK	106	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=8924	52.013	2	1940.9397	1940.9397	K	L	600	618
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	107	sp|Q68EM7-2|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=8796	51.314	3	2686.2501	2686.2501	R	R	596	622
PSM	SQLGAHHTTPVGDGAAGTR	108	sp|Q5BJD5-3|TM41B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=2444	16.136	2	1911.8589	1911.8589	R	G	10	29
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	109	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12169	70.842	3	2814.2433	2814.2433	R	G	194	223
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	110	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=12316	71.856	3	2814.2433	2814.2433	R	G	194	223
PSM	YCRPESQEHPEADPGAAPYLK	111	sp|P40763-2|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=7294	42.926	3	2494.0624	2494.0624	K	T	686	707
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	112	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14095	84.09525	3	3442.4060	3442.4027	K	L	104	135
PSM	ELEKPIQSKPQSPVIQAAAVSPK	113	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	21-UNIMOD:21	ms_run[1]:scan=10504	60.77437166666667	3	2525.321181	2524.330206	R	F	207	230
PSM	DRDDFPVVLVGNK	114	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13600	80.586	2	1472.7623	1472.7623	K	A	131	144
PSM	DRSSPPPGYIPDELHQVAR	115	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=12694	74.413	3	2213.0266	2213.0266	R	N	161	180
PSM	DRSVPNLTEGSLHEPGR	116	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9792	56.825	2	1942.8898	1942.8898	R	Q	960	977
PSM	ELRPEDDMKPGSFDR	117	sp|P22466|GALA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=6103	36.275	2	1886.787	1886.7870	R	S	65	80
PSM	ERDHSPTPSVFNSDEER	118	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6686	39.563	2	2080.8487	2080.8487	R	Y	414	431
PSM	ERVPSVAEAPQLRPAGTAAAK	119	sp|Q63ZY3-3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=9837	57.078	2	2198.1209	2198.1209	R	T	536	557
PSM	FTGSFDDDPDPHRDPYGEEVDR	120	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=11030	63.859	3	2645.0344	2645.0344	R	R	1324	1346
PSM	GMKDDKEEEEDGTGSPQLNNR	121	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=2158	14.509	3	2443.9799	2443.9799	K	-	390	411
PSM	HQASDSENEELPKPR	122	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=3494	21.903	2	1815.7789	1815.7789	R	I	232	247
PSM	IHIDPEIQDGSPTTSR	123	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=9553	55.464	2	1844.8306	1844.8306	R	R	102	118
PSM	IRLDETDDPDDYGDR	124	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8768	51.165	2	1793.7704	1793.7704	K	E	399	414
PSM	KAPPPPISPTQLSDVSSPR	125	sp|Q9P0K7-3|RAI14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=11330	65.659	2	2053.0245	2053.0245	R	S	266	285
PSM	KLSVPTSDEEDEVPAPKPR	126	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=9599	55.738	3	2173.0304	2173.0304	K	G	103	122
PSM	KPRPSEGDEDCLPASK	127	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3000	19.102	3	1864.8026	1864.8026	K	K	247	263
PSM	KPRPSEGDEDCLPASK	128	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3168	20.123	3	1864.8026	1864.8026	K	K	247	263
PSM	KPSHTSAVSIAGK	129	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=2118	14.259	2	1361.6704	1361.6704	R	E	92	105
PSM	KQQHVISTEEGDMMETNSTDDEK	130	sp|Q9H0E3-2|SP130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35,14-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=2720	17.632	3	2763.0888	2763.0889	R	S	403	426
PSM	KSSTGSPTSPLNAEK	131	sp|Q15746-11|MYLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=4115	25.24	2	1582.724	1582.7240	R	L	849	864
PSM	KTEMDKSPFNSPSPQDSPR	132	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=4730	28.485	3	2242.9566	2242.9566	K	L	294	313
PSM	LGSVTHVTSFSHAPPSSR	133	sp|P53814-5|SMTN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=8860	51.666	2	1945.9047	1945.9047	R	G	521	539
PSM	PTSQHYTNPTSNPVPASPINFHPESR	134	sp|Q6N043-3|Z280D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:21	ms_run[2]:scan=11904	69.229	3	2954.3348	2954.3348	K	S	88	114
PSM	RAPSVANVGSHCDLSLK	135	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9889	57.347	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RGSLEENLFHEMETCLK	136	sp|Q9NR16|C163B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,12-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=13719	81.391	2	2187.933	2187.9330	R	R	1400	1417
PSM	RKPSVPDSASPADDSFVDPGER	137	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=9444	54.892	3	2408.0645	2408.0645	K	L	18	40
