MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr05.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr05.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	416-UNIMOD:21,417-UNIMOD:21	0.05	51.0	2	1	0
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	123-UNIMOD:21,125-UNIMOD:21,128-UNIMOD:21	0.10	50.0	5	1	0
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	52-UNIMOD:4,38-UNIMOD:35	0.09	49.0	4	2	0
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.05	49.0	2	1	0
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	49.0	null	179-UNIMOD:28	0.05	49.0	3	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	100-UNIMOD:21,114-UNIMOD:21,107-UNIMOD:21	0.03	49.0	4	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	86-UNIMOD:21	0.06	48.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	57-UNIMOD:21,129-UNIMOD:21,126-UNIMOD:21	0.29	48.0	22	2	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	585-UNIMOD:21	0.03	48.0	6	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	2	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	106-UNIMOD:21	0.18	48.0	10	2	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	73-UNIMOD:21	0.14	48.0	4	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	47.0	null	246-UNIMOD:35	0.05	47.0	74	2	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	741-UNIMOD:4	0.01	47.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	5	1	0
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	120-UNIMOD:21,100-UNIMOD:21,104-UNIMOD:4	0.16	47.0	2	2	2
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	383-UNIMOD:35,507-UNIMOD:4,514-UNIMOD:21	0.08	47.0	4	2	1
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	76-UNIMOD:4	0.07	46.0	3	1	0
PRT	sp|Q9NUJ1-3|ABHDA_HUMAN	Isoform 3 of Mycophenolic acid acyl-glucuronide esterase, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.10	46.0	1	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.01	46.0	1	1	1
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.05	46.0	5	2	1
PRT	sp|P08648|ITA5_HUMAN	Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|P10643|CO7_HUMAN	Complement component C7 OS=Homo sapiens OX=9606 GN=C7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	103-UNIMOD:4,109-UNIMOD:4	0.02	46.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	317-UNIMOD:21	0.04	46.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|Q96GN5-5|CDA7L_HUMAN	Isoform 4 of Cell division cycle-associated 7-like protein OS=Homo sapiens OX=9606 GN=CDCA7L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	71-UNIMOD:21	0.05	45.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	45.0	4	1	0
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.02	45.0	5	2	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1943-UNIMOD:21,1373-UNIMOD:35,1379-UNIMOD:4,988-UNIMOD:4,172-UNIMOD:4,365-UNIMOD:35,1910-UNIMOD:35	0.08	45.0	21	9	6
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	118-UNIMOD:21	0.05	45.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	1	1	1
PRT	sp|P26232-3|CTNA2_HUMAN	Isoform 3 of Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	654-UNIMOD:21,657-UNIMOD:21,651-UNIMOD:21	0.02	45.0	2	1	0
PRT	sp|P68402|PA1B2_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	2-UNIMOD:1	0.10	45.0	2	1	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	157-UNIMOD:21,1574-UNIMOD:35	0.03	44.0	3	3	3
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	306-UNIMOD:21	0.06	44.0	4	3	2
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	125-UNIMOD:21,126-UNIMOD:21,100-UNIMOD:21,101-UNIMOD:4	0.26	44.0	10	3	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	4346-UNIMOD:35,4348-UNIMOD:35	0.01	44.0	2	2	2
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	138-UNIMOD:35	0.05	44.0	7	1	0
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	30-UNIMOD:21,37-UNIMOD:35,33-UNIMOD:21,28-UNIMOD:21	0.04	44.0	6	1	0
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	631-UNIMOD:21,623-UNIMOD:21	0.03	43.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	377-UNIMOD:21,398-UNIMOD:21	0.01	43.0	2	1	0
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	220-UNIMOD:4	0.03	43.0	2	1	0
PRT	sp|Q6V0I7-2|FAT4_HUMAN	Isoform 2 of Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.01	43.0	2	1	0
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	445-UNIMOD:28	0.02	43.0	3	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	131-UNIMOD:35	0.06	43.0	3	2	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	83-UNIMOD:21,699-UNIMOD:4	0.03	43.0	2	2	2
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	92-UNIMOD:35	0.10	43.0	3	1	0
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.12	43.0	5	1	0
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1088-UNIMOD:35,1934-UNIMOD:35,1451-UNIMOD:35,920-UNIMOD:4	0.07	42.0	10	8	6
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	369-UNIMOD:4,383-UNIMOD:35,369-UNIMOD:385,591-UNIMOD:4	0.04	42.0	4	2	1
PRT	sp|P30279|CCND2_HUMAN	G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	271-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	154-UNIMOD:21,157-UNIMOD:21,221-UNIMOD:21	0.13	42.0	5	2	1
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	58-UNIMOD:35	0.03	42.0	2	1	0
PRT	sp|O43182-5|RHG06_HUMAN	Isoform 5 of Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	159-UNIMOD:35	0.03	42.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1016-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	61-UNIMOD:35	0.05	42.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	676-UNIMOD:21,529-UNIMOD:21,702-UNIMOD:21,642-UNIMOD:21,624-UNIMOD:21	0.13	42.0	32	5	1
PRT	sp|P39060-2|COIA1_HUMAN	Isoform 3 of Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	290-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	2	1	0
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	324-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q6ZV73-2|FGD6_HUMAN	Isoform 2 of FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1197-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|P23142-2|FBLN1_HUMAN	Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	354-UNIMOD:4,360-UNIMOD:4,367-UNIMOD:4	0.09	42.0	4	3	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	140-UNIMOD:21,151-UNIMOD:4	0.05	42.0	2	1	0
PRT	sp|Q8WXH0-2|SYNE2_HUMAN	Isoform 2 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	766-UNIMOD:35	0.00	42.0	2	1	0
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	56-UNIMOD:21	0.04	42.0	3	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.01	42.0	1	1	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.20	42.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.08	42.0	1	1	1
PRT	sp|P29972-4|AQP1_HUMAN	Isoform 4 of Aquaporin-1 OS=Homo sapiens OX=9606 GN=AQP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.14	42.0	2	1	0
PRT	sp|P23142|FBLN1_HUMAN	Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	235-UNIMOD:35	0.08	41.0	1	1	1
PRT	sp|Q96TC7-2|RMD3_HUMAN	Isoform 2 of Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	64-UNIMOD:21,73-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	77-UNIMOD:21,81-UNIMOD:21,83-UNIMOD:21	0.21	41.0	6	3	2
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	2	2	2
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	2	2	2
PRT	sp|Q5VSL9-4|STRP1_HUMAN	Isoform 4 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	59-UNIMOD:21	0.10	41.0	2	1	0
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	44-UNIMOD:35	0.08	41.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35,1177-UNIMOD:21,43-UNIMOD:35,45-UNIMOD:35	0.04	41.0	6	3	0
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	161-UNIMOD:4,171-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	360-UNIMOD:21,362-UNIMOD:21	0.00	41.0	2	1	0
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1800-UNIMOD:21	0.01	41.0	3	1	0
PRT	sp|Q9NYV4-2|CDK12_HUMAN	Isoform 2 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|Q8IUC4-2|RHPN2_HUMAN	Isoform 2 of Rhophilin-2 OS=Homo sapiens OX=9606 GN=RHPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	463-UNIMOD:21,466-UNIMOD:35,468-UNIMOD:4	0.03	41.0	2	1	0
PRT	sp|Q6DN12-3|MCTP2_HUMAN	Isoform 3 of Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	326-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	79-UNIMOD:35	0.04	40.0	3	2	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	151-UNIMOD:35	0.08	40.0	2	1	0
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	70-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|O94887-3|FARP2_HUMAN	Isoform 3 of FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	439-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	172-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q4VCS5-2|AMOT_HUMAN	Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	305-UNIMOD:21,303-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1679-UNIMOD:21,1725-UNIMOD:4,1681-UNIMOD:21	0.02	40.0	4	2	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	4	3	2
PRT	sp|Q96RG2-4|PASK_HUMAN	Isoform 3 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	843-UNIMOD:21,859-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q96S66-4|CLCC1_HUMAN	Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	324-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	2	2	2
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	2	1	0
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	499-UNIMOD:21,503-UNIMOD:35	0.02	40.0	8	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	387-UNIMOD:4,396-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	391-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.06	40.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q96S99|PKHF1_HUMAN	Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:4	0.06	40.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	720-UNIMOD:35,714-UNIMOD:28	0.02	40.0	3	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	3	1	0
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	36-UNIMOD:4	0.07	40.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	18-UNIMOD:21,2-UNIMOD:1	0.09	40.0	11	3	2
PRT	sp|Q7Z3K6-4|MIER3_HUMAN	Isoform 4 of Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	83-UNIMOD:21,87-UNIMOD:4	0.06	40.0	1	1	1
PRT	sp|Q9Y4G2|PKHM1_HUMAN	Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	280-UNIMOD:21,284-UNIMOD:4,288-UNIMOD:35,290-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q92835-3|SHIP1_HUMAN	Isoform 3 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	606-UNIMOD:4	0.04	40.0	2	2	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	388-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	198-UNIMOD:21,205-UNIMOD:4,206-UNIMOD:4,227-UNIMOD:35	0.09	40.0	1	1	1
PRT	sp|Q9BY89-2|K1671_HUMAN	Isoform 2 of Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	110-UNIMOD:21,119-UNIMOD:35,128-UNIMOD:4,115-UNIMOD:21,103-UNIMOD:21,105-UNIMOD:21	0.10	40.0	5	1	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	764-UNIMOD:35,763-UNIMOD:35,599-UNIMOD:21,602-UNIMOD:21,606-UNIMOD:35	0.04	40.0	9	2	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	276-UNIMOD:35	0.02	40.0	4	1	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	486-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9P289-2|STK26_HUMAN	Isoform 2 of Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	223-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.11	39.0	1	1	1
PRT	sp|P24821-5|TENA_HUMAN	Isoform 5 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4,64-UNIMOD:4,72-UNIMOD:21	0.02	39.0	2	2	1
PRT	sp|Q9C086|IN80B_HUMAN	INO80 complex subunit B OS=Homo sapiens OX=9606 GN=INO80B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|O94979-3|SC31A_HUMAN	Isoform 3 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	532-UNIMOD:21,527-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	591-UNIMOD:21,604-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|P22033|MUTA_HUMAN	Methylmalonyl-CoA mutase, mitochondrial OS=Homo sapiens OX=9606 GN=MMUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	159-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	97-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	908-UNIMOD:4,914-UNIMOD:4,921-UNIMOD:4,1888-UNIMOD:35,1889-UNIMOD:4,1895-UNIMOD:4,2111-UNIMOD:4,2128-UNIMOD:35,2131-UNIMOD:4	0.02	39.0	3	3	3
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.05	39.0	6	1	0
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	407-UNIMOD:35	0.04	39.0	1	1	1
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	953-UNIMOD:21	0.01	39.0	5	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|P42566-2|EPS15_HUMAN	Isoform 2 of Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9UKY1|ZHX1_HUMAN	Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	630-UNIMOD:35,640-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:35,10-UNIMOD:4	0.02	39.0	2	2	2
PRT	sp|Q6KC79-2|NIPBL_HUMAN	Isoform 2 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1743-UNIMOD:35,1754-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|P50993|AT1A2_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens OX=9606 GN=ATP1A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	372-UNIMOD:4	0.03	39.0	2	2	2
PRT	sp|Q8WU90-2|ZC3HF_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.10	39.0	1	1	1
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null		0.09	39.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	3	1	0
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	2	2
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	659-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q76I76|SSH2_HUMAN	Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	708-UNIMOD:21,721-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	270-UNIMOD:4	0.08	39.0	2	1	0
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	220-UNIMOD:21,224-UNIMOD:21,939-UNIMOD:21,951-UNIMOD:35	0.05	39.0	2	2	2
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	15-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	208-UNIMOD:35,211-UNIMOD:35	0.05	39.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	20-UNIMOD:35	0.02	39.0	2	2	2
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	167-UNIMOD:21,165-UNIMOD:21	0.15	39.0	4	3	2
PRT	sp|Q5EBL4|RIPL1_HUMAN	RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	259-UNIMOD:21	0.07	39.0	1	1	0
PRT	sp|P50750-2|CDK9_HUMAN	Isoform 2 of Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	55-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|Q05086-2|UBE3A_HUMAN	Isoform I of Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	175-UNIMOD:4,180-UNIMOD:35	0.02	38.0	2	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	3	1	0
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	203-UNIMOD:35	0.05	38.0	2	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	602-UNIMOD:4,605-UNIMOD:35,589-UNIMOD:35,592-UNIMOD:35,602-UNIMOD:385	0.06	38.0	7	3	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1196-UNIMOD:4	0.01	38.0	2	2	2
PRT	sp|P25940|CO5A3_HUMAN	Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	351-UNIMOD:35	0.01	38.0	1	1	1
PRT	sp|Q8IWE2-2|NXP20_HUMAN	Isoform 2 of Protein NOXP20 OS=Homo sapiens OX=9606 GN=FAM114A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|O43301|HS12A_HUMAN	Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9H8L6|MMRN2_HUMAN	Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	263-UNIMOD:21,251-UNIMOD:27	0.05	38.0	23	2	0
PRT	sp|P54753|EPHB3_HUMAN	Ephrin type-B receptor 3 OS=Homo sapiens OX=9606 GN=EPHB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	616-UNIMOD:21,624-UNIMOD:21,634-UNIMOD:4,629-UNIMOD:21	0.04	38.0	2	1	0
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1119-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	88-UNIMOD:35	0.09	38.0	3	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	145-UNIMOD:21,175-UNIMOD:35	0.07	38.0	2	2	2
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	971-UNIMOD:21,979-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	208-UNIMOD:21,211-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	166-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1620-UNIMOD:35,1418-UNIMOD:35,3902-UNIMOD:35,2806-UNIMOD:4	0.05	38.0	19	14	11
PRT	sp|Q0VD83|APOBR_HUMAN	Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	485-UNIMOD:35	0.03	38.0	3	2	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.14	38.0	2	2	2
PRT	sp|P14780|MMP9_HUMAN	Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	256-UNIMOD:4	0.03	38.0	4	1	0
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	2	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	53-UNIMOD:35,55-UNIMOD:35	0.03	38.0	5	2	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	622-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35	0.02	38.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	655-UNIMOD:4	0.02	38.0	2	1	0
PRT	sp|Q8IYQ7|THNS1_HUMAN	Threonine synthase-like 1 OS=Homo sapiens OX=9606 GN=THNSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	203-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null		0.01	38.0	2	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	694-UNIMOD:35	0.01	38.0	3	1	0
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	4	1	0
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2753-UNIMOD:21	0.01	38.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	255-UNIMOD:21,226-UNIMOD:21,224-UNIMOD:27	0.07	38.0	20	4	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	173-UNIMOD:27,181-UNIMOD:21	0.11	38.0	1	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	38.0	2	1	0
PRT	sp|Q7Z333|SETX_HUMAN	Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.01	38.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	678-UNIMOD:21,683-UNIMOD:21,359-UNIMOD:35	0.05	37.0	3	2	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	23-UNIMOD:21,31-UNIMOD:4,293-UNIMOD:21,461-UNIMOD:21	0.07	37.0	4	4	4
PRT	sp|Q9UH92-3|MLX_HUMAN	Isoform Beta of Max-like protein X OS=Homo sapiens OX=9606 GN=MLX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	44-UNIMOD:21	0.12	37.0	1	1	1
PRT	sp|Q12824-2|SNF5_HUMAN	Isoform B of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.09	37.0	1	1	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	447-UNIMOD:21	0.04	37.0	2	2	2
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	363-UNIMOD:21,610-UNIMOD:21,1106-UNIMOD:21,1110-UNIMOD:21	0.03	37.0	5	3	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	67-UNIMOD:21,66-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	433-UNIMOD:21	0.03	37.0	8	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|P07203|GPX1_HUMAN	Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	144-UNIMOD:35	0.09	37.0	2	1	0
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1156-UNIMOD:21,1154-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q8NBJ4-2|GOLM1_HUMAN	Isoform 2 of Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	347-UNIMOD:35,459-UNIMOD:21,426-UNIMOD:21	0.11	37.0	4	3	2
PRT	sp|P01042-3|KNG1_HUMAN	Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	292-UNIMOD:4,296-UNIMOD:21,304-UNIMOD:4,291-UNIMOD:21	0.05	37.0	5	1	0
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	45-UNIMOD:4	0.17	37.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	2	2	2
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	249-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q6AI12|ANR40_HUMAN	Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	93-UNIMOD:35	0.06	37.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	375-UNIMOD:35,376-UNIMOD:21,390-UNIMOD:21	0.04	37.0	3	1	0
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	3	3	3
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	481-UNIMOD:35,1104-UNIMOD:21,1114-UNIMOD:21	0.04	37.0	2	2	2
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	352-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	208-UNIMOD:35,209-UNIMOD:21,438-UNIMOD:21	0.05	37.0	3	2	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	194-UNIMOD:4	0.03	37.0	2	2	2
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	988-UNIMOD:35,994-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q9Y6X4|F169A_HUMAN	Soluble lamin-associated protein of 75 kDa OS=Homo sapiens OX=9606 GN=FAM169A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P18859|ATP5J_HUMAN	ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.19	37.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	394-UNIMOD:21,397-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9HCY8|S10AE_HUMAN	Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	48-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	180-UNIMOD:21,186-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	357-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	37.0	3	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|P10606|COX5B_HUMAN	Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	31-UNIMOD:35	0.16	37.0	1	1	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	459-UNIMOD:21,461-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	426-UNIMOD:21	0.03	37.0	13	1	0
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	174-UNIMOD:35	0.02	37.0	3	1	0
PRT	sp|Q8NFD5-4|ARI1B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	999-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	322-UNIMOD:4	0.04	37.0	3	2	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	28-UNIMOD:4,29-UNIMOD:35,33-UNIMOD:4	0.17	37.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2094-UNIMOD:4,717-UNIMOD:4	0.02	37.0	5	3	2
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	579-UNIMOD:28,583-UNIMOD:21	0.02	37.0	4	1	0
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	712-UNIMOD:28	0.01	37.0	2	1	0
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	120-UNIMOD:27,123-UNIMOD:21	0.09	37.0	2	1	0
PRT	sp|Q8IXQ4|GPAM1_HUMAN	GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	102-UNIMOD:28,105-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q53TN4|CYBR1_HUMAN	Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	249-UNIMOD:35,257-UNIMOD:35,260-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	57-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|O15417|TNC18_HUMAN	Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens OX=9606 GN=TNRC18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2543-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O94760-2|DDAH1_HUMAN	Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	108-UNIMOD:35,114-UNIMOD:4	0.05	36.0	2	1	0
PRT	sp|Q9H0P0-3|5NT3A_HUMAN	Isoform 4 of Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8WWV3-3|RT4I1_HUMAN	Isoform 3 of Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RTN4IP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	128-UNIMOD:35,130-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|Q8IWF6|DEN6A_HUMAN	Protein DENND6A OS=Homo sapiens OX=9606 GN=DENND6A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|P46736-5|BRCC3_HUMAN	Isoform 5 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	35-UNIMOD:35,38-UNIMOD:4	0.07	36.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	1	0
PRT	sp|O75398-5|DEAF1_HUMAN	Isoform 4 of Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	176-UNIMOD:21	0.05	36.0	3	1	0
PRT	sp|Q92851-7|CASPA_HUMAN	Isoform 7 of Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	169-UNIMOD:4,174-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P23229-4|ITA6_HUMAN	Isoform Alpha-6X2A of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|O43264|ZW10_HUMAN	Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	2	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9Y5S1|TRPV2_HUMAN	Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q5EBL4-3|RIPL1_HUMAN	Isoform 3 of RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	108-UNIMOD:21	0.12	36.0	1	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	3206-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|Q9HBB8-2|CDHR5_HUMAN	Isoform 2 of Cadherin-related family member 5 OS=Homo sapiens OX=9606 GN=CDHR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	549-UNIMOD:35,560-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	886-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q5VT52-5|RPRD2_HUMAN	Isoform 5 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	708-UNIMOD:21,712-UNIMOD:35,713-UNIMOD:35,724-UNIMOD:35,704-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|Q6NSI3|FA53A_HUMAN	Protein FAM53A OS=Homo sapiens OX=9606 GN=FAM53A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	303-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|P02774-2|VTDB_HUMAN	Isoform 2 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	253-UNIMOD:4,254-UNIMOD:4,262-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	629-UNIMOD:21,644-UNIMOD:35	0.03	36.0	3	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	819-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P30291-2|WEE1_HUMAN	Isoform 2 of Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|P09327-2|VILI_HUMAN	Isoform 2 of Villin-1 OS=Homo sapiens OX=9606 GN=VIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q96LR5|UB2E2_HUMAN	Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	990-UNIMOD:35,1356-UNIMOD:35,1917-UNIMOD:35	0.04	36.0	10	5	2
PRT	sp|P26640-2|SYVC_HUMAN	Isoform 2 of Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	782-UNIMOD:21	0.03	36.0	2	2	2
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	131-UNIMOD:4	0.07	36.0	2	2	2
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	132-UNIMOD:21	0.09	36.0	3	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	3	2	1
PRT	sp|P24821|TENA_HUMAN	Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	392-UNIMOD:385,392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4,480-UNIMOD:4,484-UNIMOD:35,485-UNIMOD:4,487-UNIMOD:4,496-UNIMOD:4	0.02	36.0	2	2	1
PRT	sp|Q8IV56|PRR15_HUMAN	Proline-rich protein 15 OS=Homo sapiens OX=9606 GN=PRR15 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	49-UNIMOD:21	0.26	36.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	15-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q8IVL1|NAV2_HUMAN	Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	1797-UNIMOD:28,1799-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P67870|CSK2B_HUMAN	Casein kinase II subunit beta OS=Homo sapiens OX=9606 GN=CSNK2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	23-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	164-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	364-UNIMOD:35,365-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	607-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9NUQ8-2|ABCF3_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P23327|SRCH_HUMAN	Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	567-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q5VWQ8-3|DAB2P_HUMAN	Isoform 3 of Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	259-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	114-UNIMOD:35,120-UNIMOD:21,124-UNIMOD:21,267-UNIMOD:21	0.12	35.0	2	2	2
PRT	sp|Q86US8-3|EST1A_HUMAN	Isoform 3 of Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1074-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	950-UNIMOD:21,957-UNIMOD:35	0.01	35.0	3	1	0
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|O60238-2|BNI3L_HUMAN	Isoform 2 of BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	78-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	338-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q96M32|KAD7_HUMAN	Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P61224-3|RAP1B_HUMAN	Isoform 3 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	92-UNIMOD:35	0.08	35.0	25	1	0
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q14376-2|GALE_HUMAN	Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	3	1	0
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|Q9NR99|MXRA5_HUMAN	Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2324-UNIMOD:4	0.01	35.0	2	2	2
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	504-UNIMOD:4,505-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	185-UNIMOD:35	0.02	35.0	2	2	2
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	642-UNIMOD:21,658-UNIMOD:4	0.02	35.0	1	1	0
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	736-UNIMOD:4,753-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q99871-3|HAUS7_HUMAN	Isoform 3 of HAUS augmin-like complex subunit 7 OS=Homo sapiens OX=9606 GN=HAUS7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|P22694-10|KAPCB_HUMAN	Isoform 10 of cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	243-UNIMOD:21,246-UNIMOD:4	0.06	35.0	4	3	2
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1011-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|Q709C8-3|VP13C_HUMAN	Isoform 3 of Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1329-UNIMOD:4	0.00	35.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	32-UNIMOD:4	0.10	35.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	3	1	0
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	587-UNIMOD:35,590-UNIMOD:21,595-UNIMOD:21,597-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	315-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	819-UNIMOD:35,823-UNIMOD:35	0.01	35.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9UJA5-4|TRM6_HUMAN	Isoform 4 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	306-UNIMOD:21,302-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	160-UNIMOD:4,181-UNIMOD:4	0.06	35.0	2	2	2
