MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr18.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	321-UNIMOD:35,330-UNIMOD:21,328-UNIMOD:21	0.06	42.0	8	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	43-UNIMOD:21	0.05	42.0	6	1	0
PRT	sp|P08294|SODE_HUMAN	Extracellular superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	63-UNIMOD:4	0.11	42.0	1	1	1
PRT	sp|Q8WU39-3|MZB1_HUMAN	Isoform 3 of Marginal zone B- and B1-cell-specific protein OS=Homo sapiens OX=9606 GN=MZB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	51-UNIMOD:4	0.24	41.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	145-UNIMOD:28,164-UNIMOD:21	0.07	41.0	1	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4	0.03	40.0	3	1	0
PRT	sp|Q9UIS9|MBD1_HUMAN	Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	297-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|P98174|FGD1_HUMAN	FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	48-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	266-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	171-UNIMOD:35,189-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q8N4C8-4|MINK1_HUMAN	Isoform 4 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	555-UNIMOD:21,568-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|Q96RU3|FNBP1_HUMAN	Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	242-UNIMOD:21	0.08	38.0	3	1	0
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1954-UNIMOD:21	0.03	38.0	3	3	3
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	34-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	211-UNIMOD:21	0.10	37.0	7	2	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	455-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	596-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	617-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P12931|SRC_HUMAN	Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	17-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	486-UNIMOD:21,487-UNIMOD:35,483-UNIMOD:21	0.03	37.0	7	1	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	878-UNIMOD:21,895-UNIMOD:4	0.01	37.0	1	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	139-UNIMOD:4	0.09	36.0	2	1	0
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1278-UNIMOD:21	0.00	36.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	781-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|P20823-6|HNF1A_HUMAN	Isoform 6 of Hepatocyte nuclear factor 1-alpha OS=Homo sapiens OX=9606 GN=HNF1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	166-UNIMOD:35,196-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q9GZY8-4|MFF_HUMAN	Isoform 4 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	89-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	2	1	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	963-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	135-UNIMOD:21,112-UNIMOD:21	0.17	36.0	2	2	2
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	681-UNIMOD:21,635-UNIMOD:21,652-UNIMOD:4	0.02	36.0	2	2	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	167-UNIMOD:28,186-UNIMOD:21,181-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	351-UNIMOD:28,353-UNIMOD:21	0.05	36.0	1	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	118-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O00712-6|NFIB_HUMAN	Isoform 6 of Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	76-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	626-UNIMOD:35,635-UNIMOD:21,642-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q9Y6R1-3|S4A4_HUMAN	Isoform 3 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	211-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O43665|RGS10_HUMAN	Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	16-UNIMOD:21	0.12	35.0	3	1	0
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	107-UNIMOD:21	0.12	35.0	1	1	1
PRT	sp|Q7Z5N4|SDK1_HUMAN	Protein sidekick-1 OS=Homo sapiens OX=9606 GN=SDK1 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2097-UNIMOD:21,2102-UNIMOD:4	0.01	35.0	2	1	0
PRT	sp|Q8N5C8-2|TAB3_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	102-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1040-UNIMOD:21	0.01	35.0	1	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	138-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q9ULV0|MYO5B_HUMAN	Unconventional myosin-Vb OS=Homo sapiens OX=9606 GN=MYO5B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	602-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	635-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	151-UNIMOD:21,155-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	315-UNIMOD:21	0.05	34.0	1	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	331-UNIMOD:21,341-UNIMOD:35	0.04	34.0	2	1	0
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	448-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	328-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q5TC79|ZBT37_HUMAN	Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	455-UNIMOD:4,465-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	802-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	181-UNIMOD:4	0.07	33.0	3	1	0
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	76-UNIMOD:21,81-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	922-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9Y2B5|VP9D1_HUMAN	VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VPS9D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	330-UNIMOD:21,333-UNIMOD:4,334-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	88-UNIMOD:21	0.09	33.0	1	1	0
PRT	sp|Q13286-5|CLN3_HUMAN	Isoform 5 of Battenin OS=Homo sapiens OX=9606 GN=CLN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	12-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	307-UNIMOD:21,309-UNIMOD:21	0.04	33.0	3	1	0
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	613-UNIMOD:21,614-UNIMOD:21	0.03	33.0	3	2	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	830-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1010-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	469-UNIMOD:21	0.03	32.0	3	1	0
PRT	sp|O60504-2|VINEX_HUMAN	Isoform Beta of Vinexin OS=Homo sapiens OX=9606 GN=SORBS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	263-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|P12110-3|CO6A2_HUMAN	Isoform 2C2A' of Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	777-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|Q96RU3-5|FNBP1_HUMAN	Isoform 5 of Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	32.0	1	1	0
PRT	sp|Q13563-2|PKD2_HUMAN	Isoform 2 of Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	164-UNIMOD:4,166-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	181-UNIMOD:21,185-UNIMOD:35,188-UNIMOD:4	0.10	32.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	362-UNIMOD:35,363-UNIMOD:21	0.01	32.0	4	1	0
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q14289-2|FAK2_HUMAN	Isoform 2 of Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	797-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2191-UNIMOD:4,2144-UNIMOD:21,2152-UNIMOD:4	0.01	32.0	2	2	2
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	168-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	219-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	575-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	723-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	972-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	798-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	202-UNIMOD:21,200-UNIMOD:21	0.11	31.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q8NFM4-2|ADCY4_HUMAN	Isoform 2 of Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	198-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P21860-5|ERBB3_HUMAN	Isoform 5 of Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	339-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	34-UNIMOD:21,37-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	552-UNIMOD:21,553-UNIMOD:35,189-UNIMOD:35,191-UNIMOD:21,194-UNIMOD:35	0.04	31.0	2	2	2