PSM	RVTQHESDNENEIQIQNK	138	sp|Q5VZL5-2|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=4308	26.298	3	2261.0074	2261.0074	R	L	116	134
PSM	SAPTAPTPPPPPPPATPR	139	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8117	47.635	2	1827.892	1827.8921	R	K	799	817
PSM	SKGHYEVTGSDDETGK	140	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=1593	11.106	2	1788.7204	1788.7204	K	L	5832	5848
PSM	SKSAPLPSAAAHQQQLYGR	141	sp|Q92794|KAT6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=8059	47.281	3	2089.0106	2089.0106	R	S	1859	1878
PSM	TGSRPSSHGGGGPAAAEEEVR	142	sp|O75907|DGAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=3689	22.967	3	2087.9022	2087.9022	R	D	12	33
PSM	TLTGPKSPTVSPVPSHNQSPPTK	143	sp|Q8N960-2|CE120_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=6886	40.652	3	2436.205	2436.2050	K	D	348	371
PSM	TRLEELDDFEEGSQK	144	sp|Q7Z3J2-2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11810	68.635	2	1794.8272	1794.8272	R	E	38	53
PSM	VAHSDKPGSTSTASFR	145	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=2842	18.277	2	1726.7676	1726.7676	K	D	206	222
PSM	VGAHAGEYGAEALER	146	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7031	41.462	2	1528.727	1528.7270	K	M	18	33
PSM	YKDDDDDQLFYTR	147	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10226	59.226	2	1692.7267	1692.7267	K	L	185	198
PSM	KNQKPSQVNGAPGSPTEPAGQK	148	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1921	13.151738333333332	3	2300.084123	2299.095789	K	Q	1254	1276
PSM	VNHEPEPAGGATPGATLPKSPSQLR	149	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	20-UNIMOD:21	ms_run[1]:scan=10368	60.03273833333333	3	2591.243249	2590.254081	R	K	312	337
PSM	PGRPLSPANVPALPGETVTSPVR	150	sp|Q8IY33|MILK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:21	ms_run[1]:scan=14166	84.62224666666667	2	2392.222358	2391.231160	K	L	707	730
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	151	sp|Q96TA1|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=15805	97.02509333333333	3	3096.568710	3095.580500	R	A	655	686
PSM	ADPALLNNHSNLKPAPTVPSSPDATPEPK	152	sp|Q8N111|CEND_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:21	ms_run[2]:scan=11199	64.862	3	3057.4808	3057.4808	K	G	67	96
PSM	APSVANVGSHCDLSLK	153	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=10545	60.984	2	1733.7808	1733.7808	R	I	2142	2158
PSM	APTVPPPLPPTPPQPAR	154	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=12179	70.902	2	1811.9335	1811.9335	R	R	616	633
PSM	DKRPLSGPDVGTPQPAGLASGAK	155	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=10124	58.633	2	2298.1369	2298.1369	R	L	176	199
PSM	DRAPKPPTDGSTSPTSTPSEDQEALGK	156	sp|Q8NHM5-4|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:21	ms_run[2]:scan=7009	41.325	3	2848.2764	2848.2764	R	K	402	429
PSM	DRDDFPVVLVGNK	157	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14363	86.065	2	1472.7623	1472.7623	K	A	131	144
PSM	DRSSPPPGYIPDELHQVAR	158	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=12714	74.543	2	2213.0266	2213.0266	R	N	161	180
PSM	GAQPGRHSVTGYGDCAVGAR	159	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=5271	31.515	3	2094.9055	2094.9055	R	Y	256	276
PSM	IADPEHDHTGFLTEYVATR	160	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=14867	89.871	2	2250.9947	2250.9947	R	W	190	209
PSM	ILGSASPEEEQEKPILDRPTR	161	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=10581	61.178	3	2444.1948	2444.1948	R	I	82	103
PSM	KDPSGASNPSADSPLHR	162	sp|P55317-2|FOXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=2616	17.037	2	1814.7949	1814.7949	R	G	262	279
PSM	KESKGPIVPLNVADQK	163	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=9485	55.08	2	1801.9339	1801.9339	K	L	992	1008
PSM	KKSLDDEVNAFK	164	sp|Q14141-2|SEPT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=8421	49.291	2	1472.6912	1472.6912	K	Q	386	398
PSM	LEGLTDEINFLR	165	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18180	116.16	2	1418.7405	1418.7405	R	Q	214	226
PSM	LGSVTHVTSFSHAPPSSR	166	sp|P53814-5|SMTN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=9150	53.243	2	1945.9047	1945.9047	R	G	521	539
PSM	LKFSDEEDGRDSDEEGAEGHR	167	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=6114	36.337	3	2536.9381	2536.9381	K	D	339	360
PSM	LQGRPSPGPPAPEQLLSQAR	168	sp|P29474-3|NOS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=13736	81.519	3	2178.0947	2178.0947	K	D	109	129
PSM	NFTKPQDGDVIAPLITPQKK	169	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=12798	75.098	3	2289.177	2289.1770	R	E	507	527
PSM	PFSPPIHSSSPPPIAPLAR	170	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=14709	88.656	3	2047.0292	2047.0292	R	A	285	304