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	140-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q96K49-2|TM87B_HUMAN	Isoform 2 of Transmembrane protein 87B OS=Homo sapiens OX=9606 GN=TMEM87B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	493-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	229-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1027-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	425-UNIMOD:35	0.06	35.0	3	2	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2057-UNIMOD:4,604-UNIMOD:4	0.01	35.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	133-UNIMOD:35,106-UNIMOD:28,113-UNIMOD:21	0.04	35.0	4	3	2
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	2	2	2
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	52-UNIMOD:385,52-UNIMOD:4,58-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|O94966|UBP19_HUMAN	Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	1042-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	35.0	2	1	0
PRT	sp|Q9UM54|MYO6_HUMAN	Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.14	34.0	5	2	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	646-UNIMOD:35	0.02	34.0	2	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	401-UNIMOD:21,405-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q96BZ8|LENG1_HUMAN	Leukocyte receptor cluster member 1 OS=Homo sapiens OX=9606 GN=LENG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:4,77-UNIMOD:4,86-UNIMOD:4	0.06	34.0	9	2	1
PRT	sp|Q01484-7|ANK2_HUMAN	Isoform 5 of Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	355-UNIMOD:35,359-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.17	34.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	111-UNIMOD:35	0.08	34.0	7	1	0
PRT	sp|Q14766-3|LTBP1_HUMAN	Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1198-UNIMOD:4,1049-UNIMOD:4,1057-UNIMOD:4	0.02	34.0	4	2	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	494-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	53-UNIMOD:4,17-UNIMOD:35,26-UNIMOD:35	0.16	34.0	2	2	2
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	583-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	229-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q9H4Z3|CAPAM_HUMAN	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|O43491-4|E41L2_HUMAN	Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	38-UNIMOD:21,232-UNIMOD:4	0.06	34.0	2	2	2
PRT	sp|P02760|AMBP_HUMAN	Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	337-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|O95104-2|SCAF4_HUMAN	Isoform 2 of SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1179-UNIMOD:21,1188-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	917-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8TE04|PANK1_HUMAN	Pantothenate kinase 1 OS=Homo sapiens OX=9606 GN=PANK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P78559|MAP1A_HUMAN	Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	612-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q6P158-3|DHX57_HUMAN	Isoform 3 of Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	40-UNIMOD:4,41-UNIMOD:4	0.07	34.0	2	2	2
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	1	0
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	6	1	0
PRT	sp|P13671|CO6_HUMAN	Complement component C6 OS=Homo sapiens OX=9606 GN=C6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	158-UNIMOD:4,164-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	264-UNIMOD:21,279-UNIMOD:35	0.07	34.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	99-UNIMOD:35,113-UNIMOD:21,106-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1291-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|Q96HF1|SFRP2_HUMAN	Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	190-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	287-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9BWS9-3|CHID1_HUMAN	Isoform 3 of Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	200-UNIMOD:4	0.02	34.0	4	1	0
PRT	sp|O43768-8|ENSA_HUMAN	Isoform 8 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.14	34.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	355-UNIMOD:21,361-UNIMOD:35	0.05	34.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	661-UNIMOD:4,662-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P01024|CO3_HUMAN	Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	557-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	42-UNIMOD:21	0.11	34.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	644-UNIMOD:21,1794-UNIMOD:21	0.02	34.0	3	2	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9Y2Q0-3|AT8A1_HUMAN	Isoform 3 of Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	29-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	283-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q8NHM5-4|KDM2B_HUMAN	Isoform 4 of Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	906-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q15637-5|SF01_HUMAN	Isoform 5 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	205-UNIMOD:21,207-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	350-UNIMOD:4,359-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	571-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9Y2J2-4|E41L3_HUMAN	Isoform 4 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	124-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q96N77-2|ZN641_HUMAN	Isoform 2 of Zinc finger protein 641 OS=Homo sapiens OX=9606 GN=ZNF641	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	177-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q9Y5P4-2|CERT_HUMAN	Isoform 2 of Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	153-UNIMOD:4	0.07	34.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	1	1	1
PRT	sp|Q6P6C2-3|ALKB5_HUMAN	Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	58-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.16	34.0	1	1	1
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	248-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	202-UNIMOD:28,204-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1616-UNIMOD:21,1619-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q92845|KIFA3_HUMAN	Kinesin-associated protein 3 OS=Homo sapiens OX=9606 GN=KIFAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	692-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	260-UNIMOD:35,272-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|P01009|A1AT_HUMAN	Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q9NUJ1|ABHDA_HUMAN	Mycophenolic acid acyl-glucuronide esterase, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.07	34.0	1	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	209-UNIMOD:4	0.01	33.0	2	1	0
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9Y320-2|TMX2_HUMAN	Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	250-UNIMOD:21	0.10	33.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q96EZ8-3|MCRS1_HUMAN	Isoform 3 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	95-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9Y282-2|ERGI3_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	142-UNIMOD:4,145-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	277-UNIMOD:4,278-UNIMOD:21	0.01	33.0	1	1	0
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9H1H9-3|KI13A_HUMAN	Isoform 3 of Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P46939-2|UTRO_HUMAN	Isoform 2 of Utrophin OS=Homo sapiens OX=9606 GN=UTRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	2705-UNIMOD:35,2712-UNIMOD:35	0.00	33.0	3	1	0
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	86-UNIMOD:35	0.11	33.0	1	1	1
PRT	sp|Q6P4A8|PLBL1_HUMAN	Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	489-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q12846-2|STX4_HUMAN	Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	511-UNIMOD:21,518-UNIMOD:35	0.07	33.0	3	2	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	434-UNIMOD:35,444-UNIMOD:21	0.04	33.0	3	1	0
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9HAS0|NJMU_HUMAN	Protein Njmu-R1 OS=Homo sapiens OX=9606 GN=C17orf75 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|P39656-2|OST48_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	108-UNIMOD:4	0.04	33.0	2	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	143-UNIMOD:21,160-UNIMOD:4	0.01	33.0	2	1	0
PRT	sp|Q63ZY3-3|KANK2_HUMAN	Isoform 3 of KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	573-UNIMOD:21,568-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q99536-3|VAT1_HUMAN	Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	153-UNIMOD:21	0.07	33.0	4	1	0
PRT	sp|Q96RL1-5|UIMC1_HUMAN	Isoform 5 of BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|Q53EQ6-2|TIGD5_HUMAN	Isoform 2 of Tigger transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=TIGD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	147-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q96QE3-2|ATAD5_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1333-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9UDY2-4|ZO2_HUMAN	Isoform C2 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	1	0
PRT	sp|P13866-2|SC5A1_HUMAN	Isoform 2 of Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	109-UNIMOD:35,105-UNIMOD:21	0.16	33.0	2	1	0
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|Q9H6A9-3|PCX3_HUMAN	Isoform 3 of Pecanex-like protein 3 OS=Homo sapiens OX=9606 GN=PCNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	796-UNIMOD:21	0.02	33.0	1	1	0
PRT	sp|O94906|PRP6_HUMAN	Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q99504-2|EYA3_HUMAN	Isoform 2 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	143-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|A6NDU8|CE051_HUMAN	UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q15723-4|ELF2_HUMAN	Isoform 4 of ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	215-UNIMOD:21,218-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q0ZGT2-4|NEXN_HUMAN	Isoform 4 of Nexilin OS=Homo sapiens OX=9606 GN=NEXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	351-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9HC84|MUC5B_HUMAN	Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|Q6IQ23-3|PKHA7_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	137-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q13113|PDZ1I_HUMAN	PDZK1-interacting protein 1 OS=Homo sapiens OX=9606 GN=PDZK1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	92-UNIMOD:21	0.16	33.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	227-UNIMOD:21,235-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	199-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.14	33.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	343-UNIMOD:35,377-UNIMOD:35,387-UNIMOD:21,388-UNIMOD:35	0.06	33.0	3	3	3
PRT	sp|Q9Y5T5-4|UBP16_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	105-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P12955-3|PEPD_HUMAN	Isoform 3 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	414-UNIMOD:4,415-UNIMOD:35,418-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P24666-4|PPAC_HUMAN	Isoform 4 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.17	33.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	293-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	448-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O15269|SPTC1_HUMAN	Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1121-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.00	33.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	53-UNIMOD:28	0.04	33.0	3	1	0
PRT	sp|Q96JI7|SPTCS_HUMAN	Spatacsin OS=Homo sapiens OX=9606 GN=SPG11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	325-UNIMOD:35	0.01	33.0	1	1	0
PRT	sp|A7KAX9|RHG32_HUMAN	Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	706-UNIMOD:21	0.01	33.0	1	1	0
PRT	sp|Q9BQI7|PSD2_HUMAN	PH and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PSD2 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	36-UNIMOD:21,41-UNIMOD:21,42-UNIMOD:21,44-UNIMOD:4,45-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P14616|INSRR_HUMAN	Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1271-UNIMOD:21,1275-UNIMOD:21,1281-UNIMOD:21,1282-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8IWI9|MGAP_HUMAN	MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1497-UNIMOD:21,1498-UNIMOD:21,1505-UNIMOD:21,1511-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1285-UNIMOD:35,1288-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	18-UNIMOD:4	0.12	32.0	2	1	0
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	333-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	518-UNIMOD:21,527-UNIMOD:21	0.05	32.0	3	2	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.11	32.0	3	2	1
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1534-UNIMOD:4,1540-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	670-UNIMOD:4,677-UNIMOD:21,686-UNIMOD:4	0.05	32.0	2	2	2
PRT	sp|Q9H4E7|DEFI6_HUMAN	Differentially expressed in FDCP 6 homolog OS=Homo sapiens OX=9606 GN=DEF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	69-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|B2RTY4-3|MYO9A_HUMAN	Isoform 3 of Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	152-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	491-UNIMOD:35,494-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9HB21-2|PKHA1_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	163-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9ULZ3-3|ASC_HUMAN	Isoform 3 of Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	996-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|O14526-3|FCHO1_HUMAN	Isoform 3 of F-BAR domain only protein 1 OS=Homo sapiens OX=9606 GN=FCHO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q5SRH9-2|TT39A_HUMAN	Isoform 2 of Tetratricopeptide repeat protein 39A OS=Homo sapiens OX=9606 GN=TTC39A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	113-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P52434-3|RPAB3_HUMAN	Isoform 3 of DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens OX=9606 GN=POLR2H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	1	1	1
PRT	sp|Q9NPL8|TIDC1_HUMAN	Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|Q8NFI4|F10A5_HUMAN	Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	220-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q7Z3J2-2|VP35L_HUMAN	Isoform 2 of VPS35 endosomal protein sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.00	32.0	1	1	1
PRT	sp|Q03013-3|GSTM4_HUMAN	Isoform 3 of Glutathione S-transferase Mu 4 OS=Homo sapiens OX=9606 GN=GSTM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P15408-3|FOSL2_HUMAN	Isoform 3 of Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	2	2
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	32-UNIMOD:35	0.06	32.0	1	1	1
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1956-UNIMOD:35	0.01	32.0	6	1	0
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|Q92859-3|NEO1_HUMAN	Isoform 3 of Neogenin OS=Homo sapiens OX=9606 GN=NEO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	59-UNIMOD:21	0.09	32.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q13228-3|SBP1_HUMAN	Isoform 3 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	551-UNIMOD:21,552-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9NZJ9|NUDT4_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|Q9UHB6-5|LIMA1_HUMAN	Isoform 5 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P17275|JUNB_HUMAN	Transcription factor jun-B OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	255-UNIMOD:21,259-UNIMOD:21,263-UNIMOD:35	0.05	32.0	1	1	1
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	577-UNIMOD:21,599-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	153-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	202-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	121-UNIMOD:21	0.04	32.0	2	2	2
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9P0P8|MRES1_HUMAN	Mitochondrial transcription rescue factor 1 OS=Homo sapiens OX=9606 GN=MTRES1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	106-UNIMOD:21,115-UNIMOD:35,116-UNIMOD:21	0.13	32.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	368-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P02452|CO1A1_HUMAN	Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	70-UNIMOD:4,75-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O94956-3|SO2B1_HUMAN	Isoform 3 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	130-UNIMOD:35	0.02	32.0	2	1	0
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1570-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|P01112|RASH_HUMAN	GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	111-UNIMOD:35	0.07	32.0	1	1	0
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|O95810|CAVN2_HUMAN	Caveolae-associated protein 2 OS=Homo sapiens OX=9606 GN=CAVIN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q6IQ23|PKHA7_HUMAN	Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	569-UNIMOD:21	0.02	32.0	3	1	0
PRT	sp|Q6P1R4|DUS1L_HUMAN	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8N6N3|CA052_HUMAN	UPF0690 protein C1orf52 OS=Homo sapiens OX=9606 GN=C1orf52 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.10	32.0	1	1	1
PRT	sp|Q6P4A7|SFXN4_HUMAN	Sideroflexin-4 OS=Homo sapiens OX=9606 GN=SFXN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	70-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	164-UNIMOD:21,174-UNIMOD:21,176-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P46059|S15A1_HUMAN	Solute carrier family 15 member 1 OS=Homo sapiens OX=9606 GN=SLC15A1 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	441-UNIMOD:21,442-UNIMOD:21,448-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P01042|KNG1_HUMAN	Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	328-UNIMOD:4,332-UNIMOD:21,340-UNIMOD:4	0.03	32.0	2	1	0
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	651-UNIMOD:21,658-UNIMOD:4	0.02	32.0	1	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q8NDF8-4|PAPD5_HUMAN	Isoform 4 of Terminal nucleotidyltransferase 4B OS=Homo sapiens OX=9606 GN=TENT4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	55-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|B4DJY2|TM233_HUMAN	Transmembrane protein 233 OS=Homo sapiens OX=9606 GN=TMEM233 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P20810-4|ICAL_HUMAN	Isoform 4 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	287-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P78310-5|CXAR_HUMAN	Isoform 5 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	146-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	80-UNIMOD:21	0.20	31.0	2	1	0
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	70-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	12-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|Q9BSA9|TM175_HUMAN	Endosomal/lysosomal potassium channel TMEM175 OS=Homo sapiens OX=9606 GN=TMEM175 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	32-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	289-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	617-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q16698-2|DECR_HUMAN	Isoform 2 of 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens OX=9606 GN=DECR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	114-UNIMOD:35	0.05	31.0	2	1	0
PRT	sp|Q96P47-5|AGAP3_HUMAN	Isoform 5 of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=AGAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	2	1	0
PRT	sp|Q93062-4|RBPMS_HUMAN	Isoform D of RNA-binding protein with multiple splicing OS=Homo sapiens OX=9606 GN=RBPMS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	441-UNIMOD:21,445-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q6N022|TEN4_HUMAN	Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	830-UNIMOD:4,834-UNIMOD:35,838-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q969E4|TCAL3_HUMAN	Transcription elongation factor A protein-like 3 OS=Homo sapiens OX=9606 GN=TCEAL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	118-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q96JI7-2|SPTCS_HUMAN	Isoform 2 of Spatacsin OS=Homo sapiens OX=9606 GN=SPG11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:35	0.01	31.0	1	1	0
PRT	sp|P62306|RUXF_HUMAN	Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	84-UNIMOD:35	0.16	31.0	7	1	0
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:4	0.08	31.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	120-UNIMOD:21,124-UNIMOD:21,132-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|Q96M89-2|CC138_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	224-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9NWT6|HIF1N_HUMAN	Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q6H8Q1-4|ABLM2_HUMAN	Isoform 4 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	734-UNIMOD:21,738-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P08575-4|PTPRC_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	449-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P53992-2|SC24C_HUMAN	Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9Y2D5-5|AKAP2_HUMAN	Isoform 2 of A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	84-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P08183-2|MDR1_HUMAN	Isoform 2 of ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	589-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	95-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q8TEP8|CE192_HUMAN	Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	565-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	2	2	2
PRT	sp|Q9BV36-5|MELPH_HUMAN	Isoform 5 of Melanophilin OS=Homo sapiens OX=9606 GN=MLPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9ULG6-3|CCPG1_HUMAN	Isoform 3 of Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	184-UNIMOD:21,190-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	184-UNIMOD:21,186-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	671-UNIMOD:385,671-UNIMOD:4,673-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q12830|BPTF_HUMAN	Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q13287|NMI_HUMAN	N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|Q9H6A9|PCX3_HUMAN	Pecanex-like protein 3 OS=Homo sapiens OX=9606 GN=PCNX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1909-UNIMOD:21	0.01	31.0	1	1	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q8IUD2|RB6I2_HUMAN	ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	177-UNIMOD:21,182-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9HAR2|AGRL3_HUMAN	Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1436-UNIMOD:21,1437-UNIMOD:21,1446-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q8NCM8|DYHC2_HUMAN	Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	2671-UNIMOD:35,2678-UNIMOD:21	0.00	31.0	1	1	1
PRT	sp|Q5JPF3|AN36C_HUMAN	Ankyrin repeat domain-containing protein 36C OS=Homo sapiens OX=9606 GN=ANKRD36C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	312-UNIMOD:21,313-UNIMOD:21,320-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	2202-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|P09493-8|TPM1_HUMAN	Isoform 8 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q6IA17|SIGIR_HUMAN	Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	342-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	966-UNIMOD:4,973-UNIMOD:21,986-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	121-UNIMOD:35,126-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|O15516|CLOCK_HUMAN	Circadian locomoter output cycles protein kaput OS=Homo sapiens OX=9606 GN=CLOCK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	19-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q969T4|UB2E3_HUMAN	Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens OX=9606 GN=UBE2E3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	194-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1451-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:35,26-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	766-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	515-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	37-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P04233-2|HG2A_HUMAN	Isoform 2 of HLA class II histocompatibility antigen gamma chain OS=Homo sapiens OX=9606 GN=CD74	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|P16070-18|CD44_HUMAN	Isoform 18 of CD44 antigen OS=Homo sapiens OX=9606 GN=CD44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	323-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q02817|MUC2_HUMAN	Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	4771-UNIMOD:4,4779-UNIMOD:4	0.00	30.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q9NPG1|FZD3_HUMAN	Frizzled-3 OS=Homo sapiens OX=9606 GN=FZD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	561-UNIMOD:21,567-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|P16219|ACADS_HUMAN	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	261-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	459-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	299-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	337-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9P253|VPS18_HUMAN	Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	741-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	291-UNIMOD:4,294-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q6P4Q7|CNNM4_HUMAN	Metal transporter CNNM4 OS=Homo sapiens OX=9606 GN=CNNM4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	514-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P02649|APOE_HUMAN	Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q8IY67-3|RAVR1_HUMAN	Isoform 3 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.19	30.0	1	1	1
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9H5H4|ZN768_HUMAN	Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	97-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O00409-2|FOXN3_HUMAN	Isoform 2 of Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	327-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O95721|SNP29_HUMAN	Synaptosomal-associated protein 29 OS=Homo sapiens OX=9606 GN=SNAP29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P00738|HPT_HUMAN	Haptoglobin OS=Homo sapiens OX=9606 GN=HP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	797-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	213-UNIMOD:21,217-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	578-UNIMOD:21,580-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1132-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P29536-2|LMOD1_HUMAN	Isoform 2 of Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	453-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y4E1-3|WAC2C_HUMAN	Isoform 3 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9H1C4|UN93B_HUMAN	Protein unc-93 homolog B1 OS=Homo sapiens OX=9606 GN=UNC93B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	547-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q92835|SHIP1_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	819-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|P61224|RAP1B_HUMAN	Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	111-UNIMOD:35	0.08	30.0	1	1	0
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	132-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	107-UNIMOD:28,109-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1956-UNIMOD:35	0.01	30.0	1	1	0
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1094-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|P20591|MX1_HUMAN	Interferon-induced GTP-binding protein Mx1 OS=Homo sapiens OX=9606 GN=MX1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	42-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q6ZV73|FGD6_HUMAN	FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1197-UNIMOD:21	0.01	30.0	1	1	0
PRT	sp|Q14585|ZN345_HUMAN	Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	409-UNIMOD:21,421-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q14624-2|ITIH4_HUMAN	Isoform 2 of Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens OX=9606 GN=ITIH4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	689-UNIMOD:21,691-UNIMOD:35,692-UNIMOD:21,698-UNIMOD:4,700-UNIMOD:21,701-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q9UKZ4|TEN1_HUMAN	Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1938-UNIMOD:21,1943-UNIMOD:21,1944-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|A2RRH5|WDR27_HUMAN	WD repeat-containing protein 27 OS=Homo sapiens OX=9606 GN=WDR27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	484-UNIMOD:21,486-UNIMOD:21,488-UNIMOD:4,497-UNIMOD:4,501-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q96T37|RBM15_HUMAN	RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	749-UNIMOD:21,760-UNIMOD:21,761-UNIMOD:21,765-UNIMOD:21,767-UNIMOD:21	0.02	30.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LPNLSSPSAEGPPGPPSGPAPR	1	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	5-UNIMOD:21	ms_run[2]:scan=13740	70.023	2	2161.0205	2161.0205	R	K	412	434
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	2	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	4-UNIMOD:21	ms_run[2]:scan=8341	43.815	3	3001.2673	3001.2673	R	E	120	150