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	285-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	205-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	799-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|Q9BQQ3|GORS1_HUMAN	Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	216-UNIMOD:21	0.09	31.0	1	1	0
PRT	sp|P00387|NB5R3_HUMAN	NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	204-UNIMOD:4	0.06	31.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	246-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|P31483-2|TIA1_HUMAN	Isoform Short of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	218-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	437-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q6ZU35|CRACD_HUMAN	Capping protein inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	955-UNIMOD:35,975-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	300-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q9C0K0|BC11B_HUMAN	B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	169-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q2NKJ3-2|CTC1_HUMAN	Isoform 2 of CST complex subunit CTC1 OS=Homo sapiens OX=9606 GN=CTC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	671-UNIMOD:4,678-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5VUB5|F1711_HUMAN	Protein FAM171A1 OS=Homo sapiens OX=9606 GN=FAM171A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	371-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	336-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q8IXJ6-5|SIR2_HUMAN	Isoform 5 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	296-UNIMOD:21	0.08	30.0	1	1	1
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	372-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	635-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	905-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q96F45-3|ZN503_HUMAN	Isoform 3 of Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	102-UNIMOD:21	0.10	30.0	1	1	1
PRT	sp|Q15418-3|KS6A1_HUMAN	Isoform 3 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	271-UNIMOD:21	0.03	30.0	4	1	0
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	260-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	285-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|O00712|NFIB_HUMAN	Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	333-UNIMOD:21	0.05	30.0	1	1	0
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	134-UNIMOD:21,157-UNIMOD:35	0.04	30.0	3	1	0
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	817-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	540-UNIMOD:4,545-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q96F24|NRBF2_HUMAN	Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	113-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	1	1	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	233-UNIMOD:21,235-UNIMOD:4,240-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|P61224-4|RAP1B_HUMAN	Isoform 4 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	69-UNIMOD:35	0.10	29.0	1	1	1
PRT	sp|Q15154-3|PCM1_HUMAN	Isoform 3 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	395-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1070-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	245-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	131-UNIMOD:35,132-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1690-UNIMOD:21	0.01	29.0	3	1	0
PRT	sp|Q9BQQ3-3|GORS1_HUMAN	Isoform 3 of Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	143-UNIMOD:21	0.16	29.0	1	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	297-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	718-UNIMOD:21,722-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q9NQC3-5|RTN4_HUMAN	Isoform B2 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	182-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q8TDJ6-2|DMXL2_HUMAN	Isoform 2 of DmX-like protein 2 OS=Homo sapiens OX=9606 GN=DMXL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	326-UNIMOD:21,335-UNIMOD:35,341-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2048-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	13-UNIMOD:21,26-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	308-UNIMOD:21,296-UNIMOD:21	0.05	29.0	5	1	0
PRT	sp|P01009-3|A1AT_HUMAN	Isoform 3 of Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	35-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	64-UNIMOD:21,69-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	179-UNIMOD:21	0.11	29.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:35,269-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	718-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|P00533|EGFR_HUMAN	Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1110-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	189-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|Q9BZL4|PP12C_HUMAN	Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	407-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q8IXA5|SACA3_HUMAN	Sperm acrosome membrane-associated protein 3 OS=Homo sapiens OX=9606 GN=SPACA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	19-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:21,24-UNIMOD:21	0.11	29.0	1	1	1
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	620-UNIMOD:21,619-UNIMOD:21	0.01	28.0	3	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	858-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	430-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q92994-9|TF3B_HUMAN	Isoform 9 of Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	315-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2536-UNIMOD:21	0.00	28.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1070-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	65-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	641-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	489-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9BZF2|OSBL7_HUMAN	Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	226-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	732-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	618-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	215-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	291-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	363-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9C0H9|SRCN1_HUMAN	SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	45-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	202-UNIMOD:21,211-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	189-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	47-UNIMOD:21,59-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1497-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P32519-2|ELF1_HUMAN	Isoform 2 of ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	166-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	2413-UNIMOD:21,2421-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q8N1P7|CRBG2_HUMAN	Beta/gamma crystallin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CRYBG2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	247-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	226-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	1098-UNIMOD:28,1111-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	5-UNIMOD:28	0.02	28.0	1	1	0