PSM	PTTPLSVGTIVPPPRPASR	171	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=13131	77.405	2	2022.0663	2022.0663	R	P	418	437
PSM	RQVEKEETNEIQVVNEEPQR	172	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=7332	43.152	3	2533.181	2533.1810	K	D	238	258
PSM	RSEACPCQPDSGSPLPAEEEKR	173	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=5363	31.999	3	2579.0782	2579.0782	R	L	411	433
PSM	SEVQQPVHPKPLSPDSR	174	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=5606	33.429	2	1979.9466	1979.9466	K	A	350	367
PSM	SGHHPGETPPLITPGSAQS	175	sp|Q14802|FXYD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=8605	50.285	2	1948.868	1948.8680	K	-	69	88
PSM	SQQPLKPQVHTPVATVK	176	sp|Q6P3W7|SCYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=6616	39.163	2	1937.0136	1937.0136	K	Q	698	715
PSM	TGSRPSSHGGGGPAAAEEEVR	177	sp|O75907|DGAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=3713	23.084	2	2087.9022	2087.9022	R	D	12	33
PSM	VAHSDKPGSTSTASFR	178	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=2613	17.027	2	1726.7676	1726.7676	K	D	206	222
PSM	VHAYFAPVTPPPSVGGSR	179	sp|Q96IG2-2|FXL20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=12713	74.539	2	1917.9138	1917.9138	K	Q	377	395
PSM	VLGAFSDGLAHLDNLK	180	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16899	105.66	2	1668.8835	1668.8835	K	G	68	84
PSM	VNVDEVGGEALGR	181	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10346	59.91	2	1313.6575	1313.6575	K	L	19	32
PSM	YGLETHMETHSDNPLR	182	sp|Q92766-6|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=7866	46.186	2	1994.8194	1994.8194	K	C	221	237
PSM	YHLGAYTGDDVR	183	sp|Q15661-2|TRYB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8145	47.795	2	1365.6313	1365.6313	K	I	183	195
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	184	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=11984	69.694705	3	2971.4268	2971.4211	K	H	206	232
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	185	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=12431	72.601005	3	2575.216083	2574.222781	K	K	453	479
PSM	EEHRLSATQQSELR	186	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:27,6-UNIMOD:21	ms_run[1]:scan=4149	25.404548333333334	3	1744.7892	1744.7889	R	D	52	66
PSM	RESKPEEPPPPK	187	sp|O00255|MEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1049	8.12877	2	1469.694144	1469.691560	R	K	490	502
PSM	DRDDFPVVLVGNK	188	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14079	83.99091	2	1473.753493	1472.762343	K	A	131	144
PSM	RKPSVPDSASPADDSFVDPGER	189	sp|P16333|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=10090	58.44025500000001	2	2410.074220	2408.064549	K	L	82	104
PSM	AIMTLVSGIPMGPPRLPLQKASR	190	sp|Q9BXD5|NPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=10507	60.789951666666674	3	2691.257149	2688.269885	K	E	268	291
PSM	AASSDQLRDNSPPPAFKPEPPK	191	sp|Q9UDY2-3|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=8856	51.647	3	2428.1424	2428.1424	R	A	953	975
PSM	AHFNAMFQPSSPTR	192	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=8125	47.677	2	1685.7021	1685.7021	R	R	883	897
PSM	ALAMPGRPESPPVFR	193	sp|Q63ZY3-3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10723	62.043	2	1719.8168	1719.8168	R	S	366	381
PSM	APAPQPPSLPDRSPR	194	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=7951	46.663	2	1664.8036	1664.8036	K	P	269	284
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	195	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12151	70.732	3	3459.4297	3459.4297	K	L	104	135
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	196	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,9-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=11426	66.239	3	3213.342	3213.3420	K	F	173	200
PSM	DRDDFPVVLVGNK	197	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13439	79.576	2	1472.7623	1472.7623	K	A	131	144
PSM	DRDDFPVVLVGNK	198	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13749	81.601	2	1472.7623	1472.7623	K	A	131	144
PSM	DRDDFPVVLVGNK	199	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13889	82.609	2	1472.7623	1472.7623	K	A	131	144
PSM	GESEEPSSPQSLCHLVAPGHER	200	sp|Q8WXH0-12|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11580	67.189	3	2482.0584	2482.0584	R	S	16	38
PSM	GIRPFPSEETTENDDDVYR	201	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11033	63.874	3	2239.0029	2239.0029	K	S	125	144
PSM	GMKDDKEEEEDGTGSPQLNNR	202	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=1974	13.474	3	2443.9799	2443.9799	K	-	390	411
