MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121026_CRC_N_Fr24.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121026_CRC_N_Fr24.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UIS9-4|MBD1_HUMAN	Isoform 4 of Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	297-UNIMOD:21	0.05	35.0	3	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	246-UNIMOD:35	0.05	34.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	292-UNIMOD:21	0.05	34.0	5	1	0
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|O43314-2|VIP2_HUMAN	Isoform 2 of Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	38-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q9BZ72-3|PITM2_HUMAN	Isoform 3 of Membrane-associated phosphatidylinositol transfer protein 2 OS=Homo sapiens OX=9606 GN=PITPNM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	593-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P61224-4|RAP1B_HUMAN	Isoform 4 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	69-UNIMOD:35	0.10	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	104-UNIMOD:21,112-UNIMOD:35,107-UNIMOD:21	0.08	32.0	2	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1297-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	268-UNIMOD:21,266-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	15-UNIMOD:21,26-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	326-UNIMOD:21,333-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q15746-10|MYLK_HUMAN	Isoform 8 of Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	13-UNIMOD:21,18-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|Q9UIS9|MBD1_HUMAN	Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	297-UNIMOD:21	0.04	28.0	1	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9H4A3-5|WNK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1035-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	218-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	135-UNIMOD:21	0.00	27.0	1	1	1
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	335-UNIMOD:21,351-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q9UK76-2|JUPI1_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	87-UNIMOD:21	0.09	27.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:21,259-UNIMOD:35	0.07	27.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	112-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	935-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1278-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	331-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.16	26.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	158-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	634-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	321-UNIMOD:35,330-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	196-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	515-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NUE0|ZDH18_HUMAN	Palmitoyltransferase ZDHHC18 OS=Homo sapiens OX=9606 GN=ZDHHC18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	30-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	161-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	830-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	226-UNIMOD:21,232-UNIMOD:35	0.09	25.0	1	1	1
PRT	sp|Q13586-2|STIM1_HUMAN	Isoform 2 of Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	257-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	242-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	21-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	488-UNIMOD:35,492-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	452-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.00	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RPGAQPLPPPPPSQSPEPTEPHPR	1	sp|Q9UIS9-4|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=4887	43.494	3	2645.2751	2645.2751	R	A	283	307
PSM	DASDDLDDLNFFNQK	2	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13752	116.41	2	1755.7588	1755.7588	K	K	65	80
PSM	DPDAQPGGELMLGGTDSK	3	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=6261	54.745	2	1802.7993	1802.7993	R	Y	236	254