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	17-UNIMOD:21	0.14	28.0	1	1	1
PRT	sp|P78316|NOP14_HUMAN	Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	312-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q8N3V7|SYNPO_HUMAN	Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	806-UNIMOD:28,819-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1764-UNIMOD:21,1793-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	308-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|O75128-3|COBL_HUMAN	Isoform 3 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	347-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	626-UNIMOD:21	0.05	27.0	2	2	2
PRT	sp|Q96FF7|MISP3_HUMAN	Uncharacterized protein MISP3 OS=Homo sapiens OX=9606 GN=MISP3 PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	91-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P15941-12|MUC1_HUMAN	Isoform S2 of Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	110-UNIMOD:35,115-UNIMOD:21	0.11	27.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	418-UNIMOD:4,422-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	200-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P00915|CAH1_HUMAN	Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q96S15|WDR24_HUMAN	GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	581-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	272-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P52746|ZN142_HUMAN	Zinc finger protein 142 OS=Homo sapiens OX=9606 GN=ZNF142 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1319-UNIMOD:21,1330-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|P53365-3|ARFP2_HUMAN	Isoform 3 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	649-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	470-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q16566|KCC4_HUMAN	Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	348-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	510-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O94823|AT10B_HUMAN	Probable phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1380-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O15021-2|MAST4_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=MAST4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1456-UNIMOD:4,1458-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q8N4Y2|EFC4A_HUMAN	EF-hand calcium-binding domain-containing protein 4A OS=Homo sapiens OX=9606 GN=CRACR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	392-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	234-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1167-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q13574|DGKZ_HUMAN	Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	37-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	207-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	369-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q8TEH3|DEN1A_HUMAN	DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	707-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	366-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	264-UNIMOD:21	0.07	27.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HTFMGVVSLGSPSGEVSHPR	1	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11268	67.161	3	2175.9773	2175.9773	R	K	318	338
PSM	PGAEGAPLLPPPLPPPSPPGSGR	2	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=15521	96.85	2	2237.1246	2237.1246	R	G	27	50
PSM	RDDDGALHAACQVQPSATLDAAQPR	3	sp|P08294|SODE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4	ms_run[2]:scan=10448	61.872	3	2662.2518	2662.2518	R	V	53	78
PSM	PGAEGAPLLPPPLPPPSPPGSGR	4	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=15655	97.861	2	2237.1246	2237.1246	R	G	27	50
PSM	TCLHYLGEFGEDQIYEAHQQGR	5	sp|Q8WU39-3|MZB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4	ms_run[2]:scan=14215	87.155	3	2650.187	2650.1870	R	G	50	72
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	6	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=6018	35.176545000000004	3	3007.3340	3007.3290	K	S	145	174
PSM	VHTECCHGDLLECADDR	7	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6948	40.766	2	2085.8303	2085.8303	K	A	265	282
PSM	PGAQPLPPPPPSQSPEPTEPHPR	8	sp|Q9UIS9|MBD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21	ms_run[1]:scan=8220	48.29189166666667	3	2490.179516	2489.174040	R	A	284	307
PSM	GHLSRPEAQSLSPYTTSANR	9	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=8288	48.695	2	2251.0383	2251.0383	R	A	251	271
PSM	GHLSRPEAQSLSPYTTSANR	10	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=8317	48.87	3	2251.0383	2251.0383	R	A	251	271
PSM	HIKEEPLSEEEPCTSTAIASPEK	11	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9777	57.62	3	2661.1881	2661.1881	K	K	495	518
PSM	RGSGSALGGPLDPQFVGPSDTSLGAAPGHR	12	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=14908	92.228	3	2940.3879	2940.3879	R	V	46	76
PSM	RLSTSPDVIQGHQPR	13	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=6705	39.335	2	1769.8574	1769.8574	R	D	264	279
PSM	RSNMHFTSSSTGGLSSSQSSYSPSNR	14	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=6092	35.611	3	2844.177	2844.1770	R	E	168	194
PSM	SKPGSTGPEPPIPQASPGPPGPLSQTPPMQR	15	sp|Q8N4C8-4|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21,29-UNIMOD:35	ms_run[2]:scan=11869	70.981	3	3185.5217	3185.5217	K	P	540	571
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	16	sp|Q96RU3|FNBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	2-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=12533	75.410915	3	3279.587230	3279.599916	K	Q	330	362
PSM	QVSASELHTSGILGPETLR	17	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=16983	107.82969666666665	2	2056.9828	2056.9825	R	D	2716	2735
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	18	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	28-UNIMOD:21	ms_run[2]:scan=9682	57.083	3	3407.6452	3407.6452	R	N	215	246
PSM	HTFMGVVSLGSPSGEVSHPR	19	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11301	67.361	2	2175.9773	2175.9773	R	K	318	338
PSM	RVIENADGSEEETDTR	20	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=3256	19.231	2	1899.7847	1899.7847	R	D	1946	1962
PSM	LHDFLAHSSEESEETSSPPR	21	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=8780	51.58	2	2333.9801	2333.9801	K	L	18	38
PSM	LLKPGEEPSEYTDEEDTKDHNK	22	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=5688	33.31	3	2653.1433	2653.1433	R	Q	200	222
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	23	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=16874	106.99	3	3062.559	3062.5590	K	A	444	473
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	24	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=11290	67.299	3	3239.3932	3239.3932	R	L	585	614
PSM	SHSDASVGSHSSTESEHGSSSPR	25	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:21	ms_run[2]:scan=608	5.1616	3	2390.9361	2390.9361	R	F	597	620
PSM	SLEPAENVHGAGGGAFPASQTPSKPASADGHR	26	sp|P12931|SRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=8778	51.574	3	3179.4422	3179.4422	R	G	17	49
PSM	VERPPSPFSMAPQASLPPVPPR	27	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14151	86.659	3	2452.1974	2452.1974	K	L	478	500
PSM	VERPPSPFSMAPQASLPPVPPR	28	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14286	87.664	3	2452.1974	2452.1974	K	L	478	500
PSM	SVEDVRPHHTDANNQSACFEAPDQK	29	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=7092	41.561008333333334	3	2932.210065	2931.224314	R	T	878	903
PSM	HELQANCYEEVKDR	30	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=5091	29.929	2	1789.8053	1789.8053	K	C	133	147
PSM	HGSFHEDEDPIGSPR	31	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=6460	37.827	2	1758.6999	1758.6999	R	L	1266	1281