PSM	GPPSPPAPVMHSPSR	203	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=4550	27.596	2	1608.712	1608.7120	R	K	221	236
PSM	HPPLYQAGLTPPLSPPK	204	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=14100	84.13	2	1891.9597	1891.9597	R	S	1295	1312
PSM	HPPVLTPPDQEVIR	205	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=11701	67.934	3	1676.8287	1676.8287	R	N	636	650
PSM	HPPVLTPPDQEVIR	206	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=12024	69.948	2	1676.8287	1676.8287	R	N	636	650
PSM	IIKPFPAPQTPGR	207	sp|P78536|ADA17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=10123	58.63	2	1500.7854	1500.7854	R	L	726	739
PSM	KDSLHGSTGAVNATR	208	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=1686	11.677	2	1592.7308	1592.7308	K	P	372	387
PSM	KHQVSVEGTNQTDVK	209	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=2320	15.445	2	1748.8094	1748.8094	K	A	540	555
PSM	KLLESQEPAHAQPASPQNVLPVK	210	sp|Q7Z3V4-2|UBE3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:21	ms_run[2]:scan=11231	65.027	3	2560.3051	2560.3051	K	S	405	428
PSM	KLSLPTDLKPDLDVK	211	sp|Q5T5C0-2|STXB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=15407	93.976	2	1760.9325	1760.9325	R	D	721	736
PSM	KNSEPGSPHSLEALR	212	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7356	43.295	2	1700.7883	1700.7883	R	D	26	41
PSM	KVQCISHEINPSAIVDSPVETK	213	sp|Q96PY6-4|NEK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=12111	70.494	3	2530.2139	2530.2139	K	S	783	805
PSM	LEQPEEDKYSKPTAPAPSAPPSPSAPEPPK	214	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	24-UNIMOD:21	ms_run[2]:scan=9055	52.73	3	3221.517	3221.5170	K	A	361	391
PSM	LIHPDEDISLEER	215	sp|O43670-3|ZN207_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10889	63.067	2	1564.7733	1564.7733	K	R	280	293
PSM	MGHAGAIIAGGK	216	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=1831	12.578	2	1097.5652	1097.5652	R	G	297	309
PSM	PVLHMVSSEQHSADLNR	217	sp|Q05209-2|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=6624	39.199	2	2014.8932	2014.8932	K	N	261	278
PSM	QSQQPMKPISPVKDPVSPASQK	218	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=7096	41.852	3	2472.2084	2472.2084	R	M	1085	1107
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	219	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11341	65.72	3	3319.3595	3319.3595	R	L	585	614
PSM	RASVCAEAYNPDEEEDDAESR	220	sp|P31323|KAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8149	47.819	3	2491.9435	2491.9435	R	I	112	133
PSM	RDNEVDGQDYHFVVSR	221	sp|Q92796-3|DLG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=8408	49.222	3	2014.8534	2014.8534	R	E	213	229
PSM	RESKPEEPPPPK	222	sp|O00255-3|MEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=861	7.1239	2	1469.6916	1469.6916	R	K	450	462
PSM	RGTSPRPPEGGLGYSQLGDDDLK	223	sp|Q9UQ88-4|CD11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=11944	69.478	3	2494.1489	2494.1489	K	E	724	747
PSM	RKSELPQDVYTIK	224	sp|Q14738-3|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=9270	53.906	2	1655.8284	1655.8284	R	A	465	478
PSM	RLSPPGGSGSGVPGGGPLLPAAGR	225	sp|Q8NFZ4|NLGN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=13412	79.387	3	2193.1056	2193.1056	R	E	711	735
PSM	RQDDATGAGQDSENEVSLVSGHQR	226	sp|P16157-10|ANK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=7265	42.772	3	2635.126	2635.1260	K	G	1655	1679
PSM	RSSKEEAEMAYK	227	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=841	7.0283	2	1523.6327	1523.6327	K	D	733	745
PSM	RVPLSPLSLLAGPADAR	228	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=19075	123.63	2	1811.9659	1811.9659	R	R	429	446
PSM	SAPTAPTPPPPPPPATPR	229	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=7581	44.568	2	1827.892	1827.8921	R	K	799	817
PSM	SGHHPGETPPLITPGSAQS	230	sp|Q14802|FXYD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=9014	52.51	2	1948.868	1948.8680	K	-	69	88
PSM	SHSPAHASNVGSPLSSPLSSMK	231	sp|P08235-2|MCR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8797	51.319	3	2273.0148	2273.0148	R	S	248	270
PSM	SLSSSLQAPVVSTVGMQR	232	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14466	86.849	2	1941.9231	1941.9231	R	L	11	29
PSM	SRSGEGEVSGLMR	233	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=4056	24.964	2	1459.6127	1459.6127	R	K	389	402
PSM	SVAPASPPPPDGPLAHR	234	sp|Q2M2I3|FA83E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=8001	46.954	2	1744.8298	1744.8298	R	L	319	336
PSM	VNHEPEPAGGATPGATLPKSPSQLR	235	sp|O00499-6|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:21	ms_run[2]:scan=9766	56.651	3	2590.2541	2590.2541	R	K	281	306