PSM	RSSVVSPSHPPPAPPLGSPPGPK	4	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=6216	54.38	2	2324.1678	2324.1678	K	P	291	314
PSM	DLDDIEDENEQLK	5	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7625	65.839	2	1574.6948	1574.6948	R	Q	313	326
PSM	HFFHHADEDDEEEDDSPPER	6	sp|O43314-2|VIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=3627	32.735	3	2531.9139	2531.9139	R	Q	23	43
PSM	RLSLLALPAPSPTTPGPHPPAR	7	sp|Q9BZ72-3|PITM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10886	93.304	3	2325.2359	2325.2359	R	K	591	613
PSM	DTDDVPMILVGNK	8	sp|P61224-4|RAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=8945	76.752	2	1431.6915	1431.6915	K	C	63	76
PSM	GVVDSDDLPLNVSR	9	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9114	78.154	2	1484.7471	1484.7471	K	E	435	449
PSM	HLGSPATSVPGMGLHPPGPPLAR	10	sp|Q9C0E8-3|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=8613	74.014	3	2341.1402	2341.1402	R	P	101	124
PSM	DRDDFPVVLVGNK	11	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9402	80.569	2	1472.7623	1472.7623	K	A	131	144
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	12	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6119	53.648	3	2898.2652	2898.2652	R	R	546	572
PSM	RSSVVSPSHPPPAPPLGSPPGPK	13	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=6080	53.333	3	2324.1678	2324.1678	K	P	291	314
PSM	DADDAVYELDGK	14	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7052	61.174	2	1309.5674	1309.5674	R	E	49	61
PSM	HFFHHADEDDEEEDDSPPER	15	sp|O43314-2|VIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	16-UNIMOD:21	ms_run[2]:scan=3509	31.696	3	2531.9139	2531.9139	R	Q	23	43
PSM	HPGAHQGNLASGLHSNAIASPGSPSLGR	16	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	23-UNIMOD:21	ms_run[2]:scan=6390	55.778	3	2769.3096	2769.3096	R	H	1275	1303
PSM	RLSTSPDVIQGHQPR	17	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=4417	39.547	2	1769.8574	1769.8574	R	D	264	279
PSM	RPGAQPLPPPPPSQSPEPTEPHPR	18	sp|Q9UIS9-4|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=5020	44.563	3	2645.2751	2645.2751	R	A	283	307
PSM	SLSSSLQAPVVSTVGMQR	19	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10231	87.737	2	1941.9231	1941.9231	R	L	11	29
PSM	SPSPPLPTHIPPEPPRTPPFPAK	20	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=10401	89.178	3	2616.2543	2616.2543	R	T	326	349
PSM	HLGSPATSVPGMGLHPPGPPLAR	21	sp|Q9C0E8-3|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=8374	72.001	3	2341.1402	2341.1402	R	P	101	124
PSM	KSSTGSPTSPLNAEK	22	sp|Q15746-10|MYLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2899	26.274	2	1662.6903	1662.6903	R	L	11	26
PSM	RPGAQPLPPPPPSQSPEPTEPHPR	23	sp|Q9UIS9|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=4770	42.48133	3	2646.279663	2645.275151	R	A	283	307
PSM	DGDDVIIIGVFK	24	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13924	117.77	2	1289.6867	1289.6867	K	G	302	314
PSM	FHPVFVPHSAPAVLTHNNESR	25	sp|Q9H4A3-5|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=9163	78.562	3	2435.1536	2435.1536	K	S	1027	1048
PSM	IYHLPDAESDEDEDFKEQTR	26	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=8190	70.465	3	2516.0381	2516.0381	K	L	210	230
PSM	LKSEDGVEGDLGETQSR	27	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=4957	44.052	3	1898.8259	1898.8259	R	T	133	150
PSM	NKPRPPPLSPLGGPVPSALPNGPPSPR	28	sp|Q15642|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=10120	86.829	3	2855.4249	2855.4249	K	S	327	354
PSM	RNSSEASSGDFLDLK	29	sp|Q9UK76-2|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=8859	76.055	2	1704.7356	1704.7356	R	K	85	100
PSM	RYSSSLSPIQAPNHPPPQPPTQATPLMHTK	30	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21,27-UNIMOD:35	ms_run[2]:scan=7820	67.415	3	3373.6279	3373.6279	R	P	233	263
PSM	VNVDEVGGEALGR	31	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7007	60.783	2	1313.6575	1313.6575	K	L	19	32
PSM	DADDAVYELDGK	32	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5969	52.456	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELNGK	33	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6174	54.06	2	1308.5834	1308.5834	R	E	47	59