PSM	KQELEEICHDLEAR	32	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=12052	72.185	2	1768.8414	1768.8414	K	V	774	788
PSM	LAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSK	33	sp|P20823-6|HNF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:35,33-UNIMOD:21	ms_run[2]:scan=14086	86.178	3	3510.6895	3510.6895	K	V	164	200
PSM	PADLDLIQSTPFKPLALKTPPR	34	sp|Q9GZY8-4|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:21	ms_run[2]:scan=18169	117.07	3	2497.3346	2497.3346	R	V	71	93
PSM	PGAEGAPLLPPPLPPPSPPGSGR	35	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=15787	98.873	2	2237.1246	2237.1246	R	G	27	50
PSM	QRDEDDEAYGKPVK	36	sp|Q53GD3-4|CTL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1624	9.8086	2	1648.7693	1648.7693	K	Y	5	19
PSM	RHSVVAGGGGGEGR	37	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=681	5.4484	2	1374.6154	1374.6154	K	K	961	975
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	38	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=8116	47.697	3	2602.1925	2602.1925	R	F	118	143
PSM	SVSHGSNHTQKPDEQR	39	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=466	4.5859	2	1885.8068	1885.8068	R	S	681	697
PSM	VERPPSPFSMAPQASLPPVPPR	40	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14423	88.67	3	2452.1974	2452.1974	K	L	478	500
PSM	QHEAPSNRPLNELLTPQGPSPR	41	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=13794	84.09362833333333	3	2500.1863	2500.1855	R	T	167	189
PSM	QRSPLLNQPVPELSHASLIANQSPFR	42	sp|Q9NPI6|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18454	119.40491833333334	3	2961.4844	2961.4857	R	A	351	377
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	43	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=10951	65.108	3	2956.4332	2956.4332	K	L	117	144
PSM	KPEKPLFSSASPQDSSPR	44	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=6648	38.96	3	2036.9568	2036.9568	K	L	66	84
PSM	MDKHEPHQDSGEEAEGCPSAPEETPVDK	45	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=4824	28.401	3	3201.254	3201.2540	K	K	626	654
PSM	NLTSSSLNDISDKPEK	46	sp|Q9Y6R1-3|S4A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=8411	49.413	2	1826.8299	1826.8299	R	D	208	224
PSM	RPPSDIHDSDGSSSSSHQSLK	47	sp|O43665|RGS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=2223	13.08	3	2302.9815	2302.9815	K	S	13	34
PSM	SGSSHAPQDVSLSYPQHHVGNSSPTSTSPSR	48	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:21	ms_run[2]:scan=7715	45.313	3	3270.4327	3270.4327	R	Y	86	117
PSM	SPPRPSPGGLHYSDEDICNK	49	sp|Q7Z5N4|SDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8891	52.222	2	2304.9835	2304.9835	R	Y	2085	2105
PSM	TLVHSSSDGHIDPQHAAGK	50	sp|Q8N5C8-2|TAB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=4334	25.483	3	2035.9113	2035.9113	R	Q	97	116
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	51	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14579	89.808575	3	3442.4027	3442.4027	K	L	104	135
PSM	RHSVVAGGGGGEGR	52	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=678	5.43339	2	1374.617732	1374.615375	K	K	1038	1052
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	53	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=15860	99.433	3	3613.8254	3613.8254	R	Q	125	162
PSM	FPLVADLFHDDKDPVPATTPGK	54	sp|Q9ULV0|MYO5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:21	ms_run[2]:scan=18371	118.75	3	2459.1774	2459.1774	K	G	585	607
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	55	sp|Q93074-3|MED12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=14672	90.501	3	2781.2072	2781.2072	R	E	622	648
PSM	GVVDSDDLPLNVSR	56	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12918	78.007	2	1484.7471	1484.7471	K	E	435	449
PSM	HTFMGVVSLGSPSGEVSHPR	57	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11582	69.173	3	2175.9773	2175.9773	R	K	318	338
PSM	IKDPDASKPEDWDER	58	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6654	38.995	2	1799.8326	1799.8326	K	A	208	223
PSM	KPEKPLFSSASPQDSSPR	59	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=6610	38.748	2	2036.9568	2036.9568	K	L	66	84
PSM	PGAEGAPLLPPPLPPPSPPGSGR	60	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:21	ms_run[2]:scan=15927	99.927	2	2237.1246	2237.1246	R	G	27	50
PSM	PRPPQSSTGSTASPPVSTPVTGHK	61	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=6335	37.097	3	2452.1748	2452.1748	K	R	139	163
PSM	QRSPLLNQPVPELSHASLIANQSPFR	62	sp|Q9NPI6-2|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=17064	108.47	3	2978.5128	2978.5128	R	A	313	339
PSM	RRGSDIDNPTLTVMDISPPSR	63	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12119	72.623	3	2422.1312	2422.1312	R	S	328	349
PSM	RVSEVEEEKEPVPQPLPSDDTR	64	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=9695	57.155	3	2615.2116	2615.2116	R	V	446	468
PSM	SLNSTPPPPPAPAPAPPPALAR	65	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11834	70.774	2	2195.114	2195.1140	R	P	328	350
PSM	SVEDVRPHHTDANNQSACFEAPDQK	66	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6754	39.638	3	2931.2243	2931.2243	R	T	635	660
PSM	VERPPSPFSMAPQASLPPVPPR	67	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14561	89.682	3	2452.1974	2452.1974	K	L	478	500
PSM	NHPGCIPLEGPHSISPETTVTSR	68	sp|Q5TC79|ZBT37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=11709	69.965575	3	2566.172796	2565.168303	K	G	451	474
PSM	APVHFVEPLSPTGVAGHR	69	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=12472	75.01	2	1949.9513	1949.9513	K	K	793	811
PSM	DASDDLDDLNFFNQK	70	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18069	116.32	2	1755.7588	1755.7588	K	K	65	80
PSM	DPDDHTVCHLLFANQTEK	71	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=12852	77.569	2	2138.9691	2138.9691	K	D	174	192
PSM	GSQHSPTRPPVAAAAASLGSLPGPGAAR	72	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=14023	85.73	3	2660.3184	2660.3184	R	G	75	103
PSM	HELQANCYEEVKDR	73	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=5084	29.899	3	1789.8053	1789.8053	K	C	133	147
PSM	HTFMGVVSLGSPSGEVSHPR	74	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=10720	63.592	3	2175.9773	2175.9773	R	K	318	338
PSM	IHGSGHVEEPASPLAAYQK	75	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=8225	48.318	2	2069.9572	2069.9572	K	S	911	930
PSM	LLKPGEEPSEYTDEEDTKDHNK	76	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=6549	38.4	3	2653.1433	2653.1433	R	Q	200	222
PSM	LRPSQSLHCMLSPPEPSAAPR	77	sp|Q9Y2B5|VP9D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=9732	57.357	3	2426.1236	2426.1236	R	P	325	346
PSM	MPGMSPANPSLHSPVPDASHSPR	78	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7034	41.223	3	2480.0614	2480.0614	R	A	1124	1147
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	79	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=4604	27.16	3	3024.3561	3024.3561	K	S	73	102
PSM	RRFSDSEGEETVPEPR	80	sp|Q13286-5|CLN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=6468	37.876	3	1969.8531	1969.8531	R	L	9	25
PSM	SGPKPFSAPKPQTSPSPK	81	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=4314	25.367	2	1916.9397	1916.9397	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	82	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=5596	32.767	2	1916.9397	1916.9397	R	R	294	312
PSM	SPPDQPAVPHPPPSTPIK	83	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=8628	50.666	2	1940.9397	1940.9397	K	L	600	618
PSM	STAQQELDGKPASPTPVIVASHTANK	84	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=8747	51.395	3	2726.3276	2726.3276	R	E	818	844
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	85	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:21	ms_run[2]:scan=16044	100.79	3	2618.3622	2618.3622	R	S	989	1017
PSM	VERPPSPFSMAPQASLPPVPPR	86	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14975	92.71	3	2452.1974	2452.1974	K	L	478	500
PSM	DPDDHTVCHLLFANQTEK	87	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4	ms_run[2]:scan=12997	78.535	3	2138.9691	2138.9691	K	D	174	192