PSM	KNGQHVASSPIPVVISQSEIGDASR	236	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=13562	80.34408499999999	3	2656.287667	2655.301759	K	V	2025	2050
PSM	RAPSVANVGSHCDLSLK	237	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=10565	61.092196666666666	3	1890.875496	1889.881897	R	I	2149	2166
PSM	QKTPPPVAPKPAVK	238	sp|Q9UMS6|SYNP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=4878	29.270248333333335	2	1519.8179	1519.8158	K	S	753	767
PSM	KSSTVATLQGTPDHGD	239	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=4885	29.306296666666668	2	1692.7384	1692.7351	R	P	154	170
PSM	RLTSCTPGLEDEKEASENETDMEDPR	240	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:4,16-UNIMOD:21,22-UNIMOD:35	ms_run[1]:scan=7883	46.268926666666665	3	3104.263537	3104.258770	R	E	6346	6372
PSM	VTSGLVKPTTSPLIPTTTPAR	241	sp|Q9NZ52|GGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,10-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=7584	44.58356666666667	3	2456.061666	2456.080744	K	P	528	549
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	242	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=12350	72.065	3	2574.2228	2574.2228	K	K	408	434
PSM	DADDAVYELDGK	243	sp|Q13243|SRSF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10390	60.156	2	1309.5674	1309.5674	R	E	49	61
PSM	DRDDFPVVLVGNK	244	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14027	83.601	2	1472.7623	1472.7623	K	A	131	144
PSM	ELEAIFGRPVVDGEEGEPHSISPR	245	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	22-UNIMOD:21	ms_run[2]:scan=15134	91.934	3	2699.2592	2699.2592	K	P	274	298
PSM	ELRPEDDMKPGSFDR	246	sp|P22466|GALA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=5740	34.178	2	1886.787	1886.7870	R	S	65	80
PSM	ERGSQSSDSSSSLSSHR	247	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=756	6.6559	2	1872.7599	1872.7599	R	Y	1949	1966
PSM	HEFMSDTNLSEHAAIPLK	248	sp|Q92608|DOCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=12225	71.227	3	2134.9395	2134.9395	K	A	1727	1745
PSM	HIDLVEGDEGR	249	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5693	33.945	2	1238.5891	1238.5891	R	M	232	243
PSM	HKSESPCESPYPNEK	250	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2132	14.341	2	1867.7448	1867.7448	K	D	333	348
PSM	HQDGLPYIDDSPSSSPHLSSK	251	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:21	ms_run[2]:scan=12304	71.768	3	2346.0165	2346.0165	R	G	449	470
PSM	HREDSDVEMVEDDSR	252	sp|P40692-2|MLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4921	29.516	2	1913.7099	1913.7099	R	K	232	247
PSM	HSPQPSPSSSFNEGLLTGGHR	253	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:21	ms_run[2]:scan=11617	67.429	3	2271.007	2271.0070	R	H	599	620
PSM	ISDVHFSVKPSASASSPK	254	sp|O95503|CBX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=8252	48.357	2	1922.9139	1922.9139	R	L	92	110
PSM	IYVDDGLISLQVK	255	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16886	105.58	2	1461.8079	1461.8079	K	Q	159	172
PSM	KADTTTPTTIDPIHEPPSLPPEPK	256	sp|O60885-2|BRD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=12968	76.287	3	2661.2939	2661.2939	R	T	291	315
PSM	KDPSGASNPSADSPLHR	257	sp|P55317-2|FOXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=4248	25.963	3	1814.7949	1814.7949	R	G	262	279
PSM	KGSDALRPPVPQGEDEVPK	258	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=9964	57.744	2	2098.0096	2098.0096	R	A	308	327
PSM	KGSVSHDTVQPR	259	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=801	6.8669	2	1389.6402	1389.6402	K	T	141	153
PSM	KPLTSSSAAPQRPISTQR	260	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=3800	23.621	2	2004.0154	2004.0154	K	T	151	169
PSM	KSPVGKSPPSTGSTYGSSQK	261	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=3237	20.489	3	2058.9623	2058.9623	K	E	314	334
PSM	LGGLRPESPESLTSVSR	262	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21	ms_run[2]:scan=12321	71.879	3	1863.9092	1863.9092	R	T	11	28
PSM	RAPSVANVGSHCDLSLK	263	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10141	58.731	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RAPSVANVGSHCDLSLK	264	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=12453	72.745	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RDQMEGSPNSSESFEHIAR	265	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7186	42.322	3	2271.9216	2271.9216	R	S	530	549
PSM	RFSADEQFFSVGQAASSSAHSSK	266	sp|P46019|KPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=14257	85.269	3	2510.0863	2510.0863	R	S	1013	1036
PSM	RLPALSHSEGEEDEDEEEDEGK	267	sp|P55201-4|BRPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21	ms_run[2]:scan=7139	42.065	3	2579.0184	2579.0184	R	G	455	477