PSM	MAEGGSGDVDDAGDCSGAR	3	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	15-UNIMOD:4	ms_run[2]:scan=3542	20.485	2	1825.6843	1825.6843	K	Y	38	57
PSM	NAGDLAPAGGAASASTDEAADAESGTR	4	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=9845	50.95	2	2432.0688	2432.0688	R	N	42	69
PSM	QNLYDLDEDDDGIASVPTK	5	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=16566	84.721	2	2106.9593	2106.9593	K	Q	179	198
PSM	RPPSPDVIVLSDNEQPSSPR	6	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14513	73.945	2	2349.0403	2349.0403	R	V	97	117
PSM	DQQPSGSEGEDDDAEAALKK	7	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	5-UNIMOD:21	ms_run[2]:scan=7108	37.632	2	2168.8747	2168.8747	K	E	82	102
PSM	GDQPAASGDSDDDEPPPLPR	8	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=9320	48.416	2	2034.8767	2034.8767	R	L	48	68
PSM	RPPSPDVIVLSDNEQPSSPR	9	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13542	69.008	2	2349.0403	2349.0403	R	V	97	117
PSM	SSPPAPPLPPGSGSPGTPQALPR	10	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=14454	73.648	2	2244.094	2244.0940	R	R	585	608
PSM	WSLEDDDDDEDDPAEAEK	11	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=13537	68.985	2	2092.7869	2092.7869	K	E	198	216
PSM	YGPADVEDTTGSGATDSK	12	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=7796	41.019	2	1769.7592	1769.7592	K	D	79	97
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	13	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	6-UNIMOD:21	ms_run[1]:scan=8954	46.729213333333334	3	2797.239886	2796.233859	K	K	68	94
PSM	DPDAQPGGELMLGGTDSK	14	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	11-UNIMOD:35	ms_run[2]:scan=13493	68.775	2	1802.7993	1802.7993	R	Y	236	254
PSM	LQELESCSGLGSTSDDTDVR	15	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	7-UNIMOD:4	ms_run[2]:scan=11986	61.177	2	2167.9539	2167.9539	R	E	735	755
PSM	LVQDVANNTNEEAGDGTTTATVLAR	16	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=12821	65.419	2	2559.2413	2559.2413	K	S	97	122
PSM	LYGSAGPPPTGEEDTAEKDEL	17	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=12778	65.211	2	2174.9855	2174.9855	K	-	634	655
PSM	MAEGGSGDVDDAGDCSGAR	18	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=2005	12.585	2	1841.6792	1841.6792	K	Y	38	57
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	19	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=16833	86.266	3	2952.3714	2952.3714	R	E	118	147
PSM	YDAFGEDSSSAMGVENR	20	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	12-UNIMOD:35	ms_run[2]:scan=9802	50.754	2	1849.7425	1849.7425	R	A	372	389
PSM	ECSIYLIGGSIPEEDAGK	21	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:4	ms_run[2]:scan=18306	94.759	2	1936.9088	1936.9088	K	L	75	93
PSM	FDYSGVGSSDGNSEESTLGK	22	sp|Q9NUJ1-3|ABHDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=11908	60.826	2	2034.8654	2034.8654	R	W	110	130
PSM	LAEDEGDSEPEAVGQSR	23	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=5842	31.603	2	1787.781	1787.7810	R	G	1457	1474
PSM	LGIYDADGDGDFDVDDAK	24	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=17249	88.68	2	1899.801	1899.8010	K	V	58	76
PSM	LLESSLSSSEGEEPVEYK	25	sp|P08648|ITA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=13573	69.157	2	1981.9368	1981.9368	R	S	120	138
PSM	QLEVYTSGGDPESVAGEYGR	26	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=14856	75.716	2	2112.96	2112.9600	R	H	195	215
PSM	SLVCNGDSDCDEDSADEDR	27	sp|P10643|CO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5684	30.84	2	2157.7699	2157.7699	K	C	100	119
PSM	TASVLSKDDVAPESGDTTVK	28	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=10398	53.491	2	2098.9671	2098.9671	K	K	312	332
PSM	WQPDTEEEYEDSSGNVVNK	29	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=11912	60.844	2	2224.9397	2224.9397	R	K	471	490
PSM	YGPADVEDTTGSGATDSK	30	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=7566	39.93	2	1769.7592	1769.7592	K	D	79	97
PSM	ASLVSEEEEDEEEDKATPR	31	sp|Q96GN5-5|CDA7L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21	ms_run[2]:scan=11464	58.64	2	2241.9162	2241.9162	K	R	67	86
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	32	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13195	67.297	3	2789.2772	2789.2772	R	T	112	140
PSM	DNDSDDVESNLLLPAGIALR	33	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=22482	123.36	2	2126.0491	2126.0491	R	W	295	315
PSM	DPDAQPGGELMLGGTDSK	34	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:35	ms_run[2]:scan=10804	55.441	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	35	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:35	ms_run[2]:scan=13695	69.784	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	36	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:35	ms_run[2]:scan=14110	71.811	2	1802.7993	1802.7993	R	Y	236	254
PSM	GAGDGSDEEVDGKADGAEAKPAE	37	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=4771	26.345	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GPVAVTGASTPEGTAPPPPAAPAPPK	38	sp|Q9H0W8-2|SMG9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=11434	58.507	2	2414.1883	2414.1883	K	G	109	135
PSM	GVVPLAGTDGETTTQGLDGLSER	39	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=17267	88.776	2	2272.1183	2272.1183	K	C	112	135
PSM	SRTSVQTEDDQLIAGQSAR	40	sp|P26232-3|CTNA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9899	51.197	2	2220.9413	2220.9413	R	A	651	670
PSM	SQGDSNPAAIPHAAEDIQGDDR	41	sp|P68402|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1	ms_run[1]:scan=12519	63.933580000000006	2	2305.0235	2305.0202	M	W	2	24
PSM	AAEINGEVDDDDAGGEWR	42	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11987	61.18	2	1917.7977	1917.7977	R	L	1355	1373
PSM	DPDAQPGGELMLGGTDSK	43	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=10592	54.419	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	44	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=11217	57.472	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	45	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=11661	59.622	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	46	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=11872	60.64	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	47	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=12082	61.649	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	48	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=12272	62.659	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	49	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=12476	63.707	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	50	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=13893	70.797	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	51	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=17439	89.726	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	52	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:35	ms_run[2]:scan=18811	97.827	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	53	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12953	66.045	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	54	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13478	68.71	2	1786.8043	1786.8043	R	Y	236	254
PSM	EEEAIQLDGLNASQIR	55	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17024	87.377	2	1784.8905	1784.8905	R	E	52	68
PSM	GAGDGSDEEVDGKADGAEAKPAE	56	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=4364	24.437	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GNAEGSSDEEGKLVIDEPAK	57	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=10345	53.244	2	2123.926	2123.9260	K	E	120	140
PSM	GPPQEEEEEEDEEEEATK	58	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6924	36.683	2	2102.8288	2102.8288	R	E	202	220
PSM	GPPQEEEEEEDEEEEATK	59	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7121	37.697	2	2102.8288	2102.8288	R	E	202	220
PSM	GPPQEEEEEEDEEEEATK	60	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=7329	38.713	2	2102.8288	2102.8288	R	E	202	220
PSM	LYGSAGPPPTGEEDTAEKDEL	61	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12183	62.181	2	2174.9855	2174.9855	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	62	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12991	66.225	2	2174.9855	2174.9855	K	-	634	655
PSM	MQMLEDEDDLAYAETEK	63	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=12903	65.805	2	2061.8395	2061.8395	K	K	4346	4363
PSM	PVTVEPMDQLDDEEGLPEK	64	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=16817	86.164	2	2139.9882	2139.9882	R	L	132	151
PSM	SVSKESVASMGADSGDDFASDGSSSR	65	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=12039	61.436	3	2615.033	2615.0330	R	E	28	54
PSM	DPDAQPGGELMLGGTDSK	66	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=13091	66.745	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	67	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=13283	67.76	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	68	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=15364	78.359	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	69	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=15760	80.426	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	70	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=16152	82.455	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	71	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=16334	83.469	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	72	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:35	ms_run[2]:scan=18142	93.796	2	1802.7993	1802.7993	R	Y	236	254
PSM	GDQPAASGDSDDDEPPPLPR	73	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=10163	52.4	2	2114.843	2114.8430	R	L	48	68
PSM	GSDALSETSSVSHIEDLEK	74	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=14616	74.472	2	2082.8994	2082.8994	R	V	622	641
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	75	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=14956	76.25	3	3011.3427	3011.3427	R	D	374	402
PSM	LSDAGQYLCQAGDDSNSNK	76	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:4	ms_run[2]:scan=10502	53.978	2	2041.8647	2041.8647	R	K	212	231
PSM	LSQVNESDADDEDNYGAR	77	sp|Q6V0I7-2|FAT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=7073	37.47	2	1996.8246	1996.8246	K	L	3111	3129
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	78	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=8861	46.276	2	2796.2339	2796.2339	K	K	68	94
PSM	QGAEGAPSPNYDDDDDER	79	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5203	28.509	2	1949.7511	1949.7511	R	A	445	463
PSM	SSPPAPPLPPGSGSPGTPQALPR	80	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=14654	74.671	2	2244.094	2244.0940	R	R	585	608
PSM	SSPPAPPLPPGSGSPGTPQALPR	81	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=14848	75.676	2	2244.094	2244.0940	R	R	585	608
PSM	TTTTNTQVEGDDEAAFLER	82	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14086	71.704	2	2096.9498	2096.9498	K	L	75	94
PSM	TTYDSAEEENKENLYAGK	83	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=8421	44.192	2	2140.8838	2140.8838	K	N	79	97
PSM	VDPSLMEDSDDGPSLPTK	84	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:35	ms_run[2]:scan=11709	59.857	2	1917.8514	1917.8514	K	Q	87	105
PSM	YPDLYPQEDEDEEEER	85	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=13132	66.955	2	2054.8229	2054.8229	K	E	101	117
PSM	AQAELENVSGALNEAESK	86	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15432	78.692	2	1858.8909	1858.8908	R	T	1302	1320
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	87	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13396	68.32	3	2789.2772	2789.2772	R	T	112	140
PSM	CELLYEGPPDDEAAMGIK	88	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=15775	80.507	2	2022.8914	2022.8914	R	S	369	387
PSM	DGSKSEDELDQASTPTDVR	89	sp|P30279|CCND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=8478	44.464	2	2128.8798	2128.8798	R	D	267	286
PSM	DPDAQPGGELMLGGTDSK	90	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=11007	56.456	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	91	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=15565	79.411	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	92	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=18314	94.799	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	93	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=17083	87.702	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	94	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12739	65.026	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSHSSEEDEASSQTDLSQTISK	95	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21	ms_run[2]:scan=9930	51.34	2	2459.9813	2459.9813	R	K	153	175
PSM	EITENLMATGDLDQDGR	96	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:35	ms_run[2]:scan=11560	59.127	2	1892.8422	1892.8422	R	I	52	69
PSM	GAGDGSDEEVDGKADGAEAKPAE	97	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=3701	21.243	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GAMSVDSITDLDDNQSR	98	sp|O43182-5|RHG06_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:35	ms_run[2]:scan=11900	60.785	2	1838.7952	1838.7952	R	L	157	174
PSM	GDQPAASGDSDDDEPPPLPR	99	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9536	49.477	2	2034.8767	2034.8767	R	L	48	68
PSM	GEAEQSEEEADEEDKAEDAR	100	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=5127	28.13	2	2315.8551	2315.8551	K	E	1011	1031
PSM	GNAEGSSDEEGKLVIDEPAK	101	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=10561	54.255	2	2123.926	2123.9260	K	E	120	140
PSM	LEEDDGDVAMSDAQDGPR	102	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:35	ms_run[2]:scan=6261	33.539	2	1934.78	1934.7800	R	V	52	70
PSM	LFEESDDKEDEDADGK	103	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=7015	37.176	2	1920.715	1920.7150	K	E	672	688
PSM	LGIYDADGDGDFDVDDAK	104	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17056	87.562	2	1899.801	1899.8010	K	V	58	76
PSM	LPAPPPVTTPPLAGGSSTEDSR	105	sp|P39060-2|COIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=15293	77.969	2	2226.0569	2226.0569	R	S	274	296
PSM	LSVEESEAAGDGVDTK	106	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8352	43.867	2	1605.737	1605.7370	K	V	427	443
PSM	LYGSAGPPPTGEEDTAEKDEL	107	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12579	64.207	2	2174.9855	2174.9855	K	-	634	655
PSM	NGLAEGTEQEEEEEDEQVR	108	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9229	48.005	2	2189.9196	2189.9196	R	L	130	149
PSM	PVTVEPMDQLDDEEGLPEK	109	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:35	ms_run[2]:scan=13489	68.755	2	2155.9831	2155.9831	R	L	132	151
PSM	QVTSNSLSGTQEDGLDDPR	110	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9569	49.642	2	2017.9189	2017.9189	R	L	132	151
PSM	SEVERPASIPLSSGYSTASSDSTPR	111	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=13378	68.23	3	2660.1967	2660.1967	K	A	324	349
PSM	SLDEADSENKEEVSPLGSK	112	sp|Q6ZV73-2|FGD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=9639	49.991	2	2112.91	2112.9100	R	A	1197	1216
PSM	SQETGDLDVGGLQETDK	113	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11457	58.607	2	1790.817	1790.8170	K	I	147	164
PSM	SSPPAPPLPPGSGSPGTPQALPR	114	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=15042	76.695	2	2244.094	2244.0940	R	R	585	608
PSM	SVEDDEEGHLICQSGDVLSAR	115	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16404	83.819	2	2394.9999	2394.9999	R	Y	140	161
PSM	SVLDQDDVDTSMEESLK	116	sp|Q8WXH0-2|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:35	ms_run[2]:scan=11946	60.99	2	1925.8412	1925.8412	K	H	755	772
PSM	SVSKESVASMGADSGDDFASDGSSSR	117	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8076	42.505	3	2631.028	2631.0280	R	E	28	54
PSM	SYEDLTESEDGAASGDSHK	118	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=7790	40.992	2	2076.7797	2076.7797	R	E	56	75
PSM	TAGPLESSETEEASQLK	119	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11326	57.979	2	1775.8425	1775.8425	R	E	1334	1351
PSM	TELEDTLDSTAAQQELR	120	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15910	81.199	2	1918.912	1918.9120	K	S	1146	1163
PSM	VDNALQSGNSQESVTEQDSK	121	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5940	32.056	2	2134.9614	2134.9614	K	D	43	63
PSM	VIAINVDDPDAANYNDINDVK	122	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17252	88.694	2	2287.0968	2287.0968	K	R	156	177
PSM	VWTSGQVEEYDLDADDINSR	123	sp|P29972-4|AQP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17064	87.598	2	2311.024	2311.0240	K	V	129	149
PSM	SQETGDLDVGGLQETDK	124	sp|P23142|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=11186	57.324535	2	1790.830378	1790.817017	K	I	147	164
PSM	DPDAQPGGELMLGGTDSK	125	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=13812	70.37700333333333	2	1787.795440	1786.804344	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	126	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	11-UNIMOD:35	ms_run[1]:scan=11456	58.60418333333334	2	1803.787239	1802.799259	R	Y	236	254
PSM	AGGAGFGTDGDDQEAINEAISVK	127	sp|Q96EB6-2|SIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17148	88.102	2	2221.0135	2221.0135	R	Q	526	549
PSM	AQVTELEDELTAAEDAK	128	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19149	99.972	2	1831.8687	1831.8687	R	L	1563	1580
PSM	DNLTLWTSDMQGDGEEQNK	129	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:35	ms_run[2]:scan=14759	75.217	2	2195.9277	2195.9277	R	E	226	245
PSM	DPDAQPGGELMLGGTDSK	130	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:35	ms_run[2]:scan=12884	65.722	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	131	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:35	ms_run[2]:scan=19117	99.769	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	132	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13135	66.969	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSDKESEDGEDEVSCETVK	133	sp|Q96TC7-2|RMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=5846	31.623	2	2236.8203	2236.8203	R	M	59	78
PSM	EAGEGGEAEAPAAEGGK	134	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=1702	11.068	2	1528.6641	1528.6641	K	D	177	194
PSM	EESSELEQPFAQDTSSVGPDR	135	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14586	74.324	2	2307.0139	2307.0139	K	K	231	252
PSM	EGQGEGETQEAAAATAAAR	136	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7274	38.455	2	1816.8187	1816.8187	R	R	3681	3700
PSM	KDSEGYSESPDLEFEYADTDK	137	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=15849	80.891	2	2503.9792	2503.9792	R	W	57	78
PSM	LPDSDDDEDEETAIQR	138	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8470	44.423	2	1846.7705	1846.7705	R	V	176	192
PSM	LPDSDDDEDEETAIQR	139	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8679	45.441	2	1846.7705	1846.7705	R	V	176	192
PSM	NSGQNLEEDMGQSEQK	140	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:35	ms_run[2]:scan=1928	12.184	2	1808.7483	1808.7483	K	A	35	51
PSM	SIDGTADDEDEGVPTDQAIR	141	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10964	56.26	2	2102.924	2102.9240	K	A	628	648
PSM	SLDGALYDDEDDDDIER	142	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14249	72.507	2	1954.7916	1954.7916	K	A	514	531
PSM	STNCFGDNDPIDVCEIGSK	143	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=16306	83.318	2	2126.8885	2126.8885	K	I	158	177
PSM	TGSTSSKEDDYESDAATIVQK	144	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=12449	63.567	2	2310.9741	2310.9741	R	C	360	381
PSM	TLSSPSLQTDGIAATPVPPPPPPK	145	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=16455	84.098	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TYGNTDGPETGFSAIDTDER	146	sp|Q9NYV4-2|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14099	71.756	2	2144.9134	2144.9134	R	N	1328	1348
PSM	TYSMICLAIDDDDKTDK	147	sp|Q8IUC4-2|RHPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=16143	82.408	2	2098.8476	2098.8476	K	T	463	480
PSM	VSSIQDSQESTDIDDEEDEDDKESEK	148	sp|Q6DN12-3|MCTP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=8201	43.109	3	3051.1725	3051.1725	K	K	317	343
PSM	ECSIYLIGGSIPEEDAGK	149	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:4	ms_run[1]:scan=18258	94.47485166666667	2	1936.911528	1936.908809	K	L	75	93
PSM	AGEAAELQDAEVESSAK	150	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9692	50.237	2	1703.785	1703.7850	K	S	637	654
PSM	ALSQAAVEEEEEEEEEEEPAQGK	151	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12112	61.805	3	2559.0984	2559.0984	R	G	947	970
PSM	DATNVGDEGGFAPNILENK	152	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17225	88.542	2	1959.9174	1959.9174	K	E	110	129
PSM	DPDAQPGGELMLGGTDSK	153	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=10381	53.407	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	154	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=12676	64.714	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	155	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=14972	76.33	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	156	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=15169	77.339	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	157	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13266	67.675	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	158	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15728	80.266	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPTGMDPDDIWQLSSSLK	159	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:35	ms_run[2]:scan=20904	111.89	2	2019.9095	2019.9095	K	R	147	165
PSM	DSHSSEEDEASSQTDLSQTISK	160	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=9645	50.016	2	2459.9813	2459.9813	R	K	153	175
PSM	DSPSKSSAEAQTPEDTPNK	161	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=1997	12.544	2	2067.8634	2067.8634	K	S	65	84
PSM	DSSSSLTDPQVSYVKSPAAER	162	sp|O94887-3|FARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=11632	59.479	2	2303.0319	2303.0319	K	R	424	445
PSM	DSTSQHDDDNISTTSGFSSR	163	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=8291	43.556	2	2235.8553	2235.8553	K	A	171	191
PSM	DTTVISHSPNTSYDTALEAR	164	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=12889	65.742	2	2256.99	2256.9900	R	I	298	318
PSM	DYEPPSPSPAPGAPPPPPQR	165	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=9663	50.104	2	2132.9568	2132.9568	R	N	1674	1694
PSM	EAQAALAEAQEDLESER	166	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16235	82.907	2	1858.8545	1858.8545	R	V	1132	1149
PSM	ECSIYLIGGSIPEEDAGK	167	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=18281	94.616	2	1936.9088	1936.9088	K	L	75	93
PSM	EIEELQSQAQALSQEGK	168	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14238	72.453	2	1886.9222	1886.9222	K	S	1435	1452
PSM	ESPGHVPSTLDAGPEDTCPSAEEPR	169	sp|Q96RG2-4|PASK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=11868	60.62	3	2714.1167	2714.1167	R	L	842	867
PSM	ESSTESSQSAKPVSGQDTSGNTEGSPAAEK	170	sp|Q96S66-4|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:21	ms_run[2]:scan=2379	14.521	3	3032.2732	3032.2732	K	A	300	330
PSM	FLETDSEEEQEEVNEK	171	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9454	49.091	2	1953.8327	1953.8327	R	K	817	833
PSM	GAGDGSDEEVDGKADGAEAKPAE	172	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=4821	26.622	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GIVDQSQQAYQEAFEISK	173	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19288	100.86	2	2039.98	2039.9800	K	K	140	158
PSM	GPPQEEEEEEDEEEEATK	174	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6721	35.675	2	2102.8288	2102.8288	R	E	202	220
PSM	GTEAPAVVTEEEDDDEETAPPVIAPR	175	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15646	79.834	2	2736.2614	2736.2614	K	P	161	187
PSM	IDENSDKEMEVEESPEK	176	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=7393	39.019	2	2086.829	2086.8290	K	I	495	512
PSM	IDQYQGADAVGLEEK	177	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10913	55.997	2	1634.7788	1634.7788	R	I	88	103
PSM	IECVSAETTEDCIAK	178	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9925	51.317	2	1724.7597	1724.7597	K	I	385	400
PSM	KSCVEEPEPEPEAAEGDGDK	179	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[2]:scan=6003	32.378	2	2251.8828	2251.8828	K	K	99	119
PSM	LASGEDDPFDSDFSCPVK	180	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=17247	88.672	2	1984.836	1984.8360	K	L	377	395
PSM	LASGVEGSDIPDDGK	181	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7864	41.313	2	1458.6838	1458.6838	K	L	503	518
PSM	LQDLDTDYGSGYPNDPK	182	sp|O75792|RNH2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11869	60.624	2	1896.8378	1896.8378	K	T	199	216
PSM	LSEGSQPAEEEEDQETPSR	183	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=5364	29.299	2	2116.9033	2116.9033	K	N	239	258
PSM	MEDSVGCLETAEEVK	184	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=11569	59.173	2	1711.7281	1711.7281	K	R	1373	1388
PSM	NAGDLAPAGGAASASTDEAADAESGTR	185	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9850	50.973	3	2432.0688	2432.0688	R	N	42	69
PSM	PICGASSGDDDDSDEDK	186	sp|Q96S99|PKHF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4	ms_run[2]:scan=1753	11.339	2	1781.6534	1781.6534	R	E	237	254
PSM	QDVDDEYGVSQALAR	187	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13312	67.909	2	1664.7642	1664.7642	K	G	712	727
PSM	QTNPSAMEVEEDDPVPEIR	188	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:35	ms_run[2]:scan=14824	75.543	2	2170.9688	2170.9688	R	R	714	733
PSM	SAEIDSDDTGGSAAQK	189	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1843	11.769	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	190	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2042	12.781	2	1550.6696	1550.6696	K	Q	814	830
PSM	SCSGVEFSTSGSSNTDTGK	191	sp|P45880-2|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4	ms_run[2]:scan=6364	34.041	2	1906.7851	1906.7851	K	V	35	54
PSM	SDAEEDGGTVSQEEEDR	192	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3989	22.59	2	1851.7242	1851.7242	K	K	446	463
PSM	SETAPAETATPAPVEKSPAK	193	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=5171	28.347	2	2060.9667	2060.9667	M	K	2	22
PSM	SNTACDGDKESEVEDVETDSGNSPEDLR	194	sp|Q7Z3K6-4|MIER3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=12254	62.562	3	3134.2143	3134.2143	R	K	83	111
PSM	SPDHCEEPMSCDSDLGTANAEDSDR	195	sp|Q9Y4G2|PKHM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,5-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=7220	38.175	3	2890.0001	2890.0001	K	S	280	305
PSM	SQEGENEEGSEGELVVK	196	sp|Q92835-3|SHIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7962	41.865	2	1818.8119	1818.8119	K	F	550	567
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	197	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=12406	63.371	3	3059.1789	3059.1789	R	S	373	399
PSM	SSSQPSSCCSDPSKPGGNVEGATQSLAEQMR	198	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:4,30-UNIMOD:35	ms_run[2]:scan=10695	54.904	3	3334.3537	3334.3538	K	K	198	229
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	199	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9554	49.57	3	3138.2319	3138.2319	R	R	103	132
PSM	TDASSASSFLDSDELER	200	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16374	83.679	2	1828.7963	1828.7963	R	T	308	325
PSM	VAEEDEDDDGGIMMR	201	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:35	ms_run[2]:scan=7484	39.483	2	1696.6556	1696.6556	K	S	751	766
PSM	VAEEDEDDDGGIMMR	202	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:35	ms_run[2]:scan=7773	40.917	2	1696.6556	1696.6556	K	S	751	766
PSM	VLAVNQENEQLMEDYEK	203	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:35	ms_run[2]:scan=12828	65.448	2	2066.9467	2066.9467	K	L	265	282
PSM	VLAVNQENEQLMEDYEK	204	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:35	ms_run[2]:scan=13037	66.454	2	2066.9467	2066.9467	K	L	265	282
PSM	DPDAQPGGELMLGGTDSK	205	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=13656	69.60321333333333	2	1787.795440	1786.804344	R	Y	236	254
PSM	GEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	206	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21	ms_run[1]:scan=19994	105.64353666666668	3	4117.929717	4117.925662	K	Q	479	520
PSM	DPDAQPGGELMLGGTDSK	207	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:35	ms_run[1]:scan=11280	57.76949666666667	2	1803.787239	1802.799259	R	Y	236	254
PSM	AEGHSDDESDSEGSDSESTSR	208	sp|Q9P289-2|STK26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=644	5.8961	3	2262.767	2262.7670	K	E	219	240
PSM	AIEQADLLQEEDESPR	209	sp|P61966|AP1S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13326	67.976	2	1841.8643	1841.8643	K	S	134	150
PSM	CECDDGFTGADCGELK	210	sp|P24821-5|TENA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10351	53.268	2	1832.6651	1832.6652	R	C	392	408
PSM	DDDDIDLFGSDDEEESEEAKR	211	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=16180	82.613	2	2507.9337	2507.9337	K	L	97	118
PSM	DDDDIDLFGSDDEEESEEAKR	212	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=16368	83.642	2	2507.9337	2507.9337	K	L	97	118
PSM	DLSGGLGGQEEEEEQR	213	sp|Q9C086|IN80B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8623	45.17	2	1731.7548	1731.7548	R	W	136	152
PSM	DPDAQPGGELMLGGTDSK	214	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=14313	72.842	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	215	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=16727	85.675	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	216	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=16902	86.688	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	217	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=17256	88.721	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	218	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=17608	90.745	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	219	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=18486	95.84	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	220	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=16362	83.605	3	2861.224	2861.2240	K	E	520	546