PSM	FADQDDIGNVSFDR	88	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12731	76.761	2	1597.7009	1597.7009	K	V	489	503
PSM	GAGAAGLPQPPRESPQLHER	89	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=8853	51.996	2	2147.0273	2147.0273	R	E	456	476
PSM	GPSHPLDLGTSSPNTSQIHWTPYR	90	sp|O60504-2|VINEX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=14559	89.67	3	2727.2442	2727.2442	R	A	253	277
PSM	HESENLYSIACDKPQQVR	91	sp|P12110-3|CO6A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=9552	56.263	3	2173.0222	2173.0222	K	N	767	785
PSM	IIKDGEQHEDLNEVAK	92	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5103	29.989	2	1836.9218	1836.9218	K	L	239	255
PSM	LKEFLEDYDDDRDDPK	93	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10416	61.684	2	2011.9011	2011.9011	R	Y	496	512
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	94	sp|Q96RU3-5|FNBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,30-UNIMOD:21	ms_run[2]:scan=12422	74.676	3	3279.5999	3279.5999	K	Q	330	362
PSM	QLHEYETELEDERK	95	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7891	46.379	2	1817.8432	1817.8432	R	Q	1597	1611
PSM	REDQGPPCPSPVGGGDPLHR	96	sp|Q13563-2|PKD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=7792	45.813	3	2206.9579	2206.9579	R	H	157	177
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	97	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,7-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=10737	63.704	3	3241.3594	3241.3594	R	S	179	208
PSM	SHHAPMSPGSSGGGGQPLAR	98	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2274	13.349	3	1982.8418	1982.8418	R	T	357	377
PSM	SHHAPMSPGSSGGGGQPLAR	99	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2139	12.595	2	1982.8418	1982.8418	R	T	357	377
PSM	SKDQDDQKPGPSER	100	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=517	4.7919	2	1585.7332	1585.7332	K	S	467	481
PSM	SPLTPEKEVGYLEFTGPPQKPPR	101	sp|Q14289-2|FAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=15259	94.892	3	2646.3095	2646.3095	K	L	797	820
PSM	SPPRPSPGGLHYSDEDICNK	102	sp|Q7Z5N4|SDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8854	52	3	2304.9835	2304.9835	R	Y	2085	2105
PSM	STAQQELDGKPASPTPVIVASHTANK	103	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=9166	53.858	3	2726.3276	2726.3276	R	E	818	844
PSM	THEAEIVEGENHTYCIR	104	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=8687	51.039	2	2056.9273	2056.9273	K	F	2177	2194
PSM	RRGSDIDNPTLTVMDISPPSR	105	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=11970	71.61819666666666	3	2423.132199	2422.131189	R	S	328	349
PSM	PYHPPPLFPPSPQPPDSTPR	106	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=13849	84.504015	3	2304.080816	2303.077620	R	Q	158	178
PSM	AAPAQVRPPSPGNIRPVK	107	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=9008	52.908	2	1934.0251	1934.0251	K	R	210	228
PSM	AGIPQHHPPMAQNLQYPDDSDDEK	108	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=8238	48.395	3	2798.1643	2798.1643	K	K	403	427
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	109	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	28-UNIMOD:21	ms_run[2]:scan=9522	56.07	3	3407.6452	3407.6452	R	N	215	246
PSM	EKSPPDQPAVPHPPPSTPIK	110	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=7599	44.605	3	2198.0773	2198.0773	K	L	598	618
PSM	EKSPPDQPAVPHPPPSTPIK	111	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:21	ms_run[2]:scan=7760	45.616	3	2198.0773	2198.0773	K	L	598	618
PSM	FPPEDFRHSPEDFR	112	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=11620	69.404	2	1854.7727	1854.7727	R	R	567	581
PSM	GAGAAGLPQPPRESPQLHER	113	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=8679	50.992	2	2147.0273	2147.0273	R	E	456	476
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	114	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=7832	46.039	3	2671.2239	2671.2239	K	Q	710	737
PSM	HSPAPPPDPGFPAPSPPPADSPSEGFSLK	115	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	21-UNIMOD:21	ms_run[2]:scan=15205	94.481	3	2959.343	2959.3430	R	A	952	981
PSM	HTFMGVVSLGSPSGEVSHPR	116	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11110	66.154	3	2175.9773	2175.9773	R	K	318	338
PSM	KLFAPVPFPSGSTEDVSPSGPQQPPPLPQK	117	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=16797	106.41	3	3208.5846	3208.5846	K	K	789	819
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	118	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	25-UNIMOD:21	ms_run[2]:scan=9119	53.583	3	3290.5973	3290.5973	K	E	178	210
PSM	LDETDDPDDYGDR	119	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5615	32.877	2	1524.5852	1524.5852	R	E	401	414
PSM	PFAHLSHGDSPVSTSTPLPEK	120	sp|Q8NFM4-2|ADCY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=10016	59.131	3	2283.0573	2283.0573	K	T	183	204
PSM	RESGPGIAPGPEPHGLTNK	121	sp|P21860-5|ERBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=7132	41.791	2	1992.9419	1992.9419	K	K	337	356
PSM	RLTADMISHPLGDFR	122	sp|Q00587-2|BORG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=12625	76.044	3	1823.839	1823.8390	R	H	32	47
PSM	RTSMGGTQQQFVEGVR	123	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7531	44.172	2	1875.8299	1875.8299	R	M	550	566
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	124	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=7284	42.716	3	2455.0765	2455.0765	R	S	283	308
PSM	STAQQELDGKPASPTPVIVASHTANK	125	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=9396	55.292	3	2726.3276	2726.3276	R	E	818	844
PSM	VERPPSPFSMAPQASLPPVPPR	126	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14838	91.703	3	2452.1974	2452.1974	K	L	478	500
PSM	VIPAKSPPPPTHSTQLGAPSR	127	sp|Q14814-6|MEF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=6351	37.182	3	2217.1307	2217.1307	K	K	200	221
PSM	VLTPPHDVDSLPHLR	128	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=13783	84.042	3	1774.8767	1774.8767	R	K	797	812
PSM	VNVDEVGGEALGR	129	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10215	60.475	2	1313.6575	1313.6575	K	L	19	32
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	130	sp|Q9BQQ3|GORS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=16120	101.36857833333333	3	3773.853949	3773.855338	K	Q	212	250
PSM	DPDDHTVCHLLFANQTEK	131	sp|P00387|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:4	ms_run[1]:scan=13276	80.48665833333334	3	2139.959511	2138.969118	K	D	197	215
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	132	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	28-UNIMOD:21	ms_run[2]:scan=9858	58.091	3	3407.6452	3407.6452	R	N	215	246
PSM	DPDAQPGGELMLGGTDSK	133	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35	ms_run[2]:scan=9234	54.267	2	1802.7993	1802.7993	R	Y	236	254
PSM	DTSNHFHVFVGDLSPEITTEDIK	134	sp|P31483-2|TIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16941	107.52	3	2600.2395	2600.2395	K	A	90	113
PSM	ELEKPIQSKPQSPVIQAAAVSPK	135	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=9815	57.835	3	2524.3302	2524.3302	R	F	207	230
PSM	HTFMGVVSLGSPSGEVSHPR	136	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11427	68.166	3	2175.9773	2175.9773	R	K	318	338
PSM	IHIDPEIQDGSPTTSR	137	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=9473	55.773	2	1844.8306	1844.8306	R	R	102	118
PSM	KIPVFHNGSTPTLGETPK	138	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=10974	65.253	3	2001.9925	2001.9925	R	E	429	447
PSM	KIPVFHNGSTPTLGETPK	139	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=11008	65.472	2	2001.9925	2001.9925	R	E	429	447
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	140	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:21	ms_run[2]:scan=9293	54.648	3	3290.5973	3290.5973	K	E	178	210
PSM	LHDFLAHSSEESEETSSPPR	141	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:21	ms_run[2]:scan=8741	51.361	3	2333.9801	2333.9801	K	L	18	38