PSM	RNSSEASSGDFLDLK	268	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=12762	74.865	2	1704.7356	1704.7356	R	G	39	54
PSM	RPSLPSSPSPGLPK	269	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=9532	55.341	2	1498.7545	1498.7545	K	A	118	132
PSM	RPSTADGEGDERPFTQAGLGADER	270	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=9623	55.864	3	2611.13	2611.1300	R	I	1161	1185
PSM	RQLEEAEEEAQR	271	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3347	21.058	2	1486.7012	1486.7012	K	A	1299	1311
PSM	RSSGREEDDEELLR	272	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=5806	34.501	2	1769.7581	1769.7581	R	R	208	222
PSM	SGEHDFGAAFDGDGDR	273	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8983	52.33	2	1651.6499	1651.6499	K	N	296	312
PSM	SGHHPGETPPLITPGSAQS	274	sp|Q14802|FXYD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=8811	51.39	2	1948.868	1948.8680	K	-	69	88
PSM	SLNSTPPPPPAPAPAPPPALAR	275	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=11990	69.732	3	2195.114	2195.1140	R	P	328	350
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	276	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1401	9.9987	3	2980.1953	2980.1953	K	T	63	98
PSM	THSAGTSPTITHQK	277	sp|P35568|IRS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=831	6.9886	2	1544.6984	1544.6984	R	T	525	539
PSM	TKPTQAAGPSSPQKPPTPEETK	278	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:21	ms_run[2]:scan=3244	20.529	3	2356.1312	2356.1312	K	A	437	459
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	279	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=11667	67.737	3	3174.5598	3174.5598	K	N	773	803
PSM	VNHEPEPAGGATPGATLPKSPSQLR	280	sp|O00499-6|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:21	ms_run[2]:scan=9949	57.664	3	2590.2541	2590.2541	R	K	281	306
PSM	VNPHKVSPASSVDSNIPSSQGYK	281	sp|Q9UHB7|AFF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=8450	49.436	3	2477.1588	2477.1588	K	K	481	504
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	282	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=11513	66.778	3	2814.2433	2814.2433	R	G	194	223
PSM	VTIAQGGVLPNIQAVLLPK	283	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20456	135.48	2	1930.1615	1930.1615	K	K	101	120
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	284	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=6813	40.283098333333335	3	2672.212143	2671.223903	K	Q	868	895
PSM	QSQQPMKPISPVKDPVSPASQK	285	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,6-UNIMOD:35,17-UNIMOD:21	ms_run[1]:scan=8496	49.70121833333334	3	2455.1835	2455.1813	R	M	1085	1107
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	286	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=8869	51.719645	3	3113.497079	3112.507789	R	S	847	876
PSM	APTVPPPLPPTPPQPAR	287	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:21	ms_run[2]:scan=12636	73.992	2	1811.9335	1811.9335	R	R	616	633
PSM	DLDDNLFGQHLAK	288	sp|O14656-2|TOR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13996	83.414	2	1484.726	1484.7260	K	K	64	77
PSM	DRDDFPVVLVGNK	289	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14219	85.003	2	1472.7623	1472.7623	K	A	131	144
PSM	DRSVPNLTEGSLHEPGR	290	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=9750	56.571	3	1942.8898	1942.8898	R	Q	960	977
PSM	EEQTDTSDGESVTHHIR	291	sp|P36915|GNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=4273	26.093	2	2019.8171	2019.8171	R	R	45	62
PSM	EEQTDTSDGESVTHHIR	292	sp|P36915|GNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=4466	27.157	2	2019.8171	2019.8171	R	R	45	62
PSM	ELEKPIQSKPQSPVIQAAAVSPK	293	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:21	ms_run[2]:scan=10234	59.273	3	2524.3302	2524.3302	R	F	207	230
PSM	EREEGALAEPAPVPAVAHSPPATVEAATSR	294	sp|A6NEL2|SWAHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:21	ms_run[2]:scan=12614	73.828	3	3089.4819	3089.4819	R	A	240	270
PSM	ERTESEVPPRPASPK	295	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=2704	17.543	2	1758.8302	1758.8302	K	V	532	547
PSM	GKDNVESAQASEVKPLR	296	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=5544	33.047	3	1906.915	1906.9150	K	S	815	832
PSM	GVDEVTIVNILTNR	297	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19369	126.1	2	1541.8413	1541.8413	K	S	50	64
PSM	GVPHPEDDHSQVEGPESLR	298	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:21	ms_run[2]:scan=7666	45.021	2	2163.9222	2163.9222	K	-	679	698
PSM	HAHLSQTTLSGGQSDLGYNSLSK	299	sp|Q7Z401|MYCPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=11191	64.817	3	2480.1333	2480.1333	K	D	891	914