PSM	EFQDAGEQVVSSPADVAEK	221	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12727	64.972	2	2004.9276	2004.9276	K	A	77	96
PSM	ESEDDLNKESEEEVGPTK	222	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=5989	32.311	2	2113.8576	2113.8576	K	E	520	538
PSM	GDDTDTRDDISILATGCK	223	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15757	80.412	2	2031.8456	2031.8456	K	G	588	606
PSM	GDVGMAGVAIDTVEDTK	224	sp|P22033|MUTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:35	ms_run[2]:scan=13286	67.775	2	1692.7876	1692.7876	R	I	155	172
PSM	GPTSSPCEEEGDEGEEDR	225	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4	ms_run[2]:scan=3324	19.333	2	1978.7334	1978.7334	R	T	91	109
PSM	GTQCEDIDECEVFPGVCK	226	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=15528	79.231	2	2141.8704	2141.8704	K	N	905	923
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	227	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=14746	75.147	3	3011.3427	3011.3427	R	D	374	402
PSM	IDENSDKEMEVEESPEK	228	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4549	25.302	2	2102.8239	2102.8239	K	I	495	512
PSM	IDNDGDGFVTTEELK	229	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13728	69.963	2	1651.7577	1651.7577	R	T	91	106
PSM	IIEVEEEQEDPYLNDR	230	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14737	75.106	2	1989.9167	1989.9167	K	C	164	180
PSM	LEAEGEAMEDAAAPGDDR	231	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:35	ms_run[2]:scan=6266	33.562	2	1861.7636	1861.7636	K	G	400	418
PSM	LESIDNHSSTGGQSDQGYGSK	232	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=5438	29.658	2	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	233	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=6165	33.112	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	234	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=6380	34.119	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	235	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=6816	36.153	2	1920.715	1920.7150	K	E	672	688
PSM	LLVDVDESTLSPEEQK	236	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15966	81.469	2	1800.8993	1800.8993	K	E	478	494
PSM	LPVGSQCSVDLESASGEK	237	sp|P24821-5|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=11977	61.13	2	1941.8391	1941.8391	K	D	58	76
PSM	LQQETAELEESVESGK	238	sp|P42566-2|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13137	66.975	2	1775.8425	1775.8425	R	A	143	159
PSM	MEIDESNAGSSKEEAGETSPADESGAPK	239	sp|Q9UKY1|ZHX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=6100	32.818	3	2918.1649	2918.1649	K	S	630	658
PSM	MGDEDDDESCAVELR	240	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=8245	43.335	2	1755.6564	1755.6564	-	I	1	16
PSM	MNSDTVDYDDACLIVR	241	sp|Q6KC79-2|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15894	81.113	2	1901.8135	1901.8135	K	Y	1743	1759
PSM	NLEAVETLGSTSTICSDK	242	sp|P50993|AT1A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=15361	78.344	2	1923.9095	1923.9095	K	T	358	376
PSM	PELVNDDDEEADDTR	243	sp|Q8WU90-2|ZC3HF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6811	36.122	2	1731.7071	1731.7071	R	Y	94	109
PSM	QFYDQALQQAVVDDDANNAK	244	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17110	87.875	2	2252.0346	2252.0346	K	A	125	145
PSM	QGAEGAPSPNYDDDDDER	245	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=4990	27.498	2	1949.7511	1949.7511	R	A	445	463
PSM	QNLYDLDEDDDGIASVPTK	246	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16804	86.097	2	2106.9593	2106.9593	K	Q	179	198
PSM	SEDFGVNEDLADSDAR	247	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13456	68.619	2	1738.7282	1738.7282	R	A	189	205
PSM	SETAPAETATPAPVEKSPAK	248	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=5591	30.374	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	249	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=5794	31.394	2	2060.9667	2060.9667	M	K	2	22
PSM	SIVEEEEDDDYVELK	250	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15135	77.165	2	1810.7996	1810.7996	K	V	1100	1115
PSM	SLDGALYDDEDDDDIER	251	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13432	68.504	2	1954.7916	1954.7916	K	A	514	531
PSM	SQSESSDEVTELDLSHGK	252	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=11291	57.809	2	2026.8368	2026.8368	R	K	657	675
PSM	SSPPAPPLPPGSGSPGTPQALPR	253	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=14274	72.636	2	2244.094	2244.0940	R	R	585	608
PSM	SSSLSNTPHASEESSMDEEQSK	254	sp|Q76I76|SSH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=3723	21.344	3	2461.9428	2461.9428	R	A	706	728
PSM	SSVLIAQQTDTSDPEK	255	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8462	44.387	2	1717.837	1717.8370	K	V	453	469
PSM	SVSKESVASMGADSGDDFASDGSSSR	256	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8412	44.144	3	2631.028	2631.0280	R	E	28	54
PSM	SVTSNQSDGTQESCESPDVLDR	257	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4	ms_run[2]:scan=9290	48.272	2	2410.019	2410.0190	R	H	257	279
PSM	TGSTSSKEDDYESDAATIVQK	258	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=12425	63.46	3	2310.9741	2310.9741	R	C	360	381
PSM	TKDQPDGSSLSPAQSPSQSQPPAASSLR	259	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9658	50.083	3	2983.2962	2983.2962	R	E	210	238
PSM	TYSMICLAIDDDDKTDK	260	sp|Q8IUC4-2|RHPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=15933	81.307	2	2098.8476	2098.8476	K	T	463	480
PSM	VAEEDEDDDGGIMMR	261	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3429	19.889	2	1712.6505	1712.6505	K	S	751	766
PSM	VAEEDEDDDGGIMMR	262	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:35	ms_run[2]:scan=6796	36.052	2	1696.6556	1696.6556	K	S	751	766
PSM	VLAVNQENEQLMEDYEK	263	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16146	82.424	2	2050.9517	2050.9517	K	L	265	282
PSM	VSESEGKLEGQATAVTPNK	264	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=9179	47.791	2	2023.9463	2023.9463	K	N	12	31
PSM	YMADMDELFSQVDEK	265	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=15088	76.912	2	1851.7543	1851.7543	K	R	207	222
PSM	YPDLYPQEDEDEEEER	266	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12717	64.924	2	2054.8229	2054.8229	K	E	101	117
PSM	YPDLYPQEDEDEEEER	267	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12931	65.94	2	2054.8229	2054.8229	K	E	101	117
PSM	YSSQDADEQDWEFQK	268	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12743	65.045	2	1874.7595	1874.7595	R	R	918	933
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	269	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=5434	29.63922833333333	3	3337.337365	3336.355264	R	R	157	186
PSM	PDAQPGGELMLGGTDSK	270	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	10-UNIMOD:35	ms_run[1]:scan=9710	50.326928333333335	2	1687.7734	1687.7718	D	Y	237	254
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	271	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21	ms_run[1]:scan=9537	49.480109999999996	3	2797.220362	2796.233859	K	K	68	94
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	272	sp|Q5EBL4|RIPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21	ms_run[1]:scan=11204	57.408815000000004	3	3134.276534	3133.288473	R	V	254	282
PSM	LPAPPIGAAASSGGGGGGGSGGGGGGASAAPAPPGLSGTTSPR	273	sp|P50750-2|CDK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	40-UNIMOD:21	ms_run[1]:scan=15591	79.530795	3	3477.651883	3477.627404	R	G	16	59
PSM	AACSAAAMEEDSEASSSR	274	sp|Q05086-2|UBE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=2700	16.166	2	1844.7153	1844.7153	K	I	173	191
PSM	AADEEAFEDNSEEYIR	275	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13993	71.262	2	1886.7806	1886.7806	R	R	300	316
PSM	AANDAGYFNDEMAPIEVK	276	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:35	ms_run[2]:scan=15091	76.928	2	1969.8728	1969.8728	K	T	192	210
PSM	AATEALGEKSPDSATVSGYDIMK	277	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=12045	61.462	2	2436.0768	2436.0768	K	S	930	953
PSM	CDYMDEVTYGELEK	278	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,4-UNIMOD:35	ms_run[2]:scan=13296	67.824	2	1766.7015	1766.7015	K	E	602	616
PSM	CELLYEGPPDDEAAMGIK	279	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=15656	79.887	2	2022.8914	2022.8914	R	S	369	387
PSM	DPDAQPGGELMLGGTDSK	280	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=14764	75.24	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	281	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=17971	92.778	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	282	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=18652	96.86	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	283	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=15961	81.442	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	284	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14021	71.39	2	1786.8043	1786.8043	R	Y	236	254
PSM	DTSFLGSDDIGNIDVR	285	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19116	99.765	2	1722.8061	1722.8061	K	E	397	413
PSM	DYEPPSPSPAPGAPPPPPQR	286	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=9456	49.099	2	2132.9568	2132.9568	R	N	1674	1694
PSM	EDEEGDDSTMGPDFR	287	sp|P25940|CO5A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:35	ms_run[2]:scan=6254	33.506	2	1714.6264	1714.6264	R	A	342	357
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	288	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	22-UNIMOD:21	ms_run[2]:scan=7593	40.06	3	3061.3513	3061.3513	K	G	56	88
PSM	ELENEENQEEQGLEEK	289	sp|Q8IWE2-2|NXP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8190	43.057	2	1945.8389	1945.8389	K	G	139	155
PSM	ELSDQAGSEFENSDVR	290	sp|O43301|HS12A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10798	55.415	2	1781.7704	1781.7704	K	W	183	199
PSM	ELYSESDETFDQISK	291	sp|Q9H8L6|MMRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14659	74.694	2	1789.7894	1789.7894	K	V	414	429
PSM	ESEDKPEIEDVGSDEEEEK	292	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=5037	27.725	2	2271.8792	2271.8792	K	K	251	270
PSM	FLEDDPSDPTYTSSLGGK	293	sp|P54753|EPHB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13966	71.132	2	1927.8687	1927.8687	R	I	782	800
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	294	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,16-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13829	70.464	3	2842.2398	2842.2398	K	Q	609	638
PSM	IEDSEPHIPLIDDTDAEDDAPTK	295	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=18224	94.271	3	2615.1164	2615.1164	R	R	1116	1139
PSM	INEELESQYQQSMDSK	296	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:35	ms_run[2]:scan=8606	45.088	2	1943.8419	1943.8419	K	L	76	92
PSM	INEELESQYQQSMDSK	297	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:35	ms_run[2]:scan=8951	46.714	2	1943.8419	1943.8419	K	L	76	92
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	298	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,34-UNIMOD:35	ms_run[2]:scan=9636	49.981	3	4214.397	4214.3970	K	A	142	177
PSM	KPSVGVPPPASPSYPR	299	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10353	53.28	2	1794.8107	1794.8107	R	A	969	985
PSM	LEGALGADTTEDGDEK	300	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6430	34.347	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LFEDDDSNEKLFDEEEDSSEK	301	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=16101	82.16	2	2599.0011	2599.0011	K	L	696	717
PSM	LFEESDDKEDEDADGK	302	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=6605	35.14	2	1920.715	1920.7150	K	E	672	688
PSM	LGIYDADGDGDFDVDDAK	303	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16881	86.566	2	1899.801	1899.8010	K	V	58	76
PSM	LLKPGEEPSEYTDEEDTK	304	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9894	51.174	2	2238.8858	2238.8858	R	D	200	218
PSM	LPNLSSPSAEGPPGPPSGPAPR	305	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=13747	70.057	3	2161.0205	2161.0205	R	K	412	434
PSM	LPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	306	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=15347	78.271	3	3477.525	3477.5250	K	L	151	183
PSM	MDVNVGDIDIEGPEGK	307	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=15362	78.348	2	1702.772	1702.7720	K	L	1620	1636
PSM	MEELVQAEEAQEER	308	sp|Q0VD83|APOBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=9103	47.441	2	1705.7465	1705.7465	R	G	485	499
PSM	NSYVAGQYDDAASYQR	309	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10006	51.682	2	1806.7809	1806.7809	R	L	105	121
PSM	NYTDEAIETDDLTIK	310	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15733	80.293	2	1739.8101	1739.8101	K	L	105	120
PSM	QTIDNSQGAYQEAFDISK	311	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15576	79.463	2	2013.928	2013.9280	K	K	140	158
PSM	SDGLPWCSTTANYDTDDR	312	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=15904	81.163	2	2072.8382	2072.8382	R	F	250	268
PSM	SEAEDEDDEDYVPYVPLR	313	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17886	92.32	2	2139.912	2139.9120	R	Q	23	41
PSM	SEDFGVNEDLADSDAR	314	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12941	65.988	2	1738.7282	1738.7282	R	A	189	205
PSM	SENGLEFTSSGSANTETTK	315	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9200	47.887	2	1958.8705	1958.8705	K	V	35	54
PSM	SETAPAETATPAPVEKSPAK	316	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=6127	32.943	2	2060.9667	2060.9667	M	K	2	22
PSM	SIEGTADDEEEGVSPDTAIR	317	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11954	61.023	2	2089.9288	2089.9288	K	S	638	658
PSM	SLSKSDSDLLTCSPTEDATMGSR	318	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=13486	68.744	3	2553.0612	2553.0612	R	S	622	645
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	319	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9112	47.482	3	3138.2319	3138.2319	R	R	103	132
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	320	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9765	50.592	3	3138.2319	3138.2319	R	R	103	132
PSM	SVSESHTSCPAESASDAAPLQR	321	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8202	43.113	2	2365.9846	2365.9846	K	S	96	118
PSM	SVSKESVASMGADSGDDFASDGSSSR	322	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8660	45.347	3	2631.028	2631.0280	R	E	28	54
PSM	SYEDLTESEDGAASGDSHK	323	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=6657	35.378	2	2076.7797	2076.7797	R	E	56	75
PSM	TPAVEGLTEAEEEELR	324	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16472	84.187	2	1771.8476	1771.8476	R	A	12	28
PSM	TQLEELEDELQATEDAK	325	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20973	112.37	2	1960.9113	1960.9113	K	L	1539	1556
PSM	TVECEEGSEDDESLR	326	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=5430	29.621	2	1753.6949	1753.6949	R	E	652	667
PSM	VAEEDEDDDGGIMMR	327	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10140	52.296	2	1680.6607	1680.6607	K	S	751	766
PSM	VFCESGASPEEVADK	328	sp|Q8IYQ7|THNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4	ms_run[2]:scan=8961	46.758	2	1623.7087	1623.7087	R	V	201	216
PSM	VLDVSNSFAVPFDEDDK	329	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19984	105.57	2	1895.8789	1895.8789	K	D	47	64
PSM	VNDDVGIDWTNENDR	330	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13943	71.031	2	1760.7602	1760.7602	K	L	924	939
PSM	VNDSDDLIMTENEVGK	331	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13794	70.283	2	1777.804	1777.8040	R	I	686	702
PSM	VSEEAESQQQWDTSK	332	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6338	33.906	2	1750.7646	1750.7646	K	G	2109	2124
PSM	YLTESYGTGQDIDDR	333	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10573	54.323	2	1731.7588	1731.7588	R	I	167	182
PSM	YYSDSDDELTVEQR	334	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10037	51.816	2	1718.7271	1718.7271	K	R	480	494
PSM	NPDDITQEEYGEFYK	335	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=15925	81.27193333333334	2	1846.792569	1846.789740	R	S	292	307
PSM	EGEEPTVYSDEEEPKDESAR	336	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:27,9-UNIMOD:21	ms_run[1]:scan=8980	46.84155333333333	2	2356.9239	2356.9215	K	K	173	193
PSM	SETAPAAPAAPAPAEKTPVK	337	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8224	43.22872	2	2024.9840	2024.9815	M	K	2	22
PSM	SETAPAAPAAPAPAEKTPVK	338	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8213	43.17371333333334	2	2024.9840	2024.9815	M	K	2	22
PSM	SDGLPWCSTTANYDTDDR	339	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:4	ms_run[1]:scan=15947	81.37419333333334	2	2073.826648	2072.838163	R	F	250	268
PSM	GQVIIISDSDDDDDER	340	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=11236	57.555355000000006	2	1790.773113	1790.780631	R	I	1011	1027
PSM	AAPEASSPPASPLQHLLPGK	341	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=18219	94.244	2	2126.9803	2126.9803	K	A	673	693
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	342	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=10903	55.949	3	3927.6702	3927.6702	R	Q	14	52
PSM	ANSIGSTSASSVPNTDDEDSDYHQEAYK	343	sp|Q9UH92-3|MLX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10128	52.24	3	3067.2204	3067.2204	R	E	42	70
PSM	ASEVEEILDGNDEK	344	sp|Q12824-2|SNF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15827	80.783	2	1546.6999	1546.6999	K	Y	84	98
PSM	DCDLQEDEACYNCGR	345	sp|P62633-8|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8729	45.66	2	1903.6771	1903.6771	K	G	59	74
PSM	DDDDIDLFGSDDEEESEEAKR	346	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=15992	81.606	2	2507.9337	2507.9337	K	L	97	118
PSM	DPDAQPGGELMLGGTDSK	347	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:35	ms_run[2]:scan=21068	113.03	2	1802.7993	1802.7993	R	Y	236	254
PSM	DQPPFGDSDDSVEADK	348	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9551	49.552	2	1720.7064	1720.7064	K	S	488	504
PSM	DSQSASGEERPPEADGK	349	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=1979	12.453	2	1838.732	1838.7320	R	K	360	377
PSM	DSSESQLASTESDKPTTGR	350	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=5128	28.134	2	2074.8692	2074.8692	R	V	65	84
PSM	DSSESQLASTESDKPTTGR	351	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=6000	32.362	2	2074.8692	2074.8692	R	V	65	84
PSM	DVPNPNQDDDDDEGFSFNPLK	352	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19161	100.05	2	2376.9982	2376.9982	K	I	523	544
PSM	DYDEEEQGYDSEKEK	353	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=4208	23.699	2	1942.6993	1942.6993	R	K	423	438
PSM	EAAGEGPALYEDPPDQK	354	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9414	48.886	2	1785.8057	1785.8057	K	T	36	53
PSM	EALPAPSDDATALMTDPK	355	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:35	ms_run[2]:scan=12393	63.31	2	1857.8666	1857.8666	R	L	131	149
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	356	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=8877	46.363	3	3001.2673	3001.2673	R	E	120	150
PSM	EEASSPGAGEGPAEEGTR	357	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2871	17.079	2	1729.7391	1729.7391	K	D	1143	1161
PSM	EEETKTSNGDLSDSTVSADPVVK	358	sp|Q2M389|WASC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9937	51.37	3	2487.0902	2487.0902	K	-	1151	1174
PSM	EETNEIQVVNEEPQR	359	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9504	49.33	2	1812.849	1812.8490	K	D	243	258
PSM	ELAETIAADDGTDPR	360	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10218	52.651	2	1572.7267	1572.7267	K	S	679	694
PSM	EMEENFAVEAANYQDTIGR	361	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35	ms_run[2]:scan=17216	88.494	2	2201.9535	2201.9535	R	L	346	365
PSM	ESEDKPEIEDVGSDEEEEK	362	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=6157	33.075	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	363	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7166	37.904	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	364	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7572	39.963	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	365	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7980	41.976	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	366	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=8589	45.012	2	2271.8792	2271.8792	K	K	251	270
PSM	ETTCSKESNEELTESCETK	367	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3783	21.629	2	2340.8975	2340.8975	R	K	289	308
PSM	ETTCSKESNEELTESCETK	368	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3995	22.628	2	2340.8975	2340.8975	R	K	289	308
PSM	EVEGDDVPESIMLEMK	369	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=13471	68.68	2	1851.8118	1851.8118	K	A	578	594
PSM	EVEGDDVPESIMLEMK	370	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=13676	69.696	2	1851.8118	1851.8118	K	A	578	594
PSM	FNDSEGDDTEETEDYR	371	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7398	39.042	2	1920.7133	1920.7133	K	Q	392	408
PSM	FVAYNEEEEEEDCSLAGQDK	372	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=12692	64.79	3	2360.9591	2360.9591	K	Y	1713	1733
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	373	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:4	ms_run[2]:scan=12683	64.748	3	2552.0245	2552.0245	K	Q	24	48
PSM	GEVGEIGLDGLDGEDGDK	374	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15846	80.875	2	1773.7905	1773.7905	K	G	1497	1515
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	375	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,21-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13349	68.079	3	2842.2398	2842.2398	K	Q	609	638
PSM	GYNDDYYEESYFTTR	376	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16392	83.763	2	1921.7643	1921.7643	K	T	89	104
PSM	IESLEQEKVDEEEEGK	377	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=9070	47.285	2	1969.8405	1969.8405	R	K	247	263
PSM	IMGVEEEDDDDDDDDNLPQLK	378	sp|Q6AI12|ANR40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35	ms_run[2]:scan=14114	71.834	3	2434.9806	2434.9806	K	K	92	113
PSM	IPMTPTSSFVSPPPPTASPHSNR	379	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=12621	64.434	3	2580.1121	2580.1121	K	T	373	396
PSM	IPMTPTSSFVSPPPPTASPHSNR	380	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=12826	65.442	3	2580.1121	2580.1121	K	T	373	396
PSM	IVEEEAQEDLEGLR	381	sp|Q0VD83|APOBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15180	77.389	2	1628.7893	1628.7893	K	G	58	72
PSM	LAEFSSQAAEEEEK	382	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9043	47.154	2	1566.7049	1566.7049	R	V	1025	1039
PSM	LEEEQIILEDQNCK	383	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=13376	68.222	2	1759.8298	1759.8298	K	L	976	990
PSM	LESIDNHSSTGGQSDQGYGSK	384	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=5402	29.487	3	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	385	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=5482	29.854	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	386	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=5685	30.843	2	1920.715	1920.7150	K	E	672	688
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	387	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=8742	45.721	3	2796.2339	2796.2339	K	K	68	94
PSM	LYQPEYQEVSTEEQR	388	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11162	57.21	2	1897.8694	1897.8694	K	E	754	769
PSM	MDVNVGDIDIEGPEGK	389	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=15552	79.35	2	1702.772	1702.7720	K	L	1620	1636
PSM	MLADDAEAGAEDEK	390	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=5066	27.846	2	1479.6035	1479.6035	K	E	481	495
PSM	MQQQLDEYQELLDIK	391	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=20384	108.27	2	1908.9139	1908.9139	R	L	352	367
PSM	MSDSESEELPKPQVSDSESEEPPR	392	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[2]:scan=11057	56.703	3	2784.1321	2784.1321	R	H	208	232
PSM	NGSEADIDEGLYSR	393	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10538	54.147	2	1524.6692	1524.6692	K	Q	4	18
PSM	NPDDITNEEYGEFYK	394	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15243	77.699	2	1832.7741	1832.7741	R	S	300	315
PSM	NPDDITQEEYGEFYK	395	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15659	79.902	2	1846.7897	1846.7897	R	S	292	307
PSM	NSAAEIPVTSNGEVDDSR	396	sp|P53367-3|ARFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9251	48.102	2	1859.8497	1859.8497	K	E	8	26
PSM	PAAMISQPPTPPTGQPVR	397	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10302	53.049	2	1939.9227	1939.9227	R	E	985	1003
PSM	PSESSEEFLEEEPEQR	398	sp|Q9Y6X4|F169A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12171	62.112	2	1920.8225	1920.8225	R	G	375	391
PSM	PVTVEPMDQLDDEEGLPEK	399	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:35	ms_run[2]:scan=13165	67.151	2	2155.9831	2155.9831	R	L	132	151
PSM	PVTVEPMDQLDDEEGLPEK	400	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:35	ms_run[2]:scan=13689	69.758	2	2155.9831	2155.9831	R	L	132	151
PSM	QTSGGPVDASSEYQQELER	401	sp|P18859|ATP5J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12273	62.662	2	2079.9345	2079.9345	R	E	55	74
PSM	RALSSDSILSPAPDAR	402	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12662	64.637	2	1814.7965	1814.7965	R	A	391	407
PSM	SANAEDAQEFSDVER	403	sp|Q9HCY8|S10AE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9502	49.319	2	1666.7071	1666.7071	R	A	6	21
PSM	SDSPVPTAPTSGGPKPSTASAVPELATDPELEK	404	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=16434	83.987	3	3312.565	3312.5650	R	K	48	81
PSM	SDTATGGESAGHATSSQEPSGCSDQR	405	sp|Q92575|UBXN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=1571	10.435	3	2659.009	2659.0090	K	P	165	191
PSM	SEESLTSLHAVDGDSK	406	sp|A7KAX9-2|RHG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=11093	56.891	2	1753.7408	1753.7408	K	L	357	373
PSM	SETAPAETATPAPVEK	407	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=5447	29.693	2	1597.7835	1597.7835	M	S	2	18
PSM	SGDEEFKGEDELCDSGR	408	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10466	53.821	2	2008.7357	2008.7357	R	Q	339	356
PSM	SLDSDESEDEEDDYQQK	409	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6057	32.62	2	2030.7712	2030.7712	K	R	57	74
PSM	SMASGGGVPTDEEQATGLER	410	sp|P10606|COX5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35	ms_run[2]:scan=9202	47.894	2	2006.8851	2006.8851	R	E	30	50
PSM	SPMSTNSSVHTGSDVEQDAEK	411	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=4932	27.206	2	2300.9104	2300.9104	R	K	459	480
PSM	SQEPIPDDQKVSDDDK	412	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=4597	25.524	2	1894.7833	1894.7833	K	E	415	431
PSM	SVGDGETVEFDVVEGEK	413	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15801	80.644	2	1794.816	1794.8160	R	G	102	119
PSM	SVLDQDDVDTSMEESLK	414	sp|Q8WXH0-2|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16517	84.446	2	1909.8463	1909.8463	K	H	755	772
PSM	SYEDDDDMDLQPNK	415	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:35	ms_run[2]:scan=5819	31.505	2	1699.6519	1699.6519	R	Q	167	181
PSM	TESDEKSSIALTAPDAAADPK	416	sp|Q8NFD5-4|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=10021	51.742	2	2195.9835	2195.9835	K	E	992	1013
PSM	TGIEQGSDAGYLCESQK	417	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=9919	51.287	2	1841.8102	1841.8102	K	F	310	327
PSM	TVTLPENEDELESTNR	418	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12522	63.949	2	1845.8592	1845.8592	K	R	870	886
PSM	TYADYESVNECMEGVCK	419	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9922	51.303	2	2069.8016	2069.8016	R	M	18	35
PSM	VAEEDEDDDGGIMMR	420	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4060	22.974	2	1712.6505	1712.6505	K	S	751	766
PSM	VAEEDEDDDGGIMMR	421	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4271	23.986	2	1712.6505	1712.6505	K	S	751	766
PSM	VDINTEDLEDGTCR	422	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=11816	60.37	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VFDDESDEKEDEEYADEK	423	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=8973	46.814	2	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	424	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9410	48.865	3	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	425	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9834	50.9	2	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	426	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=10684	54.854	2	2270.8264	2270.8264	K	G	637	655
PSM	YGDINFDDLNSEQSYNK	427	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16508	84.392	2	2020.865	2020.8650	K	S	197	214
PSM	YLTESYGTGQDIDDR	428	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10784	55.343	2	1731.7588	1731.7588	R	I	167	182
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	429	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	22-UNIMOD:21	ms_run[1]:scan=7902	41.47375833333333	3	3062.338814	3061.351348	K	G	56	88
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	430	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	26-UNIMOD:21	ms_run[1]:scan=8072	42.48472666666667	3	3062.339438	3061.351348	K	G	56	88
PSM	QEPESEEEEEEKQEK	431	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4848	26.768698333333333	2	1938.7267	1938.7250	K	E	579	594
PSM	SETAPAETATPAPVEKSPAK	432	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5908	31.914171666666668	2	2102.9800	2102.9768	M	K	2	22
PSM	DPDAQPGGELMLGGTDSK	433	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:35	ms_run[1]:scan=16553	84.657085	2	1803.805143	1802.799259	R	Y	236	254
PSM	QDVDDEYGVSQALAR	434	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=13415	68.41767	2	1664.766933	1664.764193	K	G	712	727