PSM	IHIDPEIQDGSPTTSR	34	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:21	ms_run[2]:scan=6425	56.069	3	1844.8306	1844.8306	R	R	102	118
PSM	PIRPGQHPAASPTHPSAIR	35	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=2717	24.768	2	2069.032	2069.0320	K	G	923	942
PSM	RLSTSPDVIQGHQPR	36	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=4415	39.535	3	1769.8574	1769.8574	R	D	264	279
PSM	RPGAQPLPPPPPSQSPEPTEPHPR	37	sp|Q9UIS9-4|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:21	ms_run[2]:scan=5134	45.508	3	2645.2751	2645.2751	R	A	283	307
PSM	RSSLPLDHGSPAQENPESEK	38	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=4624	41.287	3	2257.0012	2257.0012	R	S	1276	1296
PSM	RSSVVSPSHPPPAPPLGSPPGPK	39	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:21	ms_run[2]:scan=6337	55.351	3	2324.1678	2324.1678	K	P	291	314
PSM	SNSVEKPVSSILSR	40	sp|Q9UI08-4|EVL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=7922	68.249	2	1581.7764	1581.7764	R	T	329	343
PSM	VTIAQGGVLPNIQAVLLPK	41	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16232	136.81	2	1930.1615	1930.1615	K	K	101	120
PSM	AGDLLEDSPK	42	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:21	ms_run[2]:scan=4626	41.299	2	1123.4798	1123.4798	R	R	151	161
PSM	HPPFSPPEPPLSSPASQHK	43	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=7054	61.187	3	2115.9779	2115.9779	R	G	622	641
PSM	HTFMGVVSLGSPSGEVSHPR	44	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7768	66.999	3	2175.9773	2175.9773	R	K	318	338
PSM	RGSIGENQIK	45	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=2000	18.18	2	1180.5602	1180.5602	K	D	194	204
PSM	RPEGPGAQAPSSPR	46	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:21	ms_run[2]:scan=1210	10.672	2	1485.6726	1485.6726	R	V	504	518
PSM	RPGPAASPTPGPGPAPPAAPAPPR	47	sp|Q9NUE0|ZDH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:21	ms_run[2]:scan=5556	49.056	3	2263.1263	2263.1263	R	W	24	48
PSM	SGDETPGSEVPGDK	48	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:21	ms_run[2]:scan=2644	24.11	2	1453.561	1453.5610	R	A	161	175
PSM	STAQQELDGKPASPTPVIVASHTANK	49	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=6185	54.152	3	2726.3276	2726.3276	R	E	818	844
PSM	LEGLTDEINFLR	50	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13880	117.40949333333333	2	1418.741200	1418.740545	R	Q	214	226
PSM	NRHSPDHPGMGSSQASSSSSLR	51	sp|A0JLT2|MED19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=939	8.181135000000001	3	2376.988211	2376.986650	K	-	223	245
PSM	AEQSLHDLQER	52	sp|Q13586-2|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21	ms_run[2]:scan=3283	29.689	2	1404.6035	1404.6035	R	L	254	265
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	53	sp|Q9BUJ2-5|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	28-UNIMOD:21	ms_run[2]:scan=6600	57.449	3	3407.6452	3407.6452	R	N	215	246
PSM	KQSLGELIGTLNAAK	54	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=12236	104.28	2	1621.844	1621.8440	R	V	19	34
PSM	LKNDMAVPTPPPPPVPPTK	55	sp|Q96RN5-3|MED15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=6847	59.493	3	2091.0476	2091.0476	K	Q	484	503
PSM	RAPSVANVGSHCDLSLK	56	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=6364	55.566	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RESPSPAPKPR	57	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=635	5.8238	2	1300.6289	1300.6289	K	K	448	459
PSM	RHDEDEDDSLKDR	58	sp|O94915|FRYL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=797	7.046	3	1628.7027	1628.7027	R	E	1329	1342
PSM	RSSVVSPSHPPPAPPLGSPPGPK	59	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:21	ms_run[2]:scan=6210	54.34	3	2324.1678	2324.1678	K	P	291	314
PSM	RSSVVSPSHPPPAPPLGSPPGPK	60	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:21	ms_run[2]:scan=6463	56.359	3	2324.1678	2324.1678	K	P	291	314
PSM	SNSVEKPVSSILSR	61	sp|Q9UI08-4|EVL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=7924	68.26	3	1581.7764	1581.7764	R	T	329	343
PSM	STAQQELDGKPASPTPVIVASHTANK	62	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=6370	55.611	3	2726.3276	2726.3276	R	E	818	844