PSM	LLKPGEEPSEYTDEEDTKDHNK	142	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=4533	26.709	3	2653.1433	2653.1433	R	Q	200	222
PSM	LLKPGEEPSEYTDEEDTKDHNK	143	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=7009	41.087	3	2653.1433	2653.1433	R	Q	200	222
PSM	MPGMSPANPSLHSPVPDASHSPR	144	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7203	42.234	3	2480.0614	2480.0614	R	A	1124	1147
PSM	MPLAQKPALAPKPTSQTPPASPLSK	145	sp|Q6ZU35|CRACD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=8588	50.458	3	2651.3758	2651.3758	K	L	955	980
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	146	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=12502	75.216	3	2775.2402	2775.2402	R	D	285	310
PSM	PAQLPAVAPIAASSHPHSSVITSPLR	147	sp|Q9C0K0|BC11B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:21	ms_run[2]:scan=14053	85.933	3	2683.3847	2683.3847	R	A	147	173
PSM	PCLHSATPSTPQTDPTGPEGPHLGQSR	148	sp|Q2NKJ3-2|CTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=8511	49.996	3	2904.2862	2904.2862	R	L	670	697
PSM	RASEFPGPLSVTSHGR	149	sp|Q5VUB5|F1711_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=10634	63.048	3	1776.8308	1776.8308	R	P	369	385
PSM	RDSSHNELYYEEAEHER	150	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7065	41.414	3	2242.8917	2242.8917	R	R	334	351
PSM	REHASIDAQSGAGVPNPSTSASPK	151	sp|Q8IXJ6-5|SIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:21	ms_run[2]:scan=6207	36.302	3	2443.1129	2443.1129	R	K	277	301
PSM	RLEGQEEEEDNRDSSMK	152	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35	ms_run[2]:scan=988	6.7012	2	2066.8811	2066.8811	K	L	357	374
PSM	RLSESLHVVDENKNESK	153	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7042	41.265	2	2062.9685	2062.9685	R	L	633	650
PSM	SFPLHSPVAGVAHR	154	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=9363	55.067	2	1553.7504	1553.7504	K	F	900	914
PSM	SGPKPFSAPKPQTSPSPK	155	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=5424	31.766	2	1916.9397	1916.9397	R	R	294	312
PSM	TGHILHPEYLQPLPSTPVSPIELDAK	156	sp|Q96F45-3|ZN503_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:21	ms_run[2]:scan=16596	104.86	3	2931.4783	2931.4783	R	K	84	110
PSM	TPKDSPGIPPSAGAHQLFR	157	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=10766	63.882	3	2054.9939	2054.9939	R	G	267	286
PSM	VHTECCHGDLLECADDR	158	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6347	37.161	2	2085.8303	2085.8303	K	A	265	282
PSM	VHTECCHGDLLECADDR	159	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7126	41.759	3	2085.8303	2085.8303	K	A	265	282
PSM	VSKPSQLQAHTPASQQTPPLPPYASPR	160	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=10871	64.565	3	2962.4702	2962.4702	K	S	250	277
PSM	VVIHFTDGADGDLADLHR	161	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13454	81.723	3	1949.9595	1949.9595	K	A	1340	1358
PSM	YSPSQNSPIHHIPSR	162	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=7561	44.348	2	1798.8152	1798.8152	R	R	284	299
PSM	GSQHSPTRPPVAAAAASLGSLPGPGAAR	163	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=13879	84.71742833333333	3	2661.320669	2660.318412	R	G	75	103
PSM	QHEAPSNRPLNELLTPQGPSPR	164	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=12626	76.048185	3	2500.1867	2500.1855	R	T	167	189
PSM	KPEKPLFSSASPQDSSPR	165	sp|O00712|NFIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21	ms_run[1]:scan=6303	36.914705	3	2036.954224	2036.956836	K	L	318	336
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	166	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=10112	59.804206666666666	3	2909.293802	2908.307590	R	P	132	161
PSM	SAPTAPTPPPPPPPATPR	167	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=7895	46.396545	2	1828.895659	1827.892051	R	K	811	829
PSM	HTFMGVVSLGSPSGEVSHPR	168	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=11281	67.24661333333333	3	2160.964240	2159.982339	R	K	318	338
PSM	APEPHVEEDDDDELDSK	169	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6394	37.444	3	1938.7967	1938.7967	K	L	5	22
PSM	CHAEHTPEEEIDHTGAK	170	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=2855	17.135	3	2039.8044	2039.8044	K	T	540	557
PSM	DAAAHLQTSHKPSAEDAEGQSPLSQK	171	sp|Q96F24|NRBF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:21	ms_run[2]:scan=5934	34.662	3	2782.2559	2782.2559	K	Y	93	119
PSM	DADDAVYELDGK	172	sp|Q13243-2|SRSF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10260	60.734	2	1309.5674	1309.5674	R	E	49	61
PSM	DGLHFLPHASSSAQSPCGSPGMK	173	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=10684	63.362	3	2463.0348	2463.0348	R	R	219	242
PSM	DTDDVPMILVGNK	174	sp|P61224-4|RAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:35	ms_run[2]:scan=12692	76.495	2	1431.6915	1431.6915	K	C	63	76
PSM	FHNQLRDSQPPAVPDNR	175	sp|Q15154-3|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21	ms_run[2]:scan=7088	41.542	3	2069.9433	2069.9433	R	R	388	405
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	176	sp|Q93074-3|MED12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:21	ms_run[2]:scan=14534	89.495	3	2781.2072	2781.2072	R	E	622	648
PSM	GTHSPPLTPEVAGLHGPR	177	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=10574	62.661	3	1901.9149	1901.9149	K	P	1067	1085
PSM	HRLTPQEGLQAPGGSLR	178	sp|Q03989-5|ARI5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=8618	50.609	2	1895.9367	1895.9367	R	E	242	259
PSM	HSTPHAAFQPNSQIGEEMSQNSFIK	179	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=11676	69.759	3	2880.2538	2880.2538	K	Q	114	139
PSM	HSTPSNSSNPSGPPSPNSPHR	180	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=1661	9.9641	3	2219.9345	2219.9345	K	S	1676	1697
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	181	sp|Q9BQQ3-3|GORS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=16047	100.81	3	3773.8553	3773.8553	K	Q	139	177
PSM	LLKPGEEPSEYTDEEDTKDHNK	182	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=6055	35.378	3	2653.1433	2653.1433	R	Q	200	222
PSM	MGHAGAIIAGGK	183	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35	ms_run[2]:scan=2149	12.646	2	1097.5652	1097.5652	R	G	297	309
PSM	PGAEGAPLLPPPLPPPSPPGSGR	184	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:21	ms_run[2]:scan=15384	95.837	2	2237.1246	2237.1246	R	G	27	50
PSM	RAPSVANVGSHCDLSLK	185	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9258	54.411	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	186	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=9655	56.93	3	2908.3076	2908.3076	R	P	132	161
PSM	RPAGGRPSPSAMGK	187	sp|Q92615|LAR4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=571	5.0119	2	1463.6704	1463.6704	R	R	711	725
PSM	RPPSDIHDSDGSSSSSHQSLK	188	sp|O43665|RGS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=2548	15.12	3	2302.9815	2302.9815	K	S	13	34
PSM	RRGSSGSVDETLFALPAASEPVIR	189	sp|Q9NQC3-5|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=17100	108.77	3	2594.2854	2594.2854	K	S	178	202
PSM	RSSKEEAEMAYK	190	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1063	7.0187	2	1523.6327	1523.6327	K	D	733	745
PSM	RSSVLVTHAELMPDQTAMHEVQR	191	sp|Q8TDJ6-2|DMXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,12-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=8809	51.743	3	2746.2568	2746.2568	R	H	324	347
PSM	SHVSSEPYEPISPPQVPVVHEK	192	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=13215	80.097	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLSSSLQAPVVSTVGMQR	193	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14277	87.599	2	1941.9231	1941.9231	R	L	11	29
PSM	SQDKLDKDDLEK	194	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2962	17.676	2	1432.7046	1432.7046	R	E	1681	1693
PSM	SSVVSPSHPPPAPPLGSPPGPK	195	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:21	ms_run[2]:scan=10395	61.545	2	2168.0667	2168.0667	R	P	292	314