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	435	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:27,4-UNIMOD:21	ms_run[1]:scan=9477	49.19689666666667	3	2983.2590	2983.2563	R	E	120	150
PSM	QDDSPPRPIIGPALPPGFIK	436	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=22001	119.86793999999999	2	2177.0959	2177.0917	K	S	102	122
PSM	LESIDNHSSTGGQSDQGYGSK	437	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=6339	33.90978166666667	2	2246.900991	2245.912465	R	D	951	972
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	438	sp|Q53TN4|CYBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=8884	46.397215	3	2742.082398	2741.094605	R	K	247	272
PSM	GVITDQNSDGYCQTGTMSR	439	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:4	ms_run[1]:scan=9307	48.35315	2	2089.871255	2088.884068	R	H	46	65
PSM	AANDAGYFNDEMAPIEVK	440	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:35	ms_run[2]:scan=15162	77.305	2	1969.8728	1969.8728	K	T	192	210
PSM	AEDGSVIDYELIDQDAR	441	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17841	92.082	2	1907.8749	1907.8749	R	D	198	215
PSM	ATDGDLAQEPGPGLTFEDSGNPKSPDK	442	sp|O15417|TNC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:21	ms_run[2]:scan=14733	75.087	3	2822.2284	2822.2284	K	A	2520	2547
PSM	DDDDIDLFGSDDEEESEEAKR	443	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=16735	85.712	2	2507.9337	2507.9337	K	L	97	118
PSM	DENATLDGGDVLFTGR	444	sp|O94760-2|DDAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16665	85.291	2	1678.7798	1678.7798	K	E	18	34
PSM	DFQDYMEPEEGCQGSPQR	445	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9439	49.016	2	2187.8473	2187.8473	K	R	103	121
PSM	DNSNIILLGDSQGDLR	446	sp|Q9H0P0-3|5NT3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17573	90.516	2	1728.8642	1728.8642	K	M	217	233
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	447	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=16909	86.724	3	2861.224	2861.2240	K	E	520	546
PSM	DSHSSEEDEASSQTDLSQTISK	448	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=9902	51.213	3	2459.9813	2459.9813	R	K	153	175
PSM	DVQGTDASLDEELDR	449	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12773	65.189	2	1661.738	1661.7380	R	V	293	308
PSM	DVSGVVMECGLDVK	450	sp|Q8WWV3-3|RT4I1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=13516	68.873	2	1522.7007	1522.7007	R	Y	122	136
PSM	DYDEEEQGYDSEKEK	451	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=3374	19.594	2	1942.6993	1942.6993	R	K	423	438
PSM	EAPALVAAGGAPEDDEEDDGR	452	sp|Q8IWF6|DEN6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10325	53.155	2	2082.8978	2082.8978	R	G	28	49
PSM	EEAEAPVEDGSQPPPPEPK	453	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6890	36.516	2	2001.9167	2001.9167	K	G	624	643
PSM	EEVMGLCIGELNDDTR	454	sp|P46736-5|BRCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=16414	83.872	2	1865.8135	1865.8135	K	S	32	48
PSM	ESEDKPEIEDVGSDEEEEK	455	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=8177	42.999	2	2271.8792	2271.8792	K	K	251	270
PSM	GAGDGSDEEVDGKADGAEAKPAE	456	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=3712	21.294	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	457	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=4355	24.399	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GEIDASVPELEGDLR	458	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17912	92.456	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GEPAAAAAPEAGASPVEK	459	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6306	33.744	2	1621.7948	1621.7948	K	E	88	106
PSM	GGIDNPAITSDQELDDK	460	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11645	59.546	2	1786.8221	1786.8221	K	K	1209	1226
PSM	GGNDSDELANGEVGGDR	461	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6013	32.423	2	1660.6925	1660.6925	K	N	1427	1444
PSM	GPAAPLTPGPQSPPTPLAPGQEK	462	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=14104	71.781	2	2287.125	2287.1250	K	G	165	188
PSM	IAEFTTNLTEEEEK	463	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13808	70.358	2	1652.7781	1652.7781	R	S	1001	1015
PSM	IDEDNLTCLEDLCK	464	sp|Q92851-7|CASPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=17564	90.464	2	1736.7597	1736.7597	K	T	162	176
PSM	IEDGNDFGVAIQEK	465	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13305	67.871	2	1533.7311	1533.7311	K	V	132	146
PSM	IEDVGSDEEDDSGKDK	466	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=2555	15.43	2	1816.6888	1816.6888	K	K	250	266
PSM	IEFDNDADPTSESK	467	sp|P23229-4|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8666	45.382	2	1566.6686	1566.6686	R	E	97	111
PSM	INEELESQYQQSMDSK	468	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11706	59.841	2	1927.8469	1927.8469	K	L	76	92
PSM	ITALEDISTEDGDR	469	sp|O43264|ZW10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12904	65.809	2	1533.7158	1533.7158	K	L	668	682
PSM	LDDDDEGVPSSALR	470	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10081	52.009	2	1487.674	1487.6740	R	E	37	51
PSM	LDEEEEDNEGGEWER	471	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8900	46.473	2	1834.7129	1834.7129	R	V	279	294
PSM	LEGALGADTTEDGDEK	472	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6987	37.028	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LETLDGGQEDGSEADR	473	sp|Q9Y5S1|TRPV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6371	34.077	2	1690.7282	1690.7282	R	G	12	28
PSM	LFEESDDKEDEDADGK	474	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=5701	30.947	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	475	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=5946	32.084	2	1920.715	1920.7150	K	E	672	688
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	476	sp|Q5EBL4-3|RIPL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=10989	56.369	3	3133.2885	3133.2885	R	V	103	131
PSM	LSDAGQYLCQAGDDSNSNK	477	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=10514	54.033	3	2041.8647	2041.8647	R	K	212	231
PSM	LTPLPEDNSMNVDQDGDPSDR	478	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35	ms_run[2]:scan=10225	52.689	2	2329.9968	2329.9968	K	M	3197	3218
PSM	NPDDITQEEYGEFYK	479	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15468	78.883	2	1846.7897	1846.7897	R	S	292	307
PSM	PAEAPMPAEPAPPGPASPGGAPEPPAAAR	480	sp|Q9HBB8-2|CDHR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=11030	56.569	3	2753.252	2753.2520	K	A	544	573
PSM	QLSSSSGNTDTQADEDER	481	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2291	14.085	2	1938.8039	1938.8039	R	A	1254	1272
PSM	SEDLDNSIDKTEAGIK	482	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=10094	52.062	2	1813.7983	1813.7983	R	E	880	896
PSM	SETAPAETATPAPVEKSPAK	483	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=5375	29.349	2	2060.9667	2060.9667	M	K	2	22
PSM	SGTPTQDEMMDKPTSSSVDTMSLLSK	484	sp|Q5VT52-5|RPRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,9-UNIMOD:35,10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=11437	58.522	3	2900.2014	2900.2014	R	I	704	730
PSM	SGTPTQDEMMDKPTSSSVDTMSLLSK	485	sp|Q5VT52-5|RPRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=13170	67.179	3	2884.2065	2884.2065	R	I	704	730
PSM	SIDGTADDEDEGVPTDQAIR	486	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10999	56.415	2	2102.924	2102.9240	K	A	628	648
PSM	SLCSLNYEDDDEDDTPVK	487	sp|Q6NSI3|FA53A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4	ms_run[2]:scan=13141	66.994	2	2113.8634	2113.8634	K	T	301	319
PSM	SLGECCDVEDSTTCFNAK	488	sp|P02774-2|VTDB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=11870	60.628	2	2091.8184	2091.8184	K	G	249	267
PSM	SQLDDHPESDDEENFIDANDDEDMEK	489	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=15203	77.499	3	3131.1347	3131.1347	R	F	621	647
PSM	SSDSDESYGEGCIALR	490	sp|Q92835-3|SHIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=11564	59.146	2	1744.721	1744.7210	K	L	595	611
PSM	SSSPAELDLKDDLQQTQGK	491	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=14232	72.423	2	2138.9733	2138.9733	R	C	819	838
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	492	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9351	48.559	3	3138.2319	3138.2319	R	R	103	132
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	493	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=11749	60.047	3	3122.237	3122.2370	R	R	103	132
PSM	SVSKESVASMGADSGDDFASDGSSSR	494	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8548	44.81	2	2631.028	2631.0280	R	E	28	54
PSM	TEELIESPKLESSEGEIIQTVDR	495	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=20171	106.82	3	2681.2685	2681.2685	K	Q	287	310
PSM	TLSSPSLQTDGIAATPVPPPPPPK	496	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=16982	87.136	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TNDDQTMCLDINECER	497	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:35,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=9237	48.039	2	2028.7823	2028.7823	K	D	1882	1898
PSM	TSIPNAASEEGDEDDWASNK	498	sp|P30291-2|WEE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12087	61.671	2	2134.8927	2134.8927	R	V	223	243
PSM	TYADYESVNECMEGVCK	499	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=14183	72.179	2	2053.8067	2053.8067	R	M	18	35
PSM	TYVGVVDGENELASPK	500	sp|P09327-2|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13506	68.831	2	1676.8257	1676.8257	R	L	206	222
PSM	VDDSPSTSGGSSDGDQR	501	sp|Q96LR5|UB2E2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=877	7.0904	2	1665.6714	1665.6714	R	E	8	25
PSM	VEQLGAEGNVEESQK	502	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5961	32.16	2	1615.7689	1615.7689	K	V	137	152
PSM	VFDDESDEKEDEEYADEK	503	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=9606	49.844	2	2270.8264	2270.8264	K	G	637	655
PSM	VIENADGSEEETDTR	504	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3316	19.291	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VNDSDDLIMTENEVGK	505	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:35	ms_run[2]:scan=11650	59.569	2	1793.7989	1793.7989	R	I	686	702
PSM	VQGSDSDEEVVVATTR	506	sp|P26640-2|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8922	46.588	2	1690.801	1690.8010	K	I	227	243
PSM	VVSEDFLQDVSASTK	507	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17882	92.301	2	1623.7992	1623.7992	R	S	453	468
PSM	YLTESYGTGQDIDDR	508	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10990	56.373	2	1731.7588	1731.7588	R	I	167	182
PSM	YSEEANNLIEECEQAER	509	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=14345	73.033	2	2082.88	2082.8800	K	L	120	137
PSM	ESEDKPEIEDVGSDEEEEK	510	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:27,13-UNIMOD:21	ms_run[1]:scan=10150	52.340068333333335	2	2253.8729	2253.8681	K	K	251	270
PSM	GNAEGSSDEEGKLVIDEPAK	511	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21	ms_run[1]:scan=10118	52.19141333333334	2	2124.931861	2123.925989	K	E	127	147
PSM	SQETGDLDVGGLQETDK	512	sp|P23142|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=11236	57.555355000000006	2	1790.830378	1790.817017	K	I	147	164
PSM	VVVAENFDEIVNNENK	513	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=17033	87.43041666666666	2	1833.902543	1831.895208	K	D	380	396
PSM	SETAPAETATPAPVEKSPAK	514	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7615	40.153886666666665	2	2102.9791	2102.9768	M	K	2	22
PSM	CECDDGFTGADCGELK	515	sp|P24821|TENA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=14175	72.14116666666666	2	1815.6403	1815.6381	R	C	392	408
PSM	EAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSR	516	sp|Q8IV56|PRR15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	24-UNIMOD:21	ms_run[1]:scan=16635	85.11744666666667	3	3227.505320	3226.497224	K	E	26	58
PSM	TTDEGAKNNEESPTATVAEQGEDITSK	517	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=11268	57.71273000000001	3	2902.2262	2901.2392	M	K	2	29
PSM	QHSSDSVSSINSATSHSSVGSNIESDSK	518	sp|Q8IVL1|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=10843	55.62829666666667	3	2896.2024	2896.1991	R	K	1797	1825
PSM	GNEFFCEVDEDYIQDK	519	sp|P67870|CSK2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:4	ms_run[1]:scan=19686	103.570475	2	2006.804708	2006.820388	R	F	18	34
PSM	QTNPSAMEVEEDDPVPEIR	520	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,7-UNIMOD:35	ms_run[1]:scan=16892	86.62434	2	2154.9442	2153.9422	R	R	714	733
PSM	APAPVVLGSPVVLGPPVGQAR	521	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:21	ms_run[1]:scan=19458	101.98980999999999	2	2061.123700	2060.118362	K	V	156	177
PSM	GIINDDEDDEDLMMASGR	522	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=12264	62.610216666666666	2	2027.795648	2026.809566	K	P	352	370
PSM	AEEEEASTEEEDKEGAVVSAPSVK	523	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=9327	48.444	3	2599.1062	2599.1062	R	G	601	625
PSM	AEGSEAAELAEIYAK	524	sp|Q9NUQ8-2|ABCF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16625	85.06	2	1550.7464	1550.7464	R	L	274	289
PSM	AEVGAPLSPDHSEEEEEEEEGLEEDEPR	525	sp|P23327|SRCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=14948	76.212	3	3216.278	3216.2780	R	F	556	584
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	526	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=11262	57.688	3	3173.2435	3173.2435	R	-	738	768
PSM	AGLESGAEPGDGDSDTTK	527	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4164	23.488	2	1705.7279	1705.7279	K	K	481	499
PSM	ALYESDENCEVDPSK	528	sp|Q5VWQ8-3|DAB2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=8181	43.012	2	1754.7305	1754.7305	K	C	251	266
PSM	AMVSPFHSPPSTPSSPGVR	529	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11883	60.695	2	2112.8741	2112.8741	K	S	113	132
PSM	AQLSSPEDQDDQDDIK	530	sp|Q86US8-3|EST1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6868	36.409	2	1802.7806	1802.7806	K	V	88	104
PSM	ASLGSLEGEAEAEASSPK	531	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15948	81.378	2	1731.8163	1731.8163	K	G	5748	5766
PSM	AYEDDGDDYSSIMVK	532	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35	ms_run[2]:scan=10704	54.944	2	1722.6931	1722.6931	K	A	1062	1077
PSM	DAGEGLLAVQITDPEGK	533	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18410	95.379	2	1711.8628	1711.8628	K	P	1574	1591
PSM	DDATPVRDEPMDAESITFK	534	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13421	68.448	3	2231.9294	2231.9294	R	S	947	966
PSM	DDDDIDLFGSDDEEESEEAKR	535	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=16499	84.343	3	2507.9337	2507.9337	K	L	97	118
PSM	DFVDDDDDDDLER	536	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11500	58.83	2	1582.5907	1582.5907	R	V	44	57
PSM	DHSSQSEEEVVEGEK	537	sp|O60238-2|BNI3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=5454	29.721	2	1767.6836	1767.6836	R	E	75	90
PSM	DIEISTEEEKDTGDLK	538	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=12474	63.696	2	1900.8191	1900.8191	R	D	333	349
PSM	DLFNQEDEEEEDDVR	539	sp|Q96M32|KAD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13453	68.604	2	1880.7548	1880.7548	K	G	492	507
PSM	DPDAQPGGELMLGGTDSK	540	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=14497	73.861	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	541	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=20088	106.24	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	542	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=20397	108.36	2	1802.7993	1802.7993	R	Y	236	254
PSM	DTDDVPMILVGNK	543	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:35	ms_run[2]:scan=14724	75.051	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	544	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17496	90.07	2	1415.6966	1415.6966	K	C	86	99
PSM	DTTVISHSPNTSYDTALEAR	545	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=12868	65.65	3	2256.99	2256.9900	R	I	298	318
PSM	DVDASPSPLSVQDLK	546	sp|Q8IWZ8|SUGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15134	77.163	2	1569.7886	1569.7886	R	G	405	420
PSM	EALNVFGNDYDTEDGTGVR	547	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17049	87.519	2	2070.913	2070.9130	R	D	147	166
PSM	EDAGDNDDTEGAIGVR	548	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6678	35.465	2	1632.6863	1632.6863	R	N	377	393
PSM	EDAGDNDDTEGAIGVR	549	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7012	37.16	2	1632.6863	1632.6863	R	N	377	393
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	550	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=8653	45.317	3	3001.2673	3001.2673	R	E	120	150
PSM	EDQSILCTGESGAGK	551	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=8119	42.715	2	1550.6883	1550.6883	R	T	166	181
PSM	EDTESLEIFQNEVAR	552	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18248	94.418	2	1778.8323	1778.8323	K	Q	271	286
PSM	EDYDSVEQDGDEPGPQR	553	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7364	38.876	2	1934.7766	1934.7766	R	S	51	68
PSM	EEGDYTCFAENQVGK	554	sp|Q9NR99|MXRA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=11936	60.945	2	1745.7203	1745.7203	R	D	2318	2333
PSM	EEGETADTVGCCSLR	555	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7293	38.546	2	1682.6876	1682.6876	K	V	494	509
PSM	EEIQSSISGVTAAYNR	556	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14250	72.51	2	1723.8377	1723.8377	R	E	723	739
PSM	ELAQQVQQVADDYGK	557	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16112	82.226	2	1690.8162	1690.8162	R	C	176	191
PSM	EQQESLALEELELQK	558	sp|Q13439-3|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17947	92.654	2	1785.8996	1785.8996	K	K	530	545
PSM	ESEDKPEIEDVGSDEEEEK	559	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=7376	38.933	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	560	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=8381	44.003	2	2271.8792	2271.8792	K	K	251	270
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	561	sp|Q96RT1-7|ERBIN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=6653	35.359	3	2858.1047	2858.1047	K	M	639	664
PSM	EVTDMNLNVINEGGIDK	562	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=14068	71.628	2	1875.8884	1875.8884	K	L	355	372
PSM	GAGDGSDEEVDGKADGAEAKPAE	563	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=1137	8.263	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	564	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=4138	23.357	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GECSGPATVNNSSDTESIPSPHTEAAK	565	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=8897	46.462	3	2822.1702	2822.1702	R	D	734	761
PSM	GGDDYSEDEGDSSVSR	566	sp|Q99871-3|HAUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=3745	21.445	2	1673.6289	1673.6289	R	A	21	37
PSM	GGNDSDELANGEVGGDR	567	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5799	31.417	2	1660.6925	1660.6925	K	N	1427	1444
PSM	GPPQEEEEEEDEEEEATK	568	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6965	36.911	3	2102.8288	2102.8288	R	E	202	220
PSM	GSGDTSNFDDYEEEDIR	569	sp|P22694-10|KAPCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12581	64.214	2	1947.7606	1947.7606	R	V	291	308
PSM	GYDFESETDTETIAK	570	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13053	66.535	2	1704.7366	1704.7366	K	L	140	155
PSM	IAECSSQLAEEEEK	571	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=6714	35.644	2	1621.7141	1621.7141	R	A	1008	1022
PSM	IDENSDKEMEVEESPEK	572	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4761	26.301	2	2102.8239	2102.8239	K	I	495	512
PSM	ILTENLCEGTEDLDK	573	sp|Q709C8-3|VP13C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=14410	73.396	2	1748.8138	1748.8138	R	V	1323	1338
PSM	IPSAVSTVSMQNIHPK	574	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=11394	58.302	2	1883.8254	1883.8254	K	S	597	613
PSM	ISDLTTNLAEEEEK	575	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12394	63.314	2	1590.7625	1590.7625	R	A	1008	1022
PSM	IVSDGEDEDDSFK	576	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6659	35.389	2	1454.6049	1454.6049	R	D	1026	1039
PSM	KPSVGVPPPASPSYPR	577	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10114	52.172	2	1794.8107	1794.8107	R	A	969	985
PSM	LAGEELAGEEAPQEK	578	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8603	45.077	2	1569.7522	1569.7522	K	A	575	590
PSM	LDQEDALLGSYPVDDGCR	579	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4	ms_run[2]:scan=16820	86.179	2	2021.9	2021.9000	K	I	16	34
PSM	LDSSEMDHSENEDYTMSSPLPGK	580	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=9846	50.954	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	581	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=12461	63.623	3	2664.0245	2664.0245	R	K	1174	1197
PSM	LFEDDDSNEKLFDEEEDSSEK	582	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=16073	82.015	3	2599.0011	2599.0011	K	L	696	717
PSM	LFEESDDKEDEDADGK	583	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=5214	28.565	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	584	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=5692	30.889	2	1920.715	1920.7150	K	E	672	688
PSM	LGDEDEEIDGDTNK	585	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5792	31.387	2	1548.6427	1548.6427	K	Y	816	830
PSM	LGIYDADGDGDFDVDDAK	586	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16704	85.543	2	1899.801	1899.8010	K	V	58	76
PSM	LLDEEEATDNDLR	587	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10860	55.711	2	1531.7002	1531.7002	R	A	457	470
PSM	MDRTPPPPTLSPAAITVGR	588	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=15009	76.519	2	2151.9789	2151.9789	R	G	587	606
PSM	MEELVQAEEAQEER	589	sp|Q0VD83|APOBR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11403	58.353	2	1689.7516	1689.7516	R	G	485	499
PSM	NDQEPPPEALDFSDDEKEK	590	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=12814	65.385	2	2281.9264	2281.9264	K	E	303	322
PSM	NPDDITQEEYGEFYK	591	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15856	80.921	2	1846.7897	1846.7897	R	S	292	307
PSM	QICPYGSGIIVGPDDSAVDMDECK	592	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,20-UNIMOD:35,23-UNIMOD:4	ms_run[2]:scan=16731	85.694	3	2641.1346	2641.1346	R	E	2109	2133
PSM	QQMAEEMVEAAGEDER	593	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6284	33.644	2	1853.7408	1853.7408	K	E	817	833
PSM	QQMAEEMVEAAGEDER	594	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6527	34.781	2	1853.7408	1853.7408	K	E	817	833
PSM	SEAPETPMEEEAELVLTEK	595	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:35	ms_run[2]:scan=17322	89.068	2	2146.9828	2146.9828	K	S	72	91
PSM	SEDPDQQYLILNTAR	596	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15829	80.795	2	1761.8533	1761.8533	R	K	500	515
PSM	SGDEEFKGEDELCDSGR	597	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9788	50.695	2	2008.7357	2008.7357	R	Q	339	356
PSM	SNASTLESHETEEPAAK	598	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=5112	28.065	2	1879.7837	1879.7837	K	K	302	319
PSM	SNASTLESHETEEPAAK	599	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=5462	29.752	2	1879.7837	1879.7837	K	K	302	319
PSM	SPSEAADEVCALEEK	600	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=13374	68.21	2	1633.7141	1633.7141	R	E	151	166
PSM	SQSESSDEVTELDLSHGK	601	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=11304	57.874	3	2026.8368	2026.8368	R	K	657	675
PSM	STVTGERQSGDGQESTEPVENK	602	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=3281	19.134	2	2414.0235	2414.0235	K	V	140	162
PSM	SVSKESVASMGADSGDDFASDGSSSR	603	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8627	45.19	3	2631.028	2631.0280	R	E	28	54
PSM	SVSNGTAKPATSENFDEDLK	604	sp|Q96K49-2|TM87B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=10670	54.791	2	2188.9525	2188.9525	K	W	493	513
PSM	SVTSNQSDGTQESCESPDVLDR	605	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=9296	48.297	3	2410.019	2410.0190	R	H	257	279
PSM	TFMDMDQDSEDEK	606	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2692	16.133	2	1621.576	1621.5760	K	Q	51	64
PSM	TIASDSEEEAGKELSDK	607	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=12684	64.752	2	1887.7987	1887.7987	K	K	435	452
PSM	TLSSPSLQTDGIAATPVPPPPPPK	608	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=16810	86.127	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TVFPGAVPVLPASPPPK	609	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=18754	97.504	2	1752.9216	1752.9216	K	D	217	234
PSM	VAAAAGSGPSPPGSPGHDR	610	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3910	22.212	2	1846.7401	1846.7401	R	E	38	57
PSM	VAEEDEDDDGGIMMR	611	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4425	24.695	2	1712.6505	1712.6505	K	S	751	766
PSM	VANFSNMDEDDIELEPER	612	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:35	ms_run[2]:scan=14748	75.159	2	2137.911	2137.9110	K	N	1021	1039
PSM	VDATEESDLAQQYGVR	613	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13872	70.686	2	1779.8275	1779.8275	K	G	82	98
PSM	VDIDTPDINIEGSEGK	614	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15456	78.817	2	1700.8105	1700.8105	K	F	3712	3728
PSM	VDIQTEDLEDGTCK	615	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=10263	52.869	2	1621.7141	1621.7141	K	V	2045	2059
PSM	VDPSLMEDSDDGPSLPTK	616	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35	ms_run[2]:scan=11508	58.862	2	1917.8514	1917.8514	K	Q	87	105
PSM	VDPSLMEDSDDGPSLPTK	617	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14456	73.655	2	1901.8564	1901.8564	K	Q	87	105
PSM	VEMYSGSDDDDDFNK	618	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35	ms_run[2]:scan=6536	34.826	2	1751.6468	1751.6468	K	L	131	146
PSM	VFDDESDEKEDEEYADEK	619	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=9186	47.827	2	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	620	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=9404	48.833	2	2270.8264	2270.8264	K	G	637	655
PSM	VNDSDDLIMTENEVGK	621	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13844	70.545	2	1777.804	1777.8040	R	I	686	702
PSM	VQVQDNEGCPVEALVK	622	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4	ms_run[2]:scan=14351	73.062	2	1783.8774	1783.8774	R	D	709	725
PSM	YDAFGEDSSSAMGVENR	623	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12824	65.43	2	1833.7476	1833.7476	R	A	372	389
PSM	YDYEEVEAEGANK	624	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9515	49.38	2	1515.6365	1515.6365	R	M	446	459
PSM	YLTESYGTGQDIDDR	625	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10277	52.939	2	1731.7588	1731.7588	R	I	167	182
PSM	YPDLYPQEDEDEEEER	626	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13327	67.98	2	2054.8229	2054.8229	K	E	101	117
PSM	ESEDKPEIEDVGSDEEEEK	627	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21	ms_run[1]:scan=8832	46.13659833333333	2	2271.892054	2271.879159	K	K	251	270
PSM	GNAEGSSDEEGKLVIDEPAK	628	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21	ms_run[1]:scan=10794	55.39571	2	2124.916075	2123.925989	K	E	127	147
PSM	QEPESEEEEEEKQEK	629	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=5053	27.792925	2	1938.7280	1938.7250	K	E	579	594
PSM	QEPESEEEEEEKQEK	630	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4650	25.766663333333334	2	1938.7267	1938.7250	K	E	579	594
PSM	DPDAQPGGELMLGGTDSK	631	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:35	ms_run[1]:scan=19948	105.33151000000001	2	1803.805077	1802.799259	R	Y	236	254
PSM	CELLYEGPPDDEAAMGIK	632	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=19652	103.32661166666666	2	2005.8733	2005.8644	R	S	369	387
PSM	QGAEGAPSPNYDDDDDER	633	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=7437	39.22777833333333	2	1932.7252	1932.7240	R	A	445	463
PSM	CSQEDHCLTSDLEDDR	634	sp|Q9NZU5|LMCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=13795	70.28641333333333	2	1961.7384	1961.7362	K	K	52	68
PSM	IDNDGDGFVTTEELK	635	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=13808	70.35819666666667	2	1651.760037	1651.757711	R	T	91	106
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	636	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:27,4-UNIMOD:21	ms_run[1]:scan=8569	44.912290000000006	3	2983.2587	2983.2563	R	E	120	150
PSM	ELECAEDPGSAGEAAR	637	sp|O94966|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	4-UNIMOD:4	ms_run[1]:scan=5799	31.41718	2	1660.6965	1660.6994	K	A	1039	1055
PSM	YYSPCEEHPAETNQNEGAESGTIR	638	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=9085	47.35968666666666	3	2819.106926	2818.117783	R	Q	182	206
PSM	YLTESYGTGQDIDDR	639	sp|Q9UM54|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=11211	57.44121666666666	2	1732.747092	1731.758774	R	I	167	182
PSM	LFEESDDKEDEDADGK	640	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=4976	27.416753333333332	2	1921.719226	1920.714994	K	E	672	688
PSM	CVNGMCVCDDGYTGEDCR	641	sp|P24821|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:4,5-UNIMOD:35,6-UNIMOD:4,8-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=7657	40.344125	2	2183.732795	2182.748245	R	D	480	498
PSM	AAEDDEDDDVDTK	642	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1499	10.046	2	1436.5427	1436.5427	R	K	90	103
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	643	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=10807	55.455	3	3090.3373	3090.3373	R	V	1094	1125
PSM	ADNFEYSDPVDGSISR	644	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13854	70.6	2	1770.7697	1770.7697	K	N	489	505
PSM	AFLDEDDMSLEEIK	645	sp|Q86XL3|ANKL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=17085	87.714	2	1669.7393	1669.7393	R	N	639	653
PSM	AFLDEDDMSLEEIK	646	sp|Q86XL3|ANKL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19516	102.41	2	1653.7444	1653.7444	R	N	639	653
PSM	AKTQTPPVSPAPQPTEER	647	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=4898	27.025	2	2092.9232	2092.9232	R	L	397	415