PSM	HLAEDDTHPPASLR	300	sp|Q13477-4|MADCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=5417	32.323	2	1637.7199	1637.7199	R	L	165	179
PSM	HLSESSGKPLSTK	301	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21	ms_run[2]:scan=1900	13.031	2	1449.6865	1449.6865	R	Q	469	482
PSM	HQASDSENEELPKPR	302	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=3678	22.908	3	1815.7789	1815.7789	R	I	232	247
PSM	HSPQHTTTLSLSTLATPK	303	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=11703	67.946	3	1998.9776	1998.9776	K	R	259	277
PSM	HVGDLGNVTADK	304	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=4558	27.639	2	1224.6099	1224.6099	R	D	81	93
PSM	HVTLGPGQSPLSR	305	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=7641	44.872	2	1427.6922	1427.6922	R	E	1173	1186
PSM	IYHLPDAESDEDEDFK	306	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=12960	76.228	2	2001.7881	2001.7881	K	E	210	226
PSM	KASLSVAGPGKPQEEDQPLPAR	307	sp|P51957-3|NEK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=8651	50.527	3	2354.1631	2354.1631	R	R	548	570
PSM	KEESHSNDQSPQIR	308	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:21	ms_run[2]:scan=777	6.757	2	1733.737	1733.7370	K	A	129	143
PSM	KPESPYGNLCDAPDSPRPVK	309	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=8727	50.935	3	2306.0402	2306.0402	R	A	419	439
PSM	KPSVGVPPPASPSYPR	310	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:21	ms_run[2]:scan=8126	47.681	2	1714.8444	1714.8444	R	A	969	985
PSM	KPTDGASSSNCVTDISHLVR	311	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=12605	73.765	3	2222.9991	2222.9991	R	K	359	379
PSM	KQHYLSSEDEPDDNPDVLDSR	312	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=10590	61.238	3	2538.0548	2538.0548	R	I	2774	2795
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	313	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=10494	60.72	2	2637.3415	2637.3415	R	R	31	56
PSM	KQSNPLLIHVDTK	314	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=10186	58.989	2	1571.8073	1571.8073	R	A	665	678
PSM	KRPSLPSSPSPGLPK	315	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8599	50.252	2	1706.8158	1706.8158	K	A	117	132
PSM	KSSTGSPTSPLNAEK	316	sp|Q15746-11|MYLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4267	26.057	2	1662.6903	1662.6903	R	L	849	864
PSM	KSVSSENPTYPSAPLKPVTVPPR	317	sp|Q5HYK7-3|SH319_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:21	ms_run[2]:scan=11340	65.716	3	2530.2833	2530.2833	K	L	147	170
PSM	LKEEQHGISVTGLQSPDR	318	sp|Q9NZN5-2|ARHGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:21	ms_run[2]:scan=8755	51.082	3	2072.9892	2072.9892	K	D	1143	1161
PSM	LLKPGEEPSEYTDEEDTK	319	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=8142	47.778	2	2158.9195	2158.9195	R	D	200	218
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	320	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=16892	105.62	3	3062.559	3062.5590	K	A	444	473
PSM	MHPGLPSVPTQDR	321	sp|Q8N468-2|MFD4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=8645	50.496	2	1529.6698	1529.6698	R	S	403	416
PSM	NDGSAERPYFMSSTLKK	322	sp|Q8IWA5-3|CTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=6742	39.928	3	2025.8867	2025.8867	R	L	676	693
PSM	NKHESMISELEVR	323	sp|P35749-4|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=7087	41.806	2	1666.7386	1666.7386	K	L	1030	1043
PSM	NMLHQSNAHSSILSPGPASDASADER	324	sp|Q86SJ2|AMGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=7752	45.529	3	2787.1919	2787.1920	K	K	433	459
PSM	PSSPALYFTHDASLVHK	325	sp|Q9Y3Q8-2|T22D4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=13553	80.286	3	1948.9084	1948.9084	R	S	23	40
PSM	QGHRPLSQSIVEAGSVGQTDLNK	326	sp|A6NDB9|PALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=12279	71.602	3	2500.2071	2500.2071	R	R	118	141
PSM	RAPSVANVGSHCDLSLK	327	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9454	54.94	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RAPSVANVGSHCDLSLK	328	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10743	62.152	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RASAPLPGLSAPGR	329	sp|O14558|HSPB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=9751	56.575	2	1428.7239	1428.7239	R	L	14	28
PSM	RELSRPGDLATPESSAAASPR	330	sp|Q8IUW3|SPA2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=8200	48.073	3	2247.0645	2247.0645	R	R	314	335
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTK	331	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:21	ms_run[2]:scan=12591	73.67	3	3379.6158	3379.6158	R	V	1112	1146