PSM	SSVVSPSHPPPAPPLGSPPGPK	196	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	17-UNIMOD:21	ms_run[2]:scan=10559	62.56	2	2168.0667	2168.0667	R	P	292	314
PSM	TDTSHHDQDHPTFNK	197	sp|P01009-3|A1AT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:21	ms_run[2]:scan=1644	9.8892	2	1858.7272	1858.7272	K	I	35	50
PSM	TPKDSPGIPPSAGAHQLFR	198	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=10447	61.87	3	2054.9939	2054.9939	R	G	267	286
PSM	TPKDSPGIPPSAGAHQLFR	199	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=10610	62.877	3	2054.9939	2054.9939	R	G	267	286
PSM	TRSLHGPCPVTTFGPK	200	sp|O95544|NADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9441	55.571	2	1833.8597	1833.8597	R	A	62	78
PSM	VHIPNDDAQFDASHCDSDK	201	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=7601	44.617	3	2169.9022	2169.9022	R	G	83	102
PSM	VLATEDRSDHLIQTDTVNLHR	202	sp|P51151|RAB9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21	ms_run[2]:scan=10504	62.241	3	2512.2071	2512.2071	R	K	172	193
PSM	YHGHSMSDPGVSYR	203	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=2990	17.797	2	1687.645	1687.6450	R	T	258	272
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	204	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	28-UNIMOD:21	ms_run[1]:scan=10015	59.12722666666667	3	3409.650468	3407.645226	R	N	691	722
PSM	RPAGSVQNPVYHNQPLNPAPSR	205	sp|P00533|EGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=7493	43.962893333333334	3	2478.191912	2478.191755	K	D	1100	1122
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	206	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=9965	58.797625	3	2908.291470	2908.307590	R	P	132	161
PSM	KSPSGPVKSPPLSPVGTTPVK	207	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=9057	53.195634999999996	3	2139.140736	2139.134072	R	L	181	202
PSM	TLNGVSSPPHPSPKSPVQLEEAPFSR	208	sp|Q9BZL4|PP12C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=13522	82.19854333333333	3	2838.360241	2837.374924	R	R	393	419
PSM	LEGLTDEINFLR	209	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=18205	117.37350333333335	2	1418.739012	1418.740545	R	Q	214	226
PSM	GAPLIRVHSSPVSSPSVSGPRR	210	sp|Q8IXA5|SACA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=9340	54.959959999999995	3	2563.106580	2562.094771	R	L	7	29
PSM	AAPPPPPPPPPLESSPR	211	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:21	ms_run[2]:scan=9486	55.852	3	1782.8706	1782.8706	K	V	606	623
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	212	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7579	44.471	3	2465.0431	2465.0431	R	A	90	114
PSM	DPDDHTVCHLLFANQTEK	213	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:4	ms_run[2]:scan=12844	77.527	3	2138.9691	2138.9691	K	D	174	192
PSM	DRDDFPVVLVGNK	214	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13257	80.361	2	1472.7623	1472.7623	K	A	131	144
PSM	EATSDPSRTPEEEPLNLEGLVAHR	215	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=15539	96.981	3	2726.2549	2726.2549	K	V	852	876
PSM	ETNLDSLPLVDTHSK	216	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=13787	84.06	2	1747.803	1747.8030	R	R	425	440
PSM	FPPEDFRHSPEDFR	217	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=11786	70.459	2	1854.7727	1854.7727	R	R	567	581
PSM	GLSSAGGGSPHREDAQPEHSASAR	218	sp|Q92994-9|TF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=1786	10.616	3	2440.0517	2440.0517	R	K	307	331
PSM	HADHSSLTLGSGSSTTR	219	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:21	ms_run[2]:scan=4203	24.735	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HAIMRSPQMVSAIVR	220	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35,6-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=6449	37.769	2	1806.8634	1806.8634	R	T	186	201
PSM	HGAPSPSHPISAPQAAAAAALR	221	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21	ms_run[2]:scan=11088	66.002	3	2157.048	2157.0481	K	R	1066	1088
PSM	HIPGAAFFDIDQCSDR	222	sp|P25325|THTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:4	ms_run[2]:scan=15195	94.407	3	1847.8261	1847.8261	R	T	53	69
PSM	HPPVLTPPDQEVIR	223	sp|P05771-2|KPCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=11632	69.469	3	1676.8287	1676.8287	R	N	636	650
PSM	HRPSEADEEELAR	224	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=3707	21.953	2	1617.6784	1617.6784	K	R	486	499
PSM	HSTPSNSSNPSGPPSPNSPHR	225	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:21	ms_run[2]:scan=1449	8.9673	2	2219.9345	2219.9345	K	S	1676	1697
PSM	HTFMGVVSLGSPSGEVSHPR	226	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11951	71.5	3	2175.9773	2175.9773	R	K	318	338
PSM	IPSAPVIPTHQASVTTERPK	227	sp|Q9BZF2|OSBL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=10031	59.224	3	2208.1304	2208.1304	R	K	224	244
PSM	KQADLEKEELAEELASSLSGR	228	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16172	101.72	3	2302.1652	2302.1652	R	N	1704	1725
PSM	KRGSLLSEPAIQVR	229	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=10296	60.957	3	1632.8713	1632.8713	R	R	729	743
PSM	LKSEDELRPEVDEHTQK	230	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=5789	33.846	2	2131.9787	2131.9787	R	T	616	633
PSM	LLKPGEEPSEYTDEEDTKDHNK	231	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=6795	39.876	3	2653.1433	2653.1433	R	Q	200	222
PSM	LTRPFPTGTPPPLPPK	232	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=12677	76.402	3	1794.9434	1794.9434	K	N	207	223
PSM	NSGEPLPPKPGPGSPSHPGALDLDGVSR	233	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:21	ms_run[2]:scan=11649	69.58	3	2814.3338	2814.3338	K	Q	278	306
PSM	PRPPQSSTGSTASPPVSTPVTGHK	234	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:21	ms_run[2]:scan=6173	36.089	3	2452.1748	2452.1748	K	R	139	163
PSM	QRDEDDEAYGKPVK	235	sp|Q53GD3-4|CTL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1617	9.7744	3	1648.7693	1648.7693	K	Y	5	19
PSM	RDQPAFTPSGILTPHALGSR	236	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=14314	87.856	3	2200.079	2200.0790	K	N	351	371
PSM	RFSNVGLVHTSER	237	sp|Q9C0H9|SRCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=8440	49.581	2	1580.7461	1580.7461	R	R	43	56
PSM	RGSIGENQVEVMVEEK	238	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=9231	54.247	2	1898.8445	1898.8445	K	T	200	216
PSM	RHSVVAGGGGGEGR	239	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=682	5.4506	3	1374.6154	1374.6154	K	K	961	975
PSM	RIDFIPVSPAPSPTR	240	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=13930	85.078	2	1731.8709	1731.8709	K	G	136	151
PSM	RPSQNAISFFNVGHSK	241	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=13258	80.364	2	1867.873	1867.8730	R	L	187	203
PSM	RRTTDFSDFLSIVGCTK	242	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=18564	120.25	3	2081.9605	2081.9605	K	G	45	62
PSM	SHHAPMSPGSSGGGGQPLAR	243	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2426	14.383	3	1982.8418	1982.8418	R	T	357	377
PSM	SHSLAQPPEFDSGVETFSIHAEKPK	244	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=14046	85.881	3	2817.3011	2817.3011	K	Y	1497	1522
PSM	SSVVSPSHPPPAPPLGSPPGPK	245	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21	ms_run[2]:scan=10824	64.264	2	2168.0667	2168.0667	R	P	292	314
PSM	TKPPRPDSPATTPNISVK	246	sp|P32519-2|ELF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:21	ms_run[2]:scan=7019	41.144	2	1984.9983	1984.9983	K	K	156	174
PSM	VERPPSPFSMAPQASLPPVPPR	247	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14702	90.696	3	2452.1974	2452.1974	K	L	478	500
PSM	VHTPSGAVEECYVSELDSDKHTIR	248	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=12998	78.537	3	2808.2426	2808.2426	R	F	2411	2435
PSM	VLSNLVPAGHSPPASHLPR	249	sp|Q8N1P7|CRBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:21	ms_run[2]:scan=11925	71.348	3	2028.0306	2028.0306	K	P	237	256