PSM	ALQEGQPEEDETDDR	648	sp|Q96BZ8|LENG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4265	23.961	2	1730.7231	1730.7231	R	R	225	240
PSM	ALSQAAVEEEEEEEEEEEPAQGK	649	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12139	61.926	2	2559.0984	2559.0984	R	G	947	970
PSM	ALVLIAFAQYLQQCPFEDHVK	650	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=26038	151.5	3	2489.2777	2489.2777	K	L	45	66
PSM	AMIVPSSPSKTPEEVSTPAEEEK	651	sp|Q01484-7|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=10816	55.496	3	2538.1448	2538.1448	K	L	354	377
PSM	AQAVSEDAGGNEGR	652	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1131	8.233	2	1359.6015	1359.6015	R	A	121	135
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	653	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13608	69.334	3	2789.2772	2789.2772	R	T	112	140
PSM	CVDVDECAPPAEPCGK	654	sp|P23142-2|FBLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7823	41.122	2	1802.7274	1802.7274	R	G	354	370
PSM	DASDDLDDLNFFNQK	655	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21136	113.55	2	1755.7588	1755.7588	K	K	65	80
PSM	DCDLQEDACYNCGR	656	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7837	41.191	2	1774.6345	1774.6345	K	G	49	63
PSM	DDDDIDLFGSDDEEESEEAKR	657	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=16127	82.316	3	2507.9337	2507.9337	K	L	97	118
PSM	DEDNDEDEERLEEEEQNEEEEVDN	658	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13955	71.088	3	2980.0973	2980.0973	R	-	124	148
PSM	DLDEDELLGNLSETELK	659	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21345	115.03	2	1931.9211	1931.9211	K	Q	14	31
PSM	DNDSDDVESNLLLPAGIALR	660	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22501	123.5	3	2126.0491	2126.0491	R	W	295	315
PSM	DNPGVVTCLDEAR	661	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=11760	60.097	2	1444.6616	1444.6616	K	H	187	200
PSM	DPAEGDGAQPEETPR	662	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2985	17.683	2	1567.675	1567.6750	K	D	192	207
PSM	DPDAQPGGELMLGGTDSK	663	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=18952	98.722	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	664	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=19594	102.91	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	665	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=19739	103.92	2	1802.7993	1802.7993	R	Y	236	254
PSM	DQQPSGSEGEDDDAEAALKK	666	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=6910	36.612	2	2168.8747	2168.8747	K	E	82	102
PSM	DSALETLQGQLEEK	667	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18099	93.552	2	1559.7679	1559.7679	R	A	1161	1175
PSM	DSDDVPMVLVGNK	668	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=13055	66.546	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDYAQLCNIPVTGR	669	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=15407	78.567	3	1822.8156	1822.8156	K	R	1190	1206
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	670	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=15900	81.144	3	2961.1785	2961.1785	R	V	489	518
PSM	DTDDVPMILVGNK	671	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=19588	102.87	2	1431.6915	1431.6915	K	C	86	99
PSM	DVVICPDASLEDAK	672	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=13908	70.869	2	1530.7236	1530.7236	R	K	49	63
PSM	DYDEEEQGYDSEKEK	673	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=3792	21.667	2	1942.6993	1942.6993	R	K	423	438
PSM	EAPALVAAGGAPEDDEEDDGR	674	sp|Q8IWF6|DEN6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10482	53.892	3	2082.8978	2082.8978	R	G	28	49
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	675	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=7335	38.738	3	3001.2673	3001.2673	R	E	120	150
PSM	EENLPDENEEQKQSNQK	676	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=3481	20.153	2	2137.8801	2137.8801	R	Q	570	587
PSM	EFAGEDTSDLFLEER	677	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18572	96.377	2	1756.7792	1756.7792	K	E	1024	1039
PSM	EGEEAGPGDPLLEAVPK	678	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17220	88.513	2	1706.8363	1706.8363	K	T	353	370
PSM	EGEEPTVYSDEEEPKDESAR	679	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=7225	38.198	2	2374.9326	2374.9326	K	K	121	141
PSM	ELEASEELDTICPK	680	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=15052	76.739	2	1632.7553	1632.7553	K	A	218	232
PSM	ELEDVTESAESMNR	681	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11222	57.492	2	1608.6937	1608.6937	R	E	1923	1937
PSM	ENNISEEVEAPEVEPR	682	sp|Q9H4Z3|CAPAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12525	63.964	2	1839.8487	1839.8487	K	L	385	401
PSM	ESEDKPEIEDVGSDEEEEK	683	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=6731	35.73	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	684	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=7786	40.973	2	2271.8792	2271.8792	K	K	251	270
PSM	ESESEEAEAGAAELR	685	sp|Q8NAF0|ZN579_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9918	51.284	2	1576.6853	1576.6853	R	A	193	208
PSM	ETYVEQEQGENANDR	686	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4305	24.149	2	1780.75	1780.7500	R	N	130	145
PSM	EVAENQQNQSSDPEEEKGSQPPPAAESQSSLR	687	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=7067	37.445	3	3532.5227	3532.5227	K	R	29	61
PSM	EYCGVPGDGDEELLR	688	sp|P02760|AMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=14559	74.193	2	1707.741	1707.7410	R	F	335	350
PSM	FDYDDEPEAVEESK	689	sp|O95104-2|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11656	59.6	2	1671.6788	1671.6788	R	K	265	279
PSM	GAGDGSDEEVDGKADGAEAKPAE	690	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=1923	12.161	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	691	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=4616	25.61	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	692	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:21,29-UNIMOD:21	ms_run[2]:scan=12997	66.26	3	3371.3239	3371.3239	R	S	1160	1192
PSM	GAVAAEGASDTEREEPTESQGLAAR	693	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=8826	46.107	3	2581.1293	2581.1293	R	L	907	932
PSM	GDEDDDESCAVELR	694	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=8142	42.838	2	1608.621	1608.6210	M	I	2	16
PSM	GGQGAEEVGESAGGGEER	695	sp|Q8TE04|PANK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3245	18.945	2	1674.7081	1674.7081	R	R	72	90
PSM	GLDSGAETEEEKDTWEEK	696	sp|P78559|MAP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=11223	57.495	2	2131.8471	2131.8471	R	K	609	627
PSM	GLSGEEEDDEPDCCNDER	697	sp|Q6P158-3|DHX57_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5309	29.064	2	2124.7484	2124.7484	R	Y	28	46
PSM	GVVDSDDLPLNVSR	698	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15172	77.354	2	1484.7471	1484.7471	K	E	435	449
PSM	GYAYVEFENPDEAEK	699	sp|Q15287-3|RNPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14979	76.365	2	1759.7577	1759.7577	K	A	167	182
PSM	IDNDGDGFVTTEELK	700	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13292	67.805	2	1651.7577	1651.7577	R	T	91	106
PSM	IDNDGDGFVTTEELK	701	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14108	71.8	2	1651.7577	1651.7577	R	T	91	106
PSM	IDNDGDGFVTTEELK	702	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14149	72.006	2	1651.7577	1651.7577	R	T	91	106
PSM	IEADSESQEDIIR	703	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9252	48.106	2	1503.7053	1503.7053	R	N	72	85
PSM	IEADSESQEDIIR	704	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9283	48.243	2	1503.7053	1503.7053	R	N	72	85
PSM	IEDLSQQAQLAAAEK	705	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12005	61.262	2	1613.8261	1613.8261	K	F	128	143
PSM	IEDVGSDEEDDSGKDK	706	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=2355	14.409	2	1816.6888	1816.6888	K	K	250	266
PSM	IESDEEEDFENVGK	707	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11267	57.709	2	1638.6897	1638.6897	R	V	1091	1105
PSM	IEYNDQNDGSCDVK	708	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=4233	23.815	2	1655.6733	1655.6733	K	Y	594	608
PSM	INEVQTDVGVDTK	709	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7607	40.122	2	1416.7096	1416.7096	K	H	61	74
PSM	INEVQTDVGVDTK	710	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7944	41.734	2	1416.7096	1416.7096	K	H	61	74
PSM	IPMTPTSSFVSPPPPTASPHSNR	711	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=13039	66.465	3	2580.1121	2580.1121	K	T	373	396
PSM	LDETDDPDDYGDR	712	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4969	27.388	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	713	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6226	33.385	2	1524.5852	1524.5852	R	E	401	414
PSM	LECNGENDCGDNSDER	714	sp|P13671|CO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=1222	8.7025	2	1882.6694	1882.6694	K	D	156	172
PSM	LEDEILVMDDQNNK	715	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35	ms_run[2]:scan=11642	59.53	2	1690.772	1690.7720	K	L	983	997
PSM	LFEESDDKEDEDADGK	716	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=4614	25.595	2	1920.715	1920.7150	K	E	672	688
PSM	LGAVDESLSEETQK	717	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9577	49.683	2	1504.7257	1504.7257	R	A	137	151
PSM	LNESDEQHQENEGTNQLVMGIQK	718	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=11967	61.088	3	2736.1698	2736.1698	K	Q	261	284
PSM	MASPPAPSPAPPAISPIIK	719	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=17017	87.33	2	1936.9733	1936.9733	R	N	99	118
PSM	MDAEVPDVNIEGPDAK	720	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=12810	65.366	2	1714.772	1714.7720	K	L	1418	1434
PSM	MEAENLEQLIDQK	721	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=15421	78.635	2	1575.745	1575.7450	K	L	1291	1304
PSM	NDDDNDIMETLCK	722	sp|Q96HF1|SFRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=15413	78.598	2	1581.6287	1581.6287	K	N	179	192
PSM	NEDLEEIASTDLK	723	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16983	87.14	2	1475.6991	1475.6991	R	Y	65	78
PSM	NEEDDMVEMEEER	724	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35	ms_run[2]:scan=6729	35.717	2	1669.6083	1669.6083	K	L	282	295
PSM	NGLAEGTEQEEEEEDEQVR	725	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9232	48.021	3	2189.9196	2189.9196	R	L	130	149
PSM	NPDDITNEEYGEFYK	726	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15045	76.706	2	1832.7741	1832.7741	R	S	300	315
PSM	NPDDITNEEYGEFYK	727	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15440	78.728	2	1832.7741	1832.7741	R	S	300	315
PSM	NQDATVYVGGLDEK	728	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11228	57.517	2	1507.7155	1507.7155	R	V	10	24
PSM	NVLDSEDEIEELSK	729	sp|Q9BWS9-3|CHID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17333	89.119	2	1618.7574	1618.7574	R	T	162	176
PSM	PAAMISQPPTPPTGQPVR	730	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10523	54.072	2	1939.9227	1939.9227	R	E	985	1003
PSM	QDENDDDDDWNPCK	731	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=8613	45.123	2	1764.6169	1764.6169	K	A	188	202
PSM	QEEENPAEETGEEK	732	sp|O43768-8|ENSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2741	16.412	2	1617.6642	1617.6642	K	Q	5	19
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVK	733	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=15871	80.994	3	3652.4937	3652.4937	K	R	353	388
PSM	QLSESESSLEMDDER	734	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9974	51.541	2	1753.7312	1753.7312	R	Y	321	336
PSM	QTNPSAMEVEEDDPVPEIR	735	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=14623	74.511	2	2170.9688	2170.9688	R	R	714	733
PSM	SDGLPWCSTTANYDTDDR	736	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=15707	80.149	2	2072.8382	2072.8382	R	F	250	268
PSM	SGCSDLEEAVDSGADKK	737	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=11675	59.686	2	1846.7292	1846.7292	K	F	659	676
PSM	SGDETPGSEVPGDK	738	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3496	20.239	2	1373.5947	1373.5947	R	A	161	175
PSM	SNLDEDIIAEENIVSR	739	sp|P01024|CO3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19571	102.76	2	1815.885	1815.8850	R	S	749	765
PSM	SNSQENVEASHPSQDGK	740	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=1087	8.05	2	1892.7538	1892.7538	R	R	555	572
PSM	SQEPIPDDQKVSDDDK	741	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=2225	13.706	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	742	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=5437	29.654	2	1894.7833	1894.7833	K	E	415	431
PSM	SQLDDHPESDDEENFIDANDDEDMEK	743	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=13674	69.691	3	3147.1296	3147.1296	R	F	621	647
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	744	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=17406	89.551	3	2692.1753	2692.1753	R	L	42	66
PSM	SSLVDEHPEDAEFEQK	745	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=10967	56.274	2	1938.7884	1938.7884	R	I	644	660
PSM	SSLVDEHPEDAEFEQK	746	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11690	59.754	2	1938.7884	1938.7884	R	I	644	660
PSM	SVPVTVDDDDDDNDPENR	747	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7738	40.738	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TCVADESAENCDK	748	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2300	14.122	2	1497.5712	1497.5712	K	S	76	89
PSM	TDDVSEKTSLADQEEVR	749	sp|Q9Y2Q0-3|AT8A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=7788	40.985	3	2000.8576	2000.8576	K	T	21	38
PSM	TEFDQEIDMGSLNPGK	750	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35	ms_run[2]:scan=13725	69.948	2	1795.7934	1795.7934	R	Q	275	291
PSM	TENSLANENQQPIKSEPESEGEEPK	751	sp|Q8NHM5-4|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:21	ms_run[2]:scan=8089	42.568	3	2863.2397	2863.2397	R	R	892	917
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	752	sp|Q15637-5|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=15182	77.4	3	2925.2471	2925.2471	R	R	192	218
PSM	TITQIEEFSDVNEGEK	753	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15613	79.641	2	1837.8582	1837.8582	K	E	596	612
PSM	TSIPNAASEEGDEDDWASNK	754	sp|P30291-2|WEE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12105	61.771	3	2134.8927	2134.8927	R	V	223	243
PSM	TVECEEGSEDDESLR	755	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=5481	29.85	2	1753.6949	1753.6949	R	E	652	667
PSM	VCVETVESGAMTK	756	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=6790	36.021	2	1425.648	1425.6480	K	D	349	362
PSM	VDEDSAEDTQSNDGKEVVEVGQK	757	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=7436	39.224	3	2557.0705	2557.0705	K	L	561	584
PSM	VDQDDDQDSSSLK	758	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1567	10.412	2	1450.606	1450.6060	R	L	186	199
PSM	VDSLVSLSEEDLESDQR	759	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18227	94.286	2	1919.896	1919.8960	R	E	1622	1639
PSM	VDVEGPDVNIEGPEGK	760	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12805	65.343	2	1652.7893	1652.7893	K	L	2930	2946
PSM	VEGDMQVPDLDIK	761	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=13362	68.152	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VIENADGSEEETDTR	762	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3065	18.049	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VIENADGSEEETDTR	763	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3597	20.744	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VILLDGSEYTCDVEK	764	sp|Q9Y2J2-4|E41L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=16451	84.08	2	1739.8288	1739.8288	K	R	114	129
PSM	VSESEGKLEGQATAVTPNK	765	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=9185	47.824	3	2023.9463	2023.9463	K	N	12	31
PSM	VTYTGDGSEHEGDTPELEAEPPR	766	sp|Q96N77-2|ZN641_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=11219	57.478	3	2565.0544	2565.0544	R	M	170	193
PSM	VVEDDEDDFPTTR	767	sp|Q9Y5P4-2|CERT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9080	47.34	2	1536.658	1536.6580	K	S	199	212
PSM	VWTSGQVEEYDLDADDINSR	768	sp|P29972-4|AQP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17058	87.569	3	2311.024	2311.0240	K	V	129	149
PSM	WSLEDDDDDEDDPAEAEK	769	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13576	69.172	3	2092.7869	2092.7869	K	E	198	216
PSM	YADLTEDQLPSCESLK	770	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=15029	76.626	2	1867.851	1867.8510	R	D	142	158
PSM	YDYNSGEELESYK	771	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11716	59.886	2	1595.6627	1595.6627	K	G	250	263
PSM	YFQINQDEEEEEDED	772	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13204	67.339	2	1930.7228	1930.7228	R	-	114	129
PSM	YNDWSDDDDDSNESK	773	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5253	28.771	2	1803.6344	1803.6344	R	S	57	72
PSM	YQEDSDPERSDYEEQQLQK	774	sp|Q6P6C2-3|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=8148	42.869	3	2465.986	2465.9860	K	E	49	68
PSM	YSDASDDSFSEPR	775	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7080	37.5	2	1474.5848	1474.5848	R	I	567	580
PSM	ESEDKPEIEDVGSDEEEEK	776	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=9064	47.26030166666666	2	2271.896457	2271.879159	K	K	251	270
PSM	CDYMDEVTYGELEK	777	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:35	ms_run[1]:scan=16444	84.04560333333333	2	1749.6769	1749.6744	K	E	602	616
PSM	SDAAVDTSSEITTKDLK	778	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=13111	66.84758666666667	2	1821.8831	1821.8838	M	E	2	19
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	779	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	28-UNIMOD:21	ms_run[1]:scan=7834	41.175095	3	3062.338814	3061.351348	K	G	56	88
PSM	EITENLMATGDLDQDGR	780	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=15058	76.764635	2	1877.859848	1876.847271	R	I	52	69
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	781	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=4941	27.257340000000003	3	3337.341224	3336.355264	R	R	157	186
PSM	DPDAQPGGELMLGGTDSK	782	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12696	64.80911166666667	2	1786.806330	1786.804344	R	Y	236	254
PSM	MSDSESEELPKPQVSDSESEEPPR	783	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=10825	55.5457	3	2784.136814	2784.132096	R	H	208	232
PSM	ILQEYQVQYTPQGDSDNGK	784	sp|O94925|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12533	63.99947333333333	2	2183.005089	2182.017842	K	E	638	657
PSM	ELQSQISDTSVVLSMDNSR	785	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:35	ms_run[1]:scan=14490	73.82674333333334	2	2124.988207	2124.000478	R	S	234	253
PSM	SQEPIPDDQKVSDDDK	786	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=3132	18.373503333333332	2	1895.787595	1894.783348	K	E	415	431
PSM	QPCPSESDIITEEDK	787	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=13454	68.60766	2	1729.7402	1729.7347	K	S	202	217
PSM	ATSEEDVSIKSPICEK	788	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=9084	47.35637	2	1871.809967	1871.822376	K	Q	1606	1622
PSM	QMDESEQYLYGDDR	789	sp|Q92845|KIFA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:35	ms_run[1]:scan=9245	48.07549	2	1764.685978	1763.694459	R	I	691	705
PSM	TDMDNQIVVSDYAQMDR	790	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=11270	57.72456666666666	2	2032.851587	2031.851371	K	V	258	275
PSM	YLTESYGTGQDIDDR	791	sp|Q9UM54|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=11292	57.81256166666667	2	1732.747092	1731.758774	R	I	167	182
PSM	VFSNGADLSGVTEEAPLK	792	sp|P01009|A1AT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=17061	87.58355	2	1833.902543	1832.915609	K	L	335	353
PSM	FDYSGVGSSDGNSEESTLGK	793	sp|Q9NUJ1|ABHDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=12257	62.573145	2	2035.852191	2034.865424	R	W	110	130
PSM	AACSAAAMEEDSEASSSR	794	sp|Q05086-2|UBE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=5876	31.775	2	1828.7204	1828.7204	K	I	173	191
PSM	AAEDDEDDDVDTK	795	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1719	11.153	2	1436.5427	1436.5427	R	K	90	103
PSM	ACIDSNEDGDLSK	796	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=4885	26.94	2	1422.5933	1422.5933	R	S	208	221
PSM	ADVLTTGAGNPVGDK	797	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8923	46.592	2	1413.71	1413.7100	K	L	24	39
PSM	AGDNIPEEQPVASTPTTVSDGENKK	798	sp|Q9Y320-2|TMX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=9614	49.88	3	2663.1963	2663.1963	K	D	232	257
PSM	AGVQADEDEDGDEK	799	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1333	9.2186	2	1476.5852	1476.5852	R	D	268	282
PSM	APSTPVPPSPAPAPGLTK	800	sp|Q96EZ8-3|MCRS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=11231	57.528	2	1763.8859	1763.8859	K	R	87	105
PSM	AVTEQGAELSNEER	801	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5547	30.183	2	1531.7114	1531.7114	K	N	28	42
PSM	CESCYGAEAEDIK	802	sp|Q9Y282-2|ERGI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7891	41.428	2	1530.5967	1530.5967	R	C	142	155
PSM	CTSHSETPTVDDEEK	803	sp|O95425-2|SVIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=3077	18.103	2	1813.6714	1813.6714	R	V	277	292
PSM	DAEEEGGDQAGQNIR	804	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3137	18.399	2	1587.6761	1587.6761	K	K	91	106
PSM	DFDGLTDSSAGELSSR	805	sp|Q9H1H9-3|KI13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14537	74.071	2	1655.7275	1655.7275	K	R	1698	1714
PSM	DINVSVGSQQPDTK	806	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7775	40.925	2	1486.7264	1486.7264	R	D	964	978
PSM	DLQGAMDDLDADMK	807	sp|P46939-2|UTRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=9262	48.144	2	1568.6334	1568.6334	R	E	2700	2714
PSM	DPDAQPGGELMLGGTDSK	808	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=17788	91.766	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	809	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=19275	100.78	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	810	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=19430	101.81	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSEPLGIEEAQIGK	811	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14121	71.867	2	1484.7359	1484.7359	K	R	239	253
PSM	DSGIIATITSSSENDDR	812	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16464	84.14	2	1779.8123	1779.8123	K	S	223	240
PSM	DSLLQDGEFSMDLR	813	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=17435	89.708	2	1640.7352	1640.7352	R	T	76	90
PSM	DTDDVPMILVGNK	814	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:35	ms_run[2]:scan=19741	103.93	2	1431.6915	1431.6915	K	C	86	99
PSM	DYDEEEQGYDSEKEK	815	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=2761	16.497	2	1942.6993	1942.6993	R	K	423	438
PSM	EALELTDTGLLSGSEER	816	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18359	95.062	2	1818.8847	1818.8847	K	V	1302	1319
PSM	EALNVFGNDYDTEDGTGVR	817	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17071	87.636	3	2070.913	2070.9130	R	D	147	166
PSM	EALPAPSDDATALMTDPK	818	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:35	ms_run[2]:scan=12208	62.304	2	1857.8666	1857.8666	R	L	131	149
PSM	EAQAALAEAQEDLESER	819	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16246	82.973	3	1858.8545	1858.8545	R	V	1132	1149
PSM	EDLNSPNPSPGGCYDTK	820	sp|Q6P4A8|PLBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=7372	38.914	2	1849.7789	1849.7789	R	V	477	494
PSM	EEADENYNSVNTR	821	sp|Q12846-2|STX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3739	21.418	2	1539.6437	1539.6437	K	M	107	120
PSM	EEPVSSGPEEAVGK	822	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5563	30.255	2	1413.6624	1413.6624	K	S	565	579
PSM	EGEEPTVYSDEEEPKDESAR	823	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=5474	29.815	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	824	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=7014	37.172	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	825	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=7853	41.264	2	2374.9326	2374.9326	K	K	121	141
PSM	EGIESGDPGTDDGR	826	sp|Q12797-10|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3455	20.022	2	1403.5801	1403.5801	K	F	484	498
PSM	EGMNPSYDEYADSDEDQHDAYLER	827	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=12355	63.106	3	2944.0655	2944.0655	K	M	432	456
PSM	EISEASENIYSDVR	828	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12485	63.761	2	1610.7424	1610.7424	K	G	1781	1795
PSM	ELDEATESNEAMGR	829	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6650	35.348	2	1550.6519	1550.6519	R	E	1906	1920
PSM	ELESSEEGGSAEER	830	sp|Q9HAS0|NJMU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1982	12.47	2	1507.6274	1507.6274	K	R	15	29
PSM	ELGSECGIEFDEEK	831	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=13078	66.686	2	1640.6876	1640.6876	R	T	103	117
PSM	ELNEDVSADVEER	832	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10055	51.895	2	1503.6689	1503.6689	R	F	878	891
PSM	EMEENFAVEAANYQDTIGR	833	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35	ms_run[2]:scan=17218	88.505	3	2201.9535	2201.9535	R	L	346	365
PSM	EQSHAEISPPAESGQAVEECK	834	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=8619	45.15	2	2361.9784	2361.9784	R	E	141	162
PSM	ESEDDLNKESEEEVGPTK	835	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=5773	31.305	2	2113.8576	2113.8576	K	E	520	538
PSM	ESQHIPTAEGASGSNTEEEIR	836	sp|Q63ZY3-3|KANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=9207	47.916	3	2320.9809	2320.9809	R	M	567	588
PSM	ETGGAEGTGDAVLGEK	837	sp|Q92667-2|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6889	36.512	2	1489.6896	1489.6896	R	V	198	214
PSM	ETVSEESNVLCLSK	838	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4	ms_run[2]:scan=13449	68.581	2	1593.7556	1593.7556	R	S	581	595
PSM	EVAEAATGEDASSPPPK	839	sp|Q99536-3|VAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3599	20.751	2	1654.7686	1654.7686	R	T	6	23
PSM	EVEDKESEGEEEDEDEDLSK	840	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=5325	29.131	2	2418.8959	2418.8959	K	Y	147	167
PSM	EVEDKESEGEEEDEDEDLSK	841	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=5741	31.156	2	2418.8959	2418.8959	K	Y	147	167
PSM	EVNSQEEEEEELLR	842	sp|Q96RL1-5|UIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12963	66.093	2	1731.7799	1731.7799	R	K	98	112
PSM	FDYDDEPEAVEESK	843	sp|O95104-2|SCAF4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11865	60.605	2	1671.6788	1671.6788	R	K	265	279
PSM	FYGEAGPPAPSPAPGPPVK	844	sp|Q53EQ6-2|TIGD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=12946	66.011	2	1914.8917	1914.8917	R	E	137	156
PSM	GAEEMETVIPVDVMR	845	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=13256	67.617	2	1706.7855	1706.7855	K	R	13	28
PSM	GAGDGSDEEVDGKADGAEAKPAE	846	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=3503	20.278	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GEDLTEEEDGGIIR	847	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11118	57.002	2	1531.7002	1531.7002	K	R	139	153
PSM	GEDLTEEEDGGIIR	848	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12062	61.535	2	1531.7002	1531.7002	K	R	139	153
PSM	GIDSDDVQDNSQLK	849	sp|Q96QE3-2|ATAD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7085	37.521	2	1532.6954	1532.6954	R	A	611	625
PSM	GPAAPLTPGPQSPPTPLAPGQEK	850	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=14052	71.548	3	2287.125	2287.1250	K	G	165	188
PSM	GSLGSQGAKDEPEEELQK	851	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=8531	44.729	2	1980.8677	1980.8677	K	G	1329	1347
PSM	GSYGSDAEEEEYR	852	sp|Q9UDY2-4|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5986	32.296	2	1490.5797	1490.5797	R	Q	985	998
PSM	GVGDDQLGEESEER	853	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6070	32.68	2	1518.6434	1518.6434	R	D	257	271
PSM	IDENSDKEMEVEESPEK	854	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=7415	39.135	3	2086.829	2086.8290	K	I	495	512
PSM	IDLDAEEENIQEGPK	855	sp|P13866-2|SC5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13574	69.16	2	1698.7948	1698.7948	R	E	444	459
PSM	IDVTAPDVSIEEPEGK	856	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14947	76.208	2	1697.836	1697.8360	K	L	785	801
PSM	IEDSEPHIPLIDDTDAEDDAPTK	857	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=18049	93.252	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEDVGSDEEDDSGK	858	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3041	17.947	2	1493.6005	1493.6005	K	D	250	264
PSM	IEDVGSDEEDDSGKDK	859	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=2976	17.634	2	1816.6888	1816.6888	K	K	250	266
PSM	IEPGVDPDDTYNETPYEK	860	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12109	61.79	2	2080.9113	2080.9113	K	G	399	417
PSM	KEESEESDDDMGFGLFD	861	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=17794	91.8	2	1964.7469	1964.7469	K	-	99	116
PSM	LASEEPPDDEEALATIR	862	sp|Q9UBB4-2|ATX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14786	75.344	2	1854.8847	1854.8847	K	L	225	242
PSM	LDDDDEGVPSSALR	863	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9854	50.992	2	1487.674	1487.6740	R	E	37	51
PSM	LESSEGEIIQTVDR	864	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14022	71.394	2	1574.7788	1574.7788	K	Q	296	310
PSM	LGAAPEEESAYVAGEK	865	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9699	50.266	2	1619.7679	1619.7679	R	R	46	62
PSM	LLDAEDVDVPSPDEK	866	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14267	72.603	2	1640.7781	1640.7781	R	S	270	285
PSM	LPGPPPASPIPTEGPR	867	sp|Q9H6A9-3|PCX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=12413	63.404	2	1661.8178	1661.8178	R	T	789	805
PSM	LSQVSDSVSGQTVVDPK	868	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9885	51.133	2	1744.8843	1744.8843	R	G	255	272