PSM	RGEGDAPFSEPGTTSTQRPSSPETATK	332	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	26-UNIMOD:21	ms_run[2]:scan=7200	42.393	3	2870.272	2870.2720	R	Q	303	330
PSM	RKPSVPDSASPADDSFVDPGER	333	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:21	ms_run[2]:scan=10269	59.46	2	2408.0645	2408.0645	K	L	18	40
PSM	RLPSKELPDSSSPVPANNIR	334	sp|Q9BWT3-2|PAPOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=9880	57.306	3	2256.1264	2256.1264	K	V	683	703
PSM	RPLSSSHEASEGQAK	335	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=912	7.3751	2	1662.7363	1662.7363	K	D	157	172
PSM	RQSQLIDTLQHQVK	336	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=11758	68.3	3	1772.8934	1772.8934	K	S	1338	1352
PSM	RSSDPVPGPPADTQPSASHPGGQSLK	337	sp|Q8TEW8-5|PAR3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=7338	43.185	3	2649.2184	2649.2184	R	L	139	165
PSM	RSSGREEDDEELLR	338	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=5980	35.512	2	1769.7581	1769.7581	R	R	208	222
PSM	SHHAASTTTAPTPAAR	339	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=1022	7.9797	2	1655.7417	1655.7417	R	S	1084	1100
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	340	sp|A0FGR8-5|ESYT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21,3-UNIMOD:35,29-UNIMOD:35	ms_run[2]:scan=6986	41.185	3	3164.3428	3164.3428	K	A	95	127
PSM	SHNNFVAILDLPEGEHQYK	341	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=16695	104.03	3	2290.042	2290.0420	R	F	108	127
PSM	SRSPLLVTVVESDPRPQGQPR	342	sp|Q5VWN6-2|TASO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=13421	79.449	3	2397.2166	2397.2166	R	R	1230	1251
PSM	SSSQSTFHIPLSPVEVKPGNVR	343	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=15254	92.841	3	2445.2053	2445.2053	K	N	545	567
PSM	SVSMPAETAHISSPHHELR	344	sp|Q96CC6|RHDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=6877	40.608	3	2260.9337	2260.9337	R	R	49	68
PSM	TGSRPSSHGGGGPAAAEEEVR	345	sp|O75907|DGAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=3869	23.982	3	2087.9022	2087.9022	R	D	12	33
PSM	THSFENVSCHLPDSR	346	sp|Q5VZ89-3|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8961	52.215	3	1864.7564	1864.7564	R	T	1097	1112
PSM	THSVSSPTVGKPYK	347	sp|Q9H2S9-2|IKZF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=2926	18.676	2	1566.7443	1566.7443	R	C	195	209
PSM	TKPPLDHNASATDYK	348	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:21	ms_run[2]:scan=3699	23.022	2	1736.7771	1736.7771	R	F	470	485
PSM	VAHSDKPGSTSTASFR	349	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=2159	14.513	2	1726.7676	1726.7676	K	D	206	222
PSM	VAHSDKPGSTSTASFR	350	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=2415	16.009	2	1726.7676	1726.7676	K	D	206	222
PSM	VPFSPGPAPPPHMGELDQER	351	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=10778	62.376	3	2252.9926	2252.9926	R	L	584	604
PSM	YKLDEDEDEDDADLSK	352	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7850	46.095	3	1898.7905	1898.7905	K	Y	167	183
PSM	RKPSVPDSASPADDSFVD	353	sp|P16333|NCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=10198	59.063326666666676	2	1968.8492	1968.8461	K	P	82	100
PSM	KFSGFSAKPNNSGEAPSSPTPK	354	sp|P49916|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=8289	48.55853	3	2315.050385	2314.063092	R	R	225	247
PSM	KPGDGEVSPSTEDAPFQHSPLGK	355	sp|O60318|GANP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	19-UNIMOD:21	ms_run[1]:scan=10160	58.84295166666667	3	2459.093753	2459.100600	K	A	520	543
PSM	KDPSGASNPSADSPLHR	356	sp|P55317|FOXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=2593	16.920335	3	1814.795468	1814.794856	R	G	295	312
PSM	FADQDDIGNVSFDR	357	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12919	75.95385333333333	2	1598.706792	1597.700865	K	V	569	583
PSM	KFSAGGDSDPPLKR	358	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=4894	29.357991666666667	2	1553.726146	1553.723923	R	S	288	302
PSM	PPRATSACAPISSPKTNGLSK	359	sp|Q9UPQ3|AGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=10160	58.84295166666667	3	2460.978599	2458.975961	R	D	410	431
PSM	GQMLLEVSYGGSPVPNPGIFFTYR	360	sp|O15031|PLXB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21,22-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=6627	39.214395	3	2868.228669	2868.203638	R	E	957	981
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	361	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=9057	52.73770666666667	3	3113.496602	3112.507789	R	S	847	876
PSM	DKSSKVPSALAPAVASGGGGVGDGVQEPTTGNWR	362	sp|O00429-5|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,4-UNIMOD:21,29-UNIMOD:21,30-UNIMOD:21	ms_run[1]:scan=14772	89.14370166666667	3	3571.447771	3571.482407	R	G	531	565