PSM	VLTPPHDVDSLPHLR	250	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=13846	84.485	2	1774.8767	1774.8767	R	K	797	812
PSM	YDERPGPSPLPHR	251	sp|P08621|RU17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	8-UNIMOD:21	ms_run[2]:scan=5075	29.859	3	1599.7195	1599.7195	R	D	219	232
PSM	QPYPSRPPFDNQHSQDLDSR	252	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=11224	66.87636666666667	3	2447.0382	2446.0332	K	Q	1098	1118
PSM	QRDEDDEAYGKPVK	253	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=3261	19.26846833333333	2	1631.7448	1631.7422	K	Y	5	19
PSM	RRSPESLPAGPGAAALEGGTR	254	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=9744	57.42505833333334	3	2129.035086	2129.037880	R	R	15	36
PSM	HMSADDLNDGFVLDKDDR	255	sp|P78316|NOP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:35	ms_run[1]:scan=10413	61.66368166666666	3	2077.894665	2077.901098	K	R	311	329
PSM	QPPYQLRPSLFVLSPIKEPAK	256	sp|Q8N3V7|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=19544	128.07183500000002	3	2470.3017	2470.3020	K	V	806	827
PSM	DPDDHTVCHLLFANQTEK	257	sp|P00387|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4	ms_run[1]:scan=13309	80.72023666666666	3	2139.959511	2138.969118	K	D	197	215
PSM	GAGAAGLPQPPRESPQLHER	258	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=8499	49.927555	2	2147.030941	2147.027316	R	E	456	476
PSM	RESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSR	259	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,32-UNIMOD:35	ms_run[1]:scan=11174	66.56514333333334	3	3145.389915	3145.388419	R	G	1762	1796
PSM	AAPPPPPPPPPLESSPR	260	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:21	ms_run[2]:scan=9334	54.924	2	1782.8706	1782.8706	K	V	606	623
PSM	AAPPPPPPPPPLESSPR	261	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:21	ms_run[2]:scan=9644	56.863	3	1782.8706	1782.8706	K	V	606	623
PSM	ALRPGDLPPSPDDVKR	262	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:21	ms_run[2]:scan=8784	51.599	3	1811.8931	1811.8931	R	R	299	315
PSM	APAPPPPQPPPPSPLIPNR	263	sp|O75128-3|COBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=11216	66.83	3	2019.0343	2019.0343	R	T	335	354
PSM	APAPPPPQPPPPSPLIPNR	264	sp|O75128-3|COBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=11242	66.99	2	2019.0343	2019.0343	R	T	335	354
PSM	APTVPPPLPPTPPQPAR	265	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21	ms_run[2]:scan=11820	70.679	2	1811.9335	1811.9335	R	R	616	633
PSM	ARSPPQPLGELKR	266	sp|Q96FF7|MISP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=7861	46.209	3	1527.7923	1527.7923	R	F	89	102
PSM	DTYHPMSEYPTYHTHGR	267	sp|P15941-12|MUC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5690	33.317	3	2186.8517	2186.8517	R	Y	105	122
PSM	EEDCHSPTSKPPKPDQPLK	268	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=3460	20.492	2	2269.0086	2269.0086	K	V	415	434
PSM	HAPSLHGSTELLPLSR	269	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:21	ms_run[2]:scan=11788	70.472	2	1793.8825	1793.8825	R	D	186	202
PSM	HDTSLKPISVSYNPATAK	270	sp|P00915|CAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9381	55.196	3	1928.0003	1928.0003	K	E	41	59
PSM	HEIVDTPPGPEHLQDK	271	sp|Q96S15|WDR24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=8315	48.857	3	1890.8513	1890.8513	R	A	576	592
PSM	HIHITQATETTTTR	272	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:21	ms_run[2]:scan=3727	22.059	3	1688.7883	1688.7883	K	H	261	275
PSM	HPEPAQPAPGSPAETTEGPLHCSR	273	sp|P52746|ZN142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=7218	42.333	3	2602.1272	2602.1272	R	C	1309	1333
PSM	HPSHSTTPSGPGDEVAR	274	sp|P53365-3|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:21	ms_run[2]:scan=2015	11.887	3	1810.7636	1810.7636	R	G	32	49
PSM	HSTPSNSSNPSGPPSPNSPHR	275	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:21	ms_run[2]:scan=1394	8.6886	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IEEVLSPEGSPSKSPSK	276	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:21	ms_run[2]:scan=7438	43.612	2	1849.871	1849.8710	K	K	636	653
PSM	IGHHSTSDDSSAYR	277	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=1220	7.7739	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	278	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=1228	7.8145	3	1611.6315	1611.6315	R	S	333	347
PSM	KTHSAASSSQGASVNPEPLHSSLDK	279	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=6426	37.615	3	2614.2024	2614.2024	R	L	467	492
PSM	LGSASSSHGSIQESHKASR	280	sp|Q16566|KCC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:21	ms_run[2]:scan=956	6.5653	2	2004.9014	2004.9014	R	D	339	358
PSM	LKDLFDYSPPLHK	281	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:21	ms_run[2]:scan=14668	90.472	2	1651.8011	1651.8011	K	N	503	516
PSM	LLKPGEEPSEYTDEEDTK	282	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:21	ms_run[2]:scan=8148	47.874	3	2158.9195	2158.9195	R	D	200	218
PSM	PGAEGAPLLPPPLPPPSPPGSGR	283	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:21	ms_run[2]:scan=15721	98.362	3	2237.1246	2237.1246	R	G	27	50
PSM	PTHHPVSSITGQDFSASTPK	284	sp|O94823|AT10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	17-UNIMOD:21	ms_run[2]:scan=7879	46.316	3	2172.9841	2172.9841	R	S	1364	1384
PSM	RAPAPGTLQDGLCHSLDR	285	sp|O15021-2|MAST4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9356	55.031	3	2042.9357	2042.9357	R	G	1444	1462
PSM	RGSGHLPSAR	286	sp|Q8N4Y2|EFC4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=1258	7.9544	2	1116.519	1116.5190	R	-	390	400
PSM	RPASPSSPEHLPATPAESPAQR	287	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=7254	42.538	3	2362.1067	2362.1067	K	F	231	253
PSM	RPPSDIHDSDGSSSSSHQSLK	288	sp|O43665|RGS10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=2378	14.1	3	2302.9815	2302.9815	K	S	13	34
PSM	RRPESAPAESSPSK	289	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21	ms_run[2]:scan=630	5.2511	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RRSPAGQASSSLAQR	290	sp|Q13574|DGKZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=2717	16.242	3	1650.7951	1650.7951	R	R	35	50
PSM	SHHAPMSPGSSGGGGQPLAR	291	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2098	12.352	3	1982.8418	1982.8418	R	T	357	377
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	292	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:21	ms_run[2]:scan=8627	50.662	3	2686.2501	2686.2501	R	R	207	233
PSM	SSVVSPSHPPPAPPLGSPPGPK	293	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=10840	64.371	3	2168.0667	2168.0667	R	P	292	314
PSM	SSVVSPSHPPPAPPLGSPPGPK	294	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=10994	65.378	3	2168.0667	2168.0667	R	P	292	314
PSM	TPKDSPGIPPSAGAHQLFR	295	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=11387	67.907	3	2054.9939	2054.9939	R	G	267	286
PSM	TPKDSPGIPPSANAHQLFR	296	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=10592	62.775	3	2112.0154	2112.0154	K	G	365	384
PSM	VETLKEEEEELKR	297	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8209	48.227	2	1630.8414	1630.8414	K	K	188	201
PSM	LKEFLEDYDDDRDD	298	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=11627	69.43756833333333	2	1786.7538	1786.7528	R	P	496	510
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	299	sp|Q96RU3|FNBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=12688	76.46744333333334	3	3281.587816	3279.599916	K	Q	330	362
PSM	KTPELGIVPPPPIPR	300	sp|Q8TEH3|DEN1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=14890	92.09539000000001	2	1689.921739	1689.921894	R	P	706	721
PSM	FASDDEHDEHDENGATGPVKR	301	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=3827	22.637716666666666	3	2405.945494	2404.955726	K	A	364	385
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	302	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	21-UNIMOD:21	ms_run[1]:scan=10316	61.057183333333334	3	2685.119415	2685.135288	R	G	244	269