PSM	LSSGDPSTSPSLSQTTPSKDTDDQSR	869	sp|Q99504-2|EYA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=7078	37.492	3	2773.1927	2773.1927	R	K	128	154
PSM	LVDEDFPEDSSSQK	870	sp|A6NDU8|CE051_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9632	49.962	2	1594.6999	1594.6999	K	V	82	96
PSM	LVQDVANNTNEEAGDGTTTATVLAR	871	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12792	65.285	3	2559.2413	2559.2413	K	S	97	122
PSM	LYGSAGPPPTGEEDTAEKDEL	872	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12798	65.312	3	2174.9855	2174.9855	K	-	634	655
PSM	MQNDTAENETTEK	873	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=739	6.4015	2	1525.6202	1525.6202	R	E	131	144
PSM	NIVVIDDDKSETCNEDLAGTTDEK	874	sp|Q15723-4|ELF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=13442	68.548	3	2760.1685	2760.1685	K	S	206	230
PSM	NQDEESQEAPELLK	875	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10376	53.384	2	1628.753	1628.7530	K	R	552	566
PSM	NSLQDQLDEEMEAK	876	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=10501	53.974	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	NTDQASMPDNTAAQK	877	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:35	ms_run[2]:scan=683	6.103	2	1606.6893	1606.6893	R	V	359	374
PSM	NVLDSEDEIEELSK	878	sp|Q9BWS9-3|CHID1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15424	78.651	2	1618.7574	1618.7574	R	T	162	176
PSM	NVTELNEPLSNEER	879	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10846	55.644	2	1642.7798	1642.7798	K	N	29	43
PSM	PVTVEPMDQLDDEEGLPEK	880	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16826	86.216	3	2139.9882	2139.9882	R	L	132	151
PSM	QDENDDDDDWNPCK	881	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=8401	44.096	2	1764.6169	1764.6169	K	A	188	202
PSM	QEMGEEEEENETFGLSR	882	sp|Q0ZGT2-4|NEXN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35	ms_run[2]:scan=11549	59.068	2	2028.8218	2028.8218	R	E	349	366
PSM	QLLDSDEEQEEDEGR	883	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7839	41.198	2	1790.7442	1790.7442	R	N	1168	1183
PSM	QLQQAQAAGAEQEVEK	884	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6818	36.164	2	1726.8486	1726.8486	K	F	46	62
PSM	RPPSPDVIVLSDNEQPSSPR	885	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14595	74.365	3	2349.0403	2349.0403	R	V	97	117
PSM	SDGLPWCSTTANYDTDDR	886	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:4	ms_run[2]:scan=15786	80.562	3	2072.8382	2072.8382	R	F	250	268
PSM	SEDGVEGDLGETQSR	887	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7189	38.025	2	1577.6805	1577.6805	K	T	135	150
PSM	SEQLGGDVESYDK	888	sp|Q9HC84|MUC5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8674	45.415	2	1425.626	1425.6260	K	I	1520	1533
PSM	SGDEEFKGEDELCDSGR	889	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10681	54.839	2	2008.7357	2008.7357	R	Q	339	356
PSM	SGDETPGSEVPGDK	890	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3704	21.259	2	1373.5947	1373.5947	R	A	161	175
PSM	SISVPPSPSDIPPPGPPR	891	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=15686	80.038	2	1875.9132	1875.9132	R	V	137	155
PSM	SQTTTERDSDTDVEEEELPVENR	892	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=11084	56.847	3	2758.1454	2758.1454	R	E	445	468
PSM	SSEHENAYENVPEEEGK	893	sp|Q13113|PDZ1I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=6913	36.629	2	2026.7793	2026.7793	R	V	92	109
PSM	STTPPPAEPVSLPQEPPKPR	894	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=12235	62.463	3	2284.0542	2284.0542	K	V	225	245
PSM	SVSNGTAKPATSENFDEDLK	895	sp|Q96K49-2|TM87B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=10653	54.718	3	2188.9525	2188.9525	K	W	493	513
PSM	SVSTPSEAGSQDSGDGAVGSR	896	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=4500	25.091	2	1949.8563	1949.8563	K	R	86	107
PSM	SVTEQGAELSNEER	897	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6095	32.796	2	1547.7063	1547.7063	K	N	28	42
PSM	TCTTVAFTQVNSEDK	898	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=10201	52.571	2	1699.7723	1699.7723	K	G	198	213
PSM	TCVADESAENCDK	899	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1391	9.5137	2	1497.5712	1497.5712	K	S	76	89
PSM	TEESPASDEAGEK	900	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1063	7.9503	2	1348.563	1348.5630	K	E	83	96
PSM	TLTDEVNSPDSDR	901	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6276	33.61	2	1447.6427	1447.6427	K	R	276	289
PSM	TVEDEDQDSEEEKDNDSYIK	902	sp|Q9Y5T5-4|UBP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=7373	38.917	2	2466.9435	2466.9435	K	E	97	117
PSM	TVEEIEACMAGCDK	903	sp|P12955-3|PEPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,9-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6707	35.611	2	1627.6528	1627.6528	R	A	407	421
PSM	VATLNSEEESDPPTYK	904	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8668	45.389	2	1778.821	1778.8210	K	D	62	78
PSM	VDIDAPDVSIEGPDAK	905	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14878	75.826	2	1639.7941	1639.7941	K	L	4352	4368
PSM	VDINTEDLEDGTCR	906	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=10629	54.61	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VDSAATSGYEIGNPPDYR	907	sp|P24666-4|PPAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12410	63.389	2	1910.8646	1910.8646	R	G	42	60
PSM	VDVEVPDVSLEGPEGK	908	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17013	87.311	2	1667.8254	1667.8254	K	L	1290	1306
PSM	VEGDMQVPDLDIK	909	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35	ms_run[2]:scan=13162	67.136	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VEYTLGEESEAPGQR	910	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9871	51.071	2	1663.7689	1663.7689	K	A	1226	1241
PSM	VFDDESDEKEDEEYADEK	911	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=9191	47.851	3	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	912	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=9613	49.878	3	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	913	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=10123	52.218	2	2270.8264	2270.8264	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	914	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=10658	54.739	3	2270.8264	2270.8264	K	G	637	655
PSM	VGAEDADGIDMAYR	915	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:35	ms_run[2]:scan=9227	47.998	2	1497.6406	1497.6406	K	V	283	297
PSM	VGDDVEFEVSSDR	916	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11435	58.511	2	1452.6369	1452.6369	K	R	65	78
PSM	VLAVNQENEQLMEDYEK	917	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:35	ms_run[2]:scan=12850	65.553	3	2066.9467	2066.9467	K	L	265	282
PSM	VSEVEEEKEPVPQPLPSDDTR	918	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=11679	59.704	3	2459.1105	2459.1105	R	V	447	468
PSM	VVVTVEQTEEELER	919	sp|O15269|SPTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16013	81.72	2	1658.8363	1658.8363	R	A	446	460
PSM	YDGESDKEQFDDDQK	920	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=5314	29.088	2	1897.6891	1897.6891	K	V	1117	1132
PSM	YNDWSDDDDDSNESK	921	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5467	29.779	2	1803.6344	1803.6344	R	S	57	72
PSM	YYSPCEEHPAETNQNEGAESGTIR	922	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8680	45.444	3	2818.1178	2818.1178	R	Q	182	206
PSM	NPDDITNEEYGEFYK	923	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=15751	80.38100666666666	2	1833.766904	1832.774089	R	S	300	315
PSM	QSFDDNDSEELEDKDSK	924	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=9956	51.4526	2	2062.7516	2062.7523	K	S	106	123
PSM	QEPESEEEEEEKQEK	925	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4434	24.735725	2	1938.7275	1938.7250	K	E	579	594
PSM	ADKEAAFDDAVEER	926	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=12446	63.551840000000006	2	1606.7127	1606.7106	M	V	2	16
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	927	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=13273	67.71148666666667	2	2789.278763	2789.277184	R	T	112	140
PSM	QNLYDLDEDDDGIASVPTK	928	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=19411	101.69638666666667	2	2089.9361	2089.9323	K	Q	179	198
PSM	GEDNAIEMSEDFDGK	929	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=13370	68.19091666666667	2	1656.664473	1655.662096	K	M	4722	4737
PSM	QSGEAFVELGSEDDVK	930	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=17723	91.40720166666667	2	1691.7531	1691.7521	R	M	53	69
PSM	GVDEDDPVNSAYNMK	931	sp|Q96JI7|SPTCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:35	ms_run[1]:scan=8360	43.90868	2	1668.696852	1668.693731	K	L	312	327
PSM	SEESLTSLHAVDGDSK	932	sp|A7KAX9|RHG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=11148	57.15271333333333	2	1753.742083	1753.740755	K	L	706	722
PSM	NPDDITQEEYGEFYK	933	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=16009	81.69668833333333	2	1847.779306	1846.789740	R	S	292	307
PSM	NGMASEGLNSSLCSPGHER	934	sp|Q9BQI7|PSD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=9207	47.91604	3	2323.739083	2321.728597	R	R	32	51
PSM	GARGSLPTTDAEPDSSPTPR	935	sp|P14616|INSRR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,9-UNIMOD:21,15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=10281	52.958055	2	2332.849805	2330.825985	R	D	1267	1287
PSM	TLLPSTSNSKMASSSGTATNR	936	sp|Q8IWI9|MGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=8874	46.34311833333334	2	2430.904076	2429.897770	R	P	1493	1514
PSM	AADEEAFEDNSEEYIR	937	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14013	71.352	3	1886.7806	1886.7806	R	R	300	316
PSM	AALLEAGMPECTEDK	938	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=9174	47.764	2	1649.7277	1649.7277	R	-	1278	1293
PSM	AALSASEGEEVPQDK	939	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6665	35.413	2	1529.7209	1529.7209	K	A	26	41
PSM	ADPDGPEAQAEACSGER	940	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=5532	30.116	2	1758.7115	1758.7115	K	T	6	23
PSM	AEAGPEGVAPAPEGEK	941	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5427	29.606	2	1507.7155	1507.7155	K	K	670	686
PSM	AGGEEEDDDDEAAGGR	942	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1286	8.9948	2	1591.587	1591.5870	R	C	357	373
PSM	ALEEGLTPQEICDK	943	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=12744	65.049	2	1601.7607	1601.7607	K	Y	322	336
PSM	AQAVSEDAGGNEGR	944	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1164	8.4078	2	1359.6015	1359.6015	R	A	121	135
PSM	AVSPPHLDGPPSPR	945	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11036	56.594	2	1585.6691	1585.6691	K	S	516	530
PSM	AVTELNEPLSNEDR	946	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10432	53.659	2	1585.7584	1585.7584	K	N	29	43
PSM	CDGFLDCSDESDEK	947	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9573	49.661	2	1675.5978	1675.5978	R	A	1534	1548
PSM	CTLPEHESPSQDISDACEAESTER	948	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12567	64.145	3	2827.095	2827.0950	R	C	670	694
PSM	DADECLLFGQEICK	949	sp|Q14766-3|LTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=18446	95.616	2	1696.7437	1696.7437	K	N	1045	1059
PSM	DDATPVRDEPMDAESITFK	950	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13325	67.973	2	2231.9294	2231.9294	R	S	947	966
PSM	DDDDGPVSSQGYMPYLNK	951	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35	ms_run[2]:scan=12538	64.022	2	2015.8419	2015.8419	R	Y	57	75
PSM	DFDDLCSLPDLNEK	952	sp|B2RTY4-3|MYO9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=19259	100.7	2	1679.7349	1679.7349	K	T	147	161
PSM	DLDDIEDENEQLK	953	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12721	64.947	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	954	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12938	65.972	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLQGAMDDLDADMK	955	sp|P46939-2|UTRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=8886	46.404	2	1568.6334	1568.6334	R	E	2700	2714
PSM	DNAEAISGHSVEADPK	956	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=5574	30.298	2	1718.7149	1718.7149	K	E	2744	2760
PSM	DPDAQPGGELMLGGTDSK	957	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=10823	55.54	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	958	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=20865	111.63	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	959	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15016	76.557	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSDDVPMVLVGNK	960	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=12734	65.005	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	961	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15332	78.194	2	1387.6653	1387.6653	K	C	105	118
PSM	DSDDVPMVLVGNK	962	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15523	79.202	2	1387.6653	1387.6653	K	C	105	118
PSM	DSDDYAQLCNIPVTGR	963	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=15582	79.493	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSQSASGEERPPEADGK	964	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=1776	11.445	2	1838.732	1838.7320	R	K	360	377
PSM	DTDDVPMILVGNK	965	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=14921	76.073	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	966	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=15314	78.096	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	967	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=15832	80.81	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	968	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=16816	86.16	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	969	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=18517	96.046	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	970	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=16641	85.147	2	1431.6915	1431.6915	K	C	86	99
PSM	DVDASPSPLSVQDLK	971	sp|Q8IWZ8|SUGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15128	77.135	2	1569.7886	1569.7886	R	G	405	420
PSM	DVFSGSDTDPDMAFCK	972	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=14658	74.691	2	1806.7077	1806.7077	R	S	480	496
PSM	DVPNPNQDDDDDEGFSFNPLK	973	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19163	100.06	3	2376.9982	2376.9982	K	I	523	544
PSM	DYDEEEQGYDSEKEK	974	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=3165	18.54	2	1942.6993	1942.6993	R	K	423	438
PSM	DYEPPSPSPAPGAPPPPPQR	975	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=9644	50.013	3	2132.9568	2132.9568	R	N	1674	1694
PSM	EEETKTSNGDLSDSTVSADPVVK	976	sp|Q2M389|WASC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=9959	51.468	2	2487.0902	2487.0902	K	-	1151	1174
PSM	EEVNECGESIDR	977	sp|Q9HB21-2|PKHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=4559	25.348	2	1435.5885	1435.5885	K	N	158	170
PSM	EGEEPTVYSDEEEPKDESAR	978	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=4029	22.802	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	979	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=4735	26.171	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	980	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=5726	31.088	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	981	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=6164	33.109	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	982	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=6379	34.116	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	983	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=6815	36.15	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	984	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=7633	40.233	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	985	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=8132	42.786	2	2374.9326	2374.9326	K	K	121	141
PSM	EGPEPPEEVPPPTTPPVPK	986	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=13281	67.749	2	2072.9708	2072.9708	K	V	597	616
PSM	EGQGEGETQEAAAAAR	987	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3394	19.695	2	1573.6968	1573.6968	R	R	3150	3166
PSM	EISDDEAEEEKGEK	988	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=2347	14.365	2	1686.6509	1686.6509	K	E	224	238
PSM	ELDEATESNEAMGR	989	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:35	ms_run[2]:scan=4059	22.97	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELGGLEGDPSPEEDEGIQK	990	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12084	61.656	2	1997.9066	1997.9066	K	A	248	267
PSM	EQDDLLVLLADQDQK	991	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21598	116.9	2	1741.8734	1741.8734	K	I	905	920
PSM	ESQDTSFTTLVER	992	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14581	74.302	2	1511.7104	1511.7104	R	V	164	177
PSM	ESQSYLVEDLER	993	sp|Q9ULZ3-3|ASC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15655	79.884	2	1466.6889	1466.6889	R	S	123	135
PSM	ETTCSKESNEELTESCETK	994	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,4-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3151	18.468	3	2340.8975	2340.8975	R	K	289	308
PSM	ETTCSKESNEELTESCETK	995	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4600	25.536	2	2340.8975	2340.8975	R	K	289	308
PSM	EVEDKESEGEEEDEDEDLSK	996	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=5539	30.145	2	2418.8959	2418.8959	K	Y	147	167
PSM	EVLDEDTDEEKETLK	997	sp|Q9Y3P9|RBGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8907	46.513	2	1871.7925	1871.7925	K	N	990	1005
PSM	EVTDMNLNVINEGGIDK	998	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35	ms_run[2]:scan=14055	71.559	2	1875.8884	1875.8884	K	L	355	372
PSM	FSSSDSDFDDEEPR	999	sp|O14526-3|FCHO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9272	48.189	2	1631.6223	1631.6223	R	K	292	306
PSM	GPENEYSVDDECLVK	1000	sp|Q5SRH9-2|TT39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=12700	64.832	2	1752.7512	1752.7512	K	L	102	117
PSM	GPPQEEEEEEDEEEEATK	1001	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7171	37.929	3	2102.8288	2102.8288	R	E	202	220
PSM	GSETGSETHESDLAPSDK	1002	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=3835	21.844	2	1925.7528	1925.7528	R	E	1105	1123
PSM	GTEAPAVVTEEEDDDEETAPPVIAPR	1003	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15607	79.605	3	2736.2614	2736.2614	K	P	161	187
PSM	IDENSDKEMEVEESPEK	1004	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4624	25.645	3	2102.8239	2102.8239	K	I	495	512
PSM	IDNDGDGFVTTEELK	1005	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13530	68.947	2	1651.7577	1651.7577	R	T	91	106
PSM	IDVDTEDVGDER	1006	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8406	44.115	2	1361.5947	1361.5947	R	V	86	98
PSM	IDVDTEDVGDER	1007	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8612	45.12	2	1361.5947	1361.5947	R	V	86	98
PSM	IEDVGSDEEDDSGKDK	1008	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=857	7.0045	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1009	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=2165	13.406	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVTPIPSDSTR	1010	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9559	49.598	2	1428.7096	1428.7096	R	R	129	142
PSM	IEGDETSTEAATR	1011	sp|P52434-3|RPAB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2321	14.219	2	1378.6212	1378.6212	R	L	63	76
PSM	IESSLQEDEPENDAK	1012	sp|Q9NPL8|TIDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6669	35.428	2	1702.7534	1702.7534	K	K	250	265
PSM	IEYNDQNDGSCDVK	1013	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=4507	25.125	2	1655.6733	1655.6733	K	Y	594	608
PSM	IVQAEGEAEAAK	1014	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3199	18.721	2	1214.6143	1214.6143	K	M	225	237
PSM	IYEFPETDDEEENK	1015	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12374	63.208	2	1756.7316	1756.7316	K	L	221	235
PSM	KDSEGYSESPDLEFEYADTDK	1016	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=15838	80.837	3	2503.9792	2503.9792	R	W	57	78
PSM	LANQDEGPEDEEDEVPK	1017	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8183	43.024	2	1912.8174	1912.8174	K	K	435	452
PSM	LAPDYDALDVANK	1018	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13877	70.713	2	1403.6933	1403.6933	R	I	140	153
PSM	LDGESSELQEQMVEQQQR	1019	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:35	ms_run[2]:scan=8168	42.958	3	2148.9593	2148.9593	R	A	1077	1095
PSM	LDYDEDASAMLK	1020	sp|Q8NFI4|F10A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:35	ms_run[2]:scan=9851	50.976	2	1385.6021	1385.6021	K	E	211	223
PSM	LEELDDFEEGSQK	1021	sp|Q7Z3J2-2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13368	68.183	2	1537.6784	1537.6784	R	E	40	53
PSM	LLDPEDVDVPQPDEK	1022	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15095	76.947	2	1707.8203	1707.8203	R	S	203	218
PSM	LLLEYTDSSYEEK	1023	sp|Q03013-3|GSTM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15043	76.698	2	1588.7508	1588.7508	R	K	19	32
PSM	LQAETEELEEEK	1024	sp|P15408-3|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8086	42.554	2	1446.6726	1446.6726	K	S	113	125
PSM	LQDFSDQLSDYYEK	1025	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17407	89.555	2	1749.7734	1749.7734	K	F	4499	4513
PSM	LSQVNESDADDEDNYGAR	1026	sp|Q6V0I7-2|FAT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7099	37.59	3	1996.8246	1996.8246	K	L	3111	3129
PSM	MASPPAPSPAPPAISPIIK	1027	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=16198	82.705	2	1936.9733	1936.9733	R	N	99	118
PSM	MATEVAADALGEEWK	1028	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=16135	82.361	2	1635.745	1635.7450	R	G	32	47
PSM	MDRTPPPPTLSPAAITVGR	1029	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=15629	79.73	3	2135.984	2135.9840	R	G	587	606
PSM	MDTIDQDDELIR	1030	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=11830	60.435	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	NEDITEPQSILAAAEK	1031	sp|Q9Y2Q3-4|GSTK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17875	92.268	2	1727.8578	1727.8578	R	A	86	102
PSM	NEEALDTESSER	1032	sp|Q92859-3|NEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3425	19.866	2	1378.5848	1378.5848	K	L	285	297
PSM	NEIDNYEEDYQK	1033	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9858	51.005	2	1558.6423	1558.6423	K	M	1109	1121
PSM	NESSNASEEEACEK	1034	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=950	7.4094	2	1582.6053	1582.6053	K	K	170	184
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1035	sp|Q9C0E8-3|LNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=13048	66.511	3	2539.2472	2539.2472	R	D	52	77
PSM	NSQEDSEDSEDKDVK	1036	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=867	7.0473	2	1803.6684	1803.6684	K	T	53	68
PSM	NTGTEAPDYLATVDVDPK	1037	sp|Q13228-3|SBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16285	83.19	2	1904.9004	1904.9004	R	S	35	53
PSM	QDENDDDDDWNPCK	1038	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=8197	43.091	2	1764.6169	1764.6169	K	A	188	202
PSM	QDVDDEYSMQYSAR	1039	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10149	52.336	2	1705.689	1705.6890	K	G	683	697
PSM	QSGEAFVELGSEDDVK	1040	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13938	71.009	2	1708.7792	1708.7792	R	M	53	69
PSM	RPPSPDVIVLSDNEQPSSPR	1041	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13668	69.661	3	2349.0403	2349.0403	R	V	97	117
PSM	SAEIDSDDTGGSAAQK	1042	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1000	7.6606	2	1550.6696	1550.6696	K	Q	814	830
PSM	SCSEEKIPEDGSLNTTK	1043	sp|P37173|TGFR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=8391	44.044	2	1973.8289	1973.8289	R	-	551	568
PSM	SDEEDFVKVEDLPLK	1044	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=19009	99.095	2	1841.8336	1841.8336	K	L	1794	1809
PSM	SEDDESGAGELTR	1045	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4014	22.724	2	1364.5692	1364.5692	K	E	309	322
PSM	SEDFGVNEDLADSDAR	1046	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13228	67.456	2	1738.7282	1738.7282	R	A	189	205
PSM	SEQEDEVLLVSSSR	1047	sp|Q9NZJ9|NUDT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13237	67.509	2	1576.758	1576.7580	R	Y	28	42
PSM	SLDEADSENKEEVSPLGSK	1048	sp|Q6ZV73-2|FGD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=9686	50.21	3	2112.91	2112.9100	R	A	1197	1216
PSM	SQDVELWEGEVVK	1049	sp|Q9UHB6-5|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16806	86.109	2	1516.7409	1516.7409	K	E	567	580
PSM	SQEPIPDDQKVSDDDK	1050	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=4378	24.497	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1051	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=4808	26.548	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1052	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=5000	27.551	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1053	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=5651	30.662	2	1894.7833	1894.7833	K	E	415	431
PSM	SRDATPPVSPINMEDQER	1054	sp|P17275|JUNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=7596	40.077	3	2216.881	2216.8810	R	I	251	269
PSM	SSFNVSDVARPEAAGSPPEEGGCTEGTPAK	1055	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=13756	70.099	3	3083.3179	3083.3179	K	D	577	607
PSM	SSTPSHGQTTATEPTPAQK	1056	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=1606	10.625	2	2004.879	2004.8790	R	T	153	172
PSM	SVEDDEEGHLICQSGDVLSAR	1057	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16381	83.715	3	2394.9999	2394.9999	R	Y	140	161
PSM	SYEDDDDMDLQPNK	1058	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:35	ms_run[2]:scan=6038	32.535	2	1699.6519	1699.6519	R	Q	167	181
PSM	SYEDLTESEDGAASGDSHK	1059	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=8012	42.184	2	2076.7797	2076.7797	R	E	56	75
PSM	TCVADESAENCDK	1060	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2879	17.131	2	1497.5712	1497.5712	K	S	76	89
PSM	TDDYLDQPCLETVNR	1061	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=14564	74.219	2	1837.8152	1837.8152	R	I	194	209
PSM	TEEIAEEEETVFPK	1062	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15592	79.535	2	1649.7672	1649.7672	K	A	41	55
PSM	TFMDMDQDSEDEK	1063	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2299	14.118	2	1621.576	1621.5760	K	Q	51	64
PSM	TFMDMDQDSEDEK	1064	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2499	15.124	2	1621.576	1621.5760	K	Q	51	64
PSM	TFMDMDQDSEEEK	1065	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2760	16.493	2	1635.5916	1635.5916	K	E	41	54
PSM	TVQIEASTVEIEER	1066	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13494	68.778	2	1602.8101	1602.8101	R	G	78	92
PSM	TYADYESVNECMEGVCK	1067	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9942	51.393	3	2069.8016	2069.8016	R	M	18	35
PSM	VDATEESDLAQQYGVR	1068	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13898	70.824	3	1779.8275	1779.8275	K	G	82	98
PSM	VDEEDSDEESHHDEMSEQEEELEDDPTVVK	1069	sp|Q9P0P8|MRES1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=11597	59.311	3	3705.3234	3705.3234	K	N	101	131
PSM	VDSNDSLYGGDSK	1070	sp|Q7Z3J2-2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4259	23.931	2	1355.5841	1355.5841	K	F	693	706
PSM	VDSTTCLFPVEEK	1071	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=16523	84.481	2	1603.6841	1603.6841	R	A	241	254
PSM	VDVDVPDVNIEGPDAK	1072	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16054	81.924	2	1680.8206	1680.8206	K	L	3186	3202
PSM	VDVECPDVNIEGPEGK	1073	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4	ms_run[2]:scan=13183	67.241	2	1755.7985	1755.7985	K	W	2802	2818
PSM	VFCVEEEDSESSLQK	1074	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=11613	59.385	2	1784.7775	1784.7775	R	R	366	381
PSM	VLCDDVICDETK	1075	sp|P02452|CO1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10975	56.306	2	1465.6429	1465.6429	K	N	68	80
PSM	VTLLDGTEYSCDLEK	1076	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=16834	86.269	2	1741.808	1741.8080	K	H	222	237
PSM	VVTDTDETELAR	1077	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7000	37.106	2	1347.6518	1347.6518	K	Q	277	289
PSM	YDNTSPEDMPQDFK	1078	sp|O94956-3|SO2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35	ms_run[2]:scan=7925	41.596	2	1701.6828	1701.6828	R	A	122	136
PSM	YDNTSPEDMPQDFK	1079	sp|O94956-3|SO2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11925	60.899	2	1685.6879	1685.6879	R	A	122	136
PSM	TTTTNTQVEGDDEAAFLER	1080	sp|Q05682|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=14648	74.64019666666667	2	2097.938753	2096.949822	K	L	81	100
PSM	GNAEGSSDEEGKLVIDEPAK	1081	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=11105	56.94608	2	2124.9132	2123.9252	K	E	127	147
PSM	IEENSLKEEESIEGEK	1082	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=9311	48.372105	2	1942.852841	1941.845614	K	E	1566	1582
PSM	DPDAQPGGELMLGGTDSK	1083	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:35	ms_run[1]:scan=14585	74.32038666666666	2	1803.799533	1802.799259	R	Y	236	254
PSM	QDVDDEYGVSQALAR	1084	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=16036	81.83217666666667	2	1647.7397	1647.7371	K	G	712	727
PSM	DSDDVPMVLVGNK	1085	sp|P01112|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:35	ms_run[1]:scan=14053	71.551725	2	1403.654742	1403.660246	K	C	105	118
PSM	AGVEEVAASGSHLNGDLDPDDR	1086	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=17368	89.31365500000001	3	2265.0177	2265.0140	M	E	2	24
PSM	SSPPAPPLPPGSGSPGTPQALPR	1087	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=14580	74.29927833333333	3	2245.099887	2244.093998	R	R	585	608
PSM	YEGSYALTSEEAER	1088	sp|O95810|CAVN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9791	50.70538333333333	2	1604.706428	1603.700196	R	S	395	409
PSM	QFYDQALQQAVVDDDANNAK	1089	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=17137	88.047875	2	2253.022755	2252.034555	K	A	125	145
PSM	SISVPPSPSDIPPPGPPR	1090	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=15426	78.65796999999999	2	1876.918600	1875.913180	R	V	563	581
PSM	SISVPPSPSDIPPPGPPR	1091	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=15485	78.97894333333333	2	1876.919182	1875.913180	R	V	563	581
PSM	ALEEEEGGTEVLSK	1092	sp|Q6P1R4|DUS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=9028	47.077315000000006	2	1489.707601	1489.714784	R	N	357	371
PSM	GADFLVTEVENGGSLGSK	1093	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=17624	90.82769833333333	2	1779.855573	1778.868659	K	K	189	207
PSM	VVVAENFDEIVNNENK	1094	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=17152	88.12871	2	1832.882126	1831.895208	K	D	380	396
PSM	NPDDITQEEYGEFYK	1095	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=16200	82.71733666666667	2	1847.778758	1846.789740	R	S	292	307
PSM	WSNIYEDNGDDAPQNAK	1096	sp|Q8N6N3|CA052_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=10627	54.599030000000006	2	1936.808779	1935.823499	K	K	128	145
PSM	QLLCTNEDVSSPASADQR	1097	sp|Q6P4A7|SFXN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4	ms_run[1]:scan=10832	55.575556666666664	2	1990.893612	1989.906183	R	I	67	85
PSM	GSTTNDPPKQSPGSTSPK	1098	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=2992	17.71363	3	2024.737063	2024.753064	K	P	161	179
PSM	INISSPGSPVTAVTDDFK	1099	sp|P46059|S15A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=8472	44.434513333333335	2	2088.851013	2086.830252	R	Q	438	456
PSM	ETTCSKESNEELTESCETK	1100	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=3074	18.083791666666666	2	2341.902213	2340.897468	R	K	325	344
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	1101	sp|Q96RT1|ERBIN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=7035	37.283384999999996	3	2859.093670	2858.104652	K	M	639	664
PSM	AADEEAFEDNSEEYIR	1102	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14206	72.292	2	1886.7806	1886.7806	R	R	300	316
PSM	AAEDDEDDDVDTK	1103	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1291	9.0176	2	1436.5427	1436.5427	R	K	90	103
PSM	AAEDDEDDDVDTKK	1104	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=935	7.345	2	1564.6377	1564.6377	R	Q	90	104
PSM	AALEDTLAETEAR	1105	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12520	63.937	2	1388.6783	1388.6783	K	F	318	331
PSM	ACIDSNEDGDLSK	1106	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=3967	22.491	2	1422.5933	1422.5933	R	S	208	221
PSM	ADAEGESDLENSR	1107	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3670	21.097	2	1391.5801	1391.5801	K	K	842	855
PSM	ADDYIEITGAGGK	1108	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11516	58.894	2	1308.6198	1308.6198	K	K	323	336
PSM	AGGEEEDDDDEAAGGR	1109	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=980	7.5704	2	1591.587	1591.5870	R	C	357	373
PSM	AGSSASSPPSASSSPHPSAAVPAADPADSASGSSNK	1110	sp|Q8NDF8-4|PAPD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=7932	41.649	3	3273.4059	3273.4059	R	R	43	79
PSM	ALDSSPEANTEDDK	1111	sp|B4DJY2|TM233_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3249	18.965	2	1490.6373	1490.6373	R	T	13	27
PSM	ALDVSASDDEIAR	1112	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10200	52.567	2	1360.647	1360.6470	K	L	181	194
PSM	AVANYDSVEEGEK	1113	sp|P51659-3|DHB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6210	33.305	2	1409.6311	1409.6311	K	V	51	64
PSM	AVTELNEPLSNEDR	1114	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10441	53.699	3	1585.7584	1585.7584	K	N	29	43
PSM	CDYMDEVTYGELEK	1115	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=17208	88.455	2	1750.7066	1750.7066	K	E	602	616
PSM	CGEDDETIPSEYR	1116	sp|P20810-4|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=9018	47.034	2	1569.6253	1569.6253	K	L	287	300
PSM	CYVDGSEEIGSDFK	1117	sp|P78310-5|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=13291	67.802	2	1604.6665	1604.6665	R	I	146	160
PSM	DADSITLFDVQQK	1118	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17614	90.775	2	1478.7253	1478.7253	R	R	468	481
PSM	DASTLQSQKAEGTGDAK	1119	sp|O00479|HMGN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=1725	11.189	3	1785.7782	1785.7782	R	-	74	91
PSM	DDATPVRDEPMDAESITFK	1120	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=15936	81.323	2	2215.9344	2215.9344	R	S	947	966
PSM	DDDDGPVSSQGYMPYLNK	1121	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=12552	64.08	3	2015.8419	2015.8419	R	Y	57	75
PSM	DDDDIDLFGSDDEEESEEAKR	1122	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=16308	83.33	3	2507.9337	2507.9337	K	L	97	118
PSM	DDDDIDLFGSDDEEESEEAKR	1123	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=16679	85.372	3	2507.9337	2507.9337	K	L	97	118
PSM	DDDEGPVSNQGYMPYLNR	1124	sp|Q9UH65|SWP70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=12762	65.131	3	2084.8745	2084.8745	R	F	58	76
PSM	DDGSTLMEIDGDK	1125	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=9522	49.41	2	1410.5821	1410.5821	R	G	6	19
PSM	DEDAGEGIQCSQR	1126	sp|Q9BSA9|TM175_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=2796	16.658	2	1463.5947	1463.5947	R	M	23	36
PSM	DGDDVIIIGVFK	1127	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21494	116.13	2	1289.6867	1289.6867	K	G	302	314
PSM	DGQDAIAQSPEKESK	1128	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=2582	15.553	2	1681.7196	1681.7196	K	D	281	296
PSM	DGQVINETSQHHDDLE	1129	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=7178	37.958	2	1915.7585	1915.7585	R	-	451	467
PSM	DIDSEKEAAMEAEIK	1130	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=13044	66.492	2	1757.7431	1757.7431	K	A	614	629
PSM	DIYDKDNYELDEDTD	1131	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12709	64.882	2	1861.7378	1861.7378	K	-	1363	1378
PSM	DMDEPSPVPNVEEVTLPK	1132	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35	ms_run[2]:scan=17591	90.637	2	2010.9456	2010.9456	K	T	342	360
PSM	DPDAQPGGELMLGGTDSK	1133	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=11027	56.555	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1134	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15414	78.601	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1135	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14468	73.718	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDMVQNTVSELIK	1136	sp|Q16698-2|DECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35	ms_run[2]:scan=18824	97.918	2	1603.7763	1603.7763	R	V	111	125
PSM	DPDMVQNTVSELIK	1137	sp|Q16698-2|DECR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35	ms_run[2]:scan=18847	98.07	2	1603.7763	1603.7763	R	V	111	125
PSM	DPIDVDLPEEAER	1138	sp|P29590-4|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15252	77.753	2	1496.6995	1496.6995	R	V	412	425
PSM	DSDDVPMVLVGNK	1139	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=12329	62.966	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	1140	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=12529	63.982	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	1141	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15771	80.484	2	1387.6653	1387.6653	K	C	105	118
PSM	DSHSSEEDEASSQTDLSQTISK	1142	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=9604	49.833	3	2459.9813	2459.9813	R	K	153	175
PSM	DTDDVPMILVGNK	1143	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=15118	77.088	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1144	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=16072	82.011	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1145	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=16254	83.019	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1146	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=16440	84.027	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1147	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=18681	97.058	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1148	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=19429	101.8	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1149	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=20006	105.71	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1150	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=20360	108.1	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1151	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=21657	117.33	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1152	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=15639	79.796	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1153	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17666	91.078	2	1415.6966	1415.6966	K	C	86	99
PSM	DYDEEEQGYDSEKEK	1154	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=1531	10.208	2	1942.6993	1942.6993	R	K	423	438
PSM	DYDEEEQGYDSEKEK	1155	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=4008	22.691	2	1942.6993	1942.6993	R	K	423	438
PSM	EEPVSSGPEEAVGK	1156	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5764	31.269	2	1413.6624	1413.6624	K	S	565	579
PSM	EEVNETYGDGDGR	1157	sp|Q96P47-5|AGAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3468	20.088	2	1439.5801	1439.5801	K	T	480	493
PSM	EGEEPTVYSDEEEPKDESAR	1158	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=4515	25.161	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1159	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=5251	28.763	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1160	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=5949	32.099	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1161	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=6186	33.207	3	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1162	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=6604	35.137	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1163	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=7434	39.219	2	2374.9326	2374.9326	K	K	121	141
PSM	EGMNPSYDEYADSDEDQHDAYLER	1164	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=12316	62.906	2	2944.0655	2944.0655	K	M	432	456
PSM	EIEELQSQAQALSQEGK	1165	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14252	72.522	3	1886.9222	1886.9222	K	S	1435	1452
PSM	ELAEDGYSGVEVR	1166	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10298	53.034	2	1422.6627	1422.6627	R	V	28	41
PSM	ELAEDGYSGVEVR	1167	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10550	54.201	2	1422.6627	1422.6627	R	V	28	41
PSM	ELDEATESNEAMGR	1168	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:35	ms_run[2]:scan=3819	21.776	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELEDATETADAMNR	1169	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:35	ms_run[2]:scan=5022	27.665	2	1580.6624	1580.6624	R	E	1899	1913
PSM	ELEDATETADAMNR	1170	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9094	47.402	2	1564.6675	1564.6675	R	E	1899	1913
PSM	ELEDVTESAESMNR	1171	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:35	ms_run[2]:scan=7622	40.182	2	1624.6886	1624.6886	R	E	1923	1937
PSM	ELESSEEGGSAEER	1172	sp|Q9HAS0|NJMU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2324	14.235	2	1507.6274	1507.6274	K	R	15	29
PSM	ELGSECGIEFDEEK	1173	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=13295	67.821	2	1640.6876	1640.6876	R	T	103	117
PSM	ENTPSEANLQEEEVR	1174	sp|Q93062-4|RBPMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8915	46.549	2	1743.7911	1743.7911	K	T	10	25
PSM	ERVPDSPSPAPSLEEGR	1175	sp|Q9UI36-2|DACH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9824	50.855	2	1981.8184	1981.8184	K	R	434	451
PSM	ESEDKPEIEDVGSDEEEEK	1176	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:21	ms_run[2]:scan=8696	45.525	3	2271.8792	2271.8792	K	K	251	270
PSM	EVDDLGPEVGDIK	1177	sp|O43143|DHX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13550	69.047	2	1384.6722	1384.6722	R	I	372	385
PSM	EVEDKESEGEEEDEDEDLSK	1178	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=5600	30.417	3	2418.8959	2418.8959	K	Y	147	167
PSM	GAGCDTSMETACGDSK	1179	sp|Q6N022|TEN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=779	6.6027	2	1661.5967	1661.5967	R	D	827	843
PSM	GDSFPDDGVQDDDDR	1180	sp|Q92932-2|PTPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8259	43.398	2	1651.6234	1651.6234	R	L	373	388
PSM	GEDEEENNLEVR	1181	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5985	32.292	2	1431.6114	1431.6114	K	E	90	102
PSM	GEIDASVPELEGDLR	1182	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17031	87.419	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GEIDASVPELEGDLR	1183	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17223	88.531	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GGSDDSSKDPIDVNYEK	1184	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=9343	48.52	2	1904.7677	1904.7677	R	L	780	797
PSM	GPAAPLTPGPQSPPTPLAPGQEK	1185	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=14258	72.556	3	2287.125	2287.1250	K	G	165	188
PSM	GSDALSETSSVSHIEDLEK	1186	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=16040	81.852	2	2082.8994	2082.8994	R	V	622	641
PSM	GSETGSETHESDLAPSDK	1187	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=4120	23.275	2	1925.7528	1925.7528	R	E	1105	1123
PSM	GTDDSPKDSQEDLQER	1188	sp|Q969E4|TCAL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=3705	21.262	2	1898.7531	1898.7531	R	H	117	133
PSM	GVDEDDPVNSAYNMK	1189	sp|Q96JI7-2|SPTCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:35	ms_run[2]:scan=8279	43.5	2	1668.6937	1668.6937	K	L	312	327
PSM	GVEEEEEDGEMRE	1190	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=1789	11.503	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1191	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=2393	14.582	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1192	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=2775	16.563	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1193	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=3308	19.256	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1194	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=3500	20.262	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1195	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4613	25.592	2	1536.5886	1536.5886	R	-	74	87
PSM	GVGDDQLGEESEER	1196	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5831	31.552	2	1518.6434	1518.6434	R	D	257	271
PSM	IDENSDKEMEVEESPEK	1197	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=3982	22.555	3	2102.8239	2102.8239	K	I	495	512
PSM	IDENSDKEMEVEESPEK	1198	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4828	26.658	3	2102.8239	2102.8239	K	I	495	512
PSM	IDVDTEDVGDER	1199	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7821	41.115	2	1361.5947	1361.5947	R	V	86	98
PSM	IIEVEEEQEDPYLNDR	1200	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14751	75.175	3	1989.9167	1989.9167	K	C	164	180
PSM	ITENDIQIALDDAK	1201	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18315	94.803	2	1557.7886	1557.7886	R	I	2151	2165
PSM	IYEFPETDDEEENK	1202	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12186	62.196	2	1756.7316	1756.7316	K	L	221	235
PSM	KEESEESDDDMGFGLFD	1203	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=19122	99.799	2	2044.7133	2044.7133	K	-	99	116
PSM	LCYYIGATDDAATK	1204	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=12730	64.987	2	1560.713	1560.7130	R	I	74	88
PSM	LDEDDSCSLLTK	1205	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=10558	54.241	2	1394.6235	1394.6235	K	E	693	705
PSM	LDETDDPDDYGDR	1206	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5411	29.53	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	1207	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6691	35.521	2	1524.5852	1524.5852	R	E	401	414
PSM	LEGALGADTTEDGDEK	1208	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6772	35.933	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LESIDNHSSTGGQSDQGYGSK	1209	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=5725	31.084	3	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	1210	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=3083	18.132	2	1920.715	1920.7150	K	E	672	688
PSM	LLDEEEATDNDLR	1211	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10413	53.565	2	1531.7002	1531.7002	R	A	457	470
PSM	LQQELDDATMDLEQQR	1212	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35	ms_run[2]:scan=14757	75.205	3	1947.8844	1947.8844	R	Q	1442	1458
PSM	LSEIDVSSEGVK	1213	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10244	52.777	2	1261.6402	1261.6402	R	G	177	189
PSM	MDSTANEVEAVK	1214	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=4823	26.632	2	1308.5867	1308.5867	K	V	425	437
PSM	MDTIDQDDELIR	1215	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=10870	55.76	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MDTIDQDDELIR	1216	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=12043	61.456	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MDTIDQDDELIR	1217	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=12236	62.467	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MDTIDQDDELIR	1218	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=12428	63.475	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MEVDYSATVDQR	1219	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35	ms_run[2]:scan=7203	38.094	2	1428.6191	1428.6191	K	L	16	28
PSM	NEGSESAPEGQAQQR	1220	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=927	7.3119	2	1586.6921	1586.6921	K	R	171	186
PSM	NPDDITQEEYGEFYK	1221	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15036	76.664	2	1846.7897	1846.7897	R	S	292	307
PSM	NSLQDQLDEEMEAK	1222	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16214	82.795	2	1648.725	1648.7250	R	Q	1346	1360
PSM	PSGTGTGPEDGRPSLGSPYGQPPR	1223	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21,6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=10059	51.914	2	2606.0241	2606.0241	R	F	119	143
PSM	PVTVEPMDQLDDEEGLPEK	1224	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35	ms_run[2]:scan=13092	66.749	3	2155.9831	2155.9831	R	L	132	151
PSM	QDADEEALYYTGVR	1225	sp|Q9NR99|MXRA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14608	74.433	2	1628.7318	1628.7318	R	A	409	423
PSM	QDENDDDDDWNPCK	1226	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=7636	40.243	2	1764.6169	1764.6169	K	A	188	202
PSM	QETEEELIENDYR	1227	sp|Q96M89-2|CC138_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13415	68.418	2	1666.7322	1666.7322	K	V	103	116
PSM	QIQQELEQCDVPEDVR	1228	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=13482	68.725	2	1984.916	1984.9160	K	V	216	232
PSM	QLSSSSGNTDTQADEDER	1229	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2312	14.182	3	1938.8039	1938.8039	R	A	1254	1272
PSM	QSFDDNDSEELEDKDSK	1230	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=7460	39.342	2	2079.7794	2079.7794	K	S	106	123
PSM	QSQVDFDNPDYER	1231	sp|Q9NWT6|HIF1N_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10012	51.706	2	1611.6801	1611.6801	R	F	239	252
PSM	QSYGESPQLLSPTPTEGDQDDR	1232	sp|Q6H8Q1-4|ABLM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13088	66.729	2	2419.0775	2419.0775	R	S	102	124
PSM	REVLYDSEGLSGEER	1233	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=11769	60.137	2	1897.7496	1897.7496	K	G	728	743
PSM	SCNLDEQQELVER	1234	sp|P08575-4|PTPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=9617	49.89	2	1618.7257	1618.7257	R	D	448	461
PSM	SDAPTGDVLLDEALK	1235	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18703	97.19	2	1542.7777	1542.7777	K	H	124	139
PSM	SDVLQPGAEVTTDDR	1236	sp|P53992-2|SC24C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9703	50.285	2	1601.7533	1601.7533	K	A	162	177
PSM	SEGDNYSATLLEPAASSLSPDHK	1237	sp|Q9Y2D5-5|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:21	ms_run[2]:scan=16656	85.236	2	2468.0744	2468.0744	K	N	66	89
PSM	SEIDALEMSSNDSR	1238	sp|P08183-2|MDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:35	ms_run[2]:scan=9996	51.642	2	1568.6624	1568.6624	K	S	582	596
PSM	SEVSSDEDIQFR	1239	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10346	53.247	2	1410.6263	1410.6263	K	L	665	677
PSM	SQEPIPDDQKVSDDDK	1240	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=1999	12.551	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1241	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=3920	22.257	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1242	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=5875	31.771	2	1894.7833	1894.7833	K	E	415	431
PSM	SQLDDHPESDDEENFIDANDDEDMEK	1243	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=13463	68.648	3	3147.1296	3147.1296	R	F	621	647
PSM	SQVSEEEGKEVESDK	1244	sp|P11171-7|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=4081	23.084	2	1758.7197	1758.7197	K	E	92	107
PSM	SSEEVDGQHPAQEEVPESPQTSGPEAENR	1245	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=9100	47.425	3	3199.3215	3199.3215	R	C	267	296
PSM	STSDLDKDDASYLR	1246	sp|Q8TEP8|CE192_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=10350	53.265	2	1664.6931	1664.6931	R	L	565	579
PSM	SYEDDDDMDLQPNK	1247	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9394	48.776	2	1683.657	1683.6570	R	Q	167	181
PSM	TCVADESAENCDK	1248	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1631	10.736	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	1249	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1837	11.743	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	1250	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1865	11.878	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	1251	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2577	15.53	2	1497.5712	1497.5712	K	S	76	89
PSM	TDPTTLTDEEINR	1252	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10362	53.314	2	1503.7053	1503.7053	K	F	505	518
PSM	TFMDMDQDSEDEK	1253	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2102	13.109	2	1621.576	1621.5760	K	Q	51	64
PSM	TGEEDEEEFFCNR	1254	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=13450	68.585	2	1660.6311	1660.6311	K	A	1186	1199
PSM	TIAVDFASEDIYDK	1255	sp|Q53GQ0|DHB12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17753	91.574	2	1585.7512	1585.7512	R	I	104	118
PSM	TIDDLEDEVYAQK	1256	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15192	77.448	2	1537.7148	1537.7148	K	M	252	265
PSM	TTDEELSELEDR	1257	sp|Q9BV36-5|MELPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12383	63.253	2	1435.6314	1435.6314	R	V	314	326
PSM	TTTTNTQVEGDDEAAFLER	1258	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14089	71.718	3	2096.9498	2096.9498	K	L	75	94
PSM	TVSASESEDRLVAEQETEPSK	1259	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=10072	51.967	2	2371.0428	2371.0428	K	E	184	205
PSM	VDFTEEEINNMK	1260	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=10188	52.516	2	1483.6501	1483.6501	K	T	175	187
PSM	VDIEAPDVSLEGPEGK	1261	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15897	81.128	2	1653.8097	1653.8097	K	L	1162	1178
PSM	VDSTTCLFPVEEK	1262	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4	ms_run[2]:scan=15053	76.743	2	1523.7178	1523.7178	R	A	241	254
PSM	VEESSWLIEDGK	1263	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14509	73.921	2	1390.6616	1390.6616	K	V	228	240
PSM	VLQSDEYEEVEDK	1264	sp|O15397-2|IPO8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9260	48.137	2	1581.7046	1581.7046	K	T	387	400
PSM	YDAFGEDSSSAMGVENR	1265	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:35	ms_run[2]:scan=9827	50.871	3	1849.7425	1849.7425	R	A	372	389
PSM	YPDLYPQEDEDEEEER	1266	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13539	68.993	2	2054.8229	2054.8229	K	E	101	117
PSM	YTTPEDATPEPGEDPR	1267	sp|P63092-3|GNAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7605	40.114	2	1773.7693	1773.7693	R	V	303	319
PSM	YYSPCEEHPAETNQNEGSESGTIR	1268	sp|Q12774|ARHG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8323	43.723	3	2834.1127	2834.1127	R	Q	182	206
PSM	EEKEESDDEAAVEEEEEEK	1269	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=7520	39.698251666666664	3	2332.874424	2331.863902	K	K	301	320
PSM	ETAPAETATPAPVEKSPAK	1270	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=5099	28.002828333333333	2	1973.9369	1973.9342	S	K	3	22
PSM	CTSHSETPTVDDEEK	1271	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=7454	39.312756666666665	2	1796.6495	1796.6443	R	V	671	686
PSM	EEDTSNTTFGPADLK	1272	sp|Q12830|BPTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=12143	61.94401333333333	2	1625.732628	1623.726411	R	D	297	312
PSM	GQVIIISDSDDDDDER	1273	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11300	57.850190000000005	2	1790.773113	1790.780631	R	I	1011	1027
PSM	ETTCSKESNEELTESCETK	1274	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=4666	25.84261	2	2341.886489	2340.897468	R	K	325	344
PSM	MEADKDDTQQILK	1275	sp|Q13287|NMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8263	43.41728666666666	2	1591.7402	1591.7394	-	E	1	14
PSM	LPGPPPASPIPTEGPR	1276	sp|Q9H6A9|PCX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=12194	62.23634333333334	2	1661.819604	1661.817823	R	T	1902	1918
PSM	DASDDLDDLNFFNQK	1277	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=21511	116.256155	2	1756.746160	1755.758774	K	K	65	80
PSM	VNDDVGIDWTNENDR	1278	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=14228	72.40329333333334	2	1761.749001	1760.760171	K	L	924	939
PSM	TDYNASVSVPDSSGPER	1279	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9771	50.624046666666665	2	1780.777772	1779.791136	R	I	70	87
PSM	GDVVNQDDLYQALASGK	1280	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=18762	97.55166166666667	2	1792.850497	1791.863908	R	I	246	263
PSM	DVEVKESKLSSSMNSIK	1281	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=19279	100.80134666666667	2	2042.914166	2039.888755	K	T	171	188
PSM	DGTPPEGSSKGPAHLVTSL	1282	sp|Q9HAR2|AGRL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21,9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=14987	76.40612833333333	2	2088.834460	2088.820750	K	-	1429	1448
PSM	RTITSLVSHMHGAVLFSPK	1283	sp|Q8NCM8|DYHC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35,17-UNIMOD:21	ms_run[1]:scan=22001	119.86793999999999	2	2177.096455	2176.086411	R	I	2662	2681
PSM	GTSDKNDSVSNTATEIKDEQK	1284	sp|Q5JPF3|AN36C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:21,3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=15838	80.83669499999999	3	2507.937034	2505.955071	K	S	311	332
PSM	AAEDDEDDDVDTK	1285	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1931	12.195	2	1436.5427	1436.5427	R	K	90	103
PSM	AALEDTLAETEAR	1286	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12723	64.954	2	1388.6783	1388.6783	K	F	318	331
PSM	ADEASELACPTPK	1287	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=6840	36.278	2	1387.6289	1387.6289	K	E	2194	2207
PSM	ADPDGPEAQAEACSGER	1288	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=5733	31.124	2	1758.7115	1758.7115	K	T	6	23
PSM	AEAELCAEAEETR	1289	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=7978	41.965	2	1477.6355	1477.6355	R	G	915	928
PSM	AEDNADTLALVFEAPNQEK	1290	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20175	106.84	2	2073.9855	2073.9855	R	V	92	111
PSM	AEDSLLAAEEAAAK	1291	sp|P09493-8|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13702	69.818	2	1387.6831	1387.6831	K	A	67	81
PSM	AGGEELDEGVAK	1292	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4709	26.044	2	1173.5513	1173.5513	R	D	635	647
PSM	AGTEDEEEEEEGR	1293	sp|O95456-2|PSMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1252	8.8437	2	1478.5645	1478.5645	R	R	16	29
PSM	ALDSEVDPDPEGDLGVR	1294	sp|Q6IA17|SIGIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15080	76.879	2	1782.8272	1782.8272	R	G	343	360
PSM	ASLEDAPVDDLTR	1295	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13626	69.438	2	1400.6783	1400.6783	R	K	283	296
PSM	ATDAEADVASLNR	1296	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8940	46.667	2	1331.6317	1331.6317	K	R	78	91
PSM	ATDGVTLTGINQTGDQSLPSKPSSVSSYEK	1297	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:21	ms_run[2]:scan=15680	80.013	3	3146.4656	3146.4656	K	T	320	350
PSM	AVSPPHLDGPPSPR	1298	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11245	57.602	2	1585.6691	1585.6691	K	S	516	530
PSM	CQTAEADSESDHEVPEPESEMK	1299	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,8-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=6071	32.684	3	2599.9568	2599.9568	R	M	966	988
PSM	DADDAVYELNGK	1300	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11141	57.11	2	1308.5834	1308.5834	R	E	47	59
PSM	DASTLQSQKAEGTGDAK	1301	sp|O00479|HMGN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=1599	10.584	2	1785.7782	1785.7782	R	-	74	91
PSM	DCDLQEDACYNCGR	1302	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7856	41.275	3	1774.6345	1774.6345	K	G	49	63
PSM	DDGSTLMEIDGDK	1303	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12566	64.141	2	1394.5871	1394.5871	R	G	6	19
PSM	DDMIFEDCGDVPSEPK	1304	sp|P05026-2|AT1B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=13737	70.007	2	1868.7444	1868.7444	R	E	119	135
PSM	DDSSIFDGLVEEDDKDK	1305	sp|O15516|CLOCK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=18487	95.844	2	2005.8041	2005.8041	R	A	17	34
PSM	DEDFSPDGGYIPR	1306	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13998	71.284	2	1466.6314	1466.6314	K	I	102	115
PSM	DEENTANSFLNYR	1307	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15339	78.228	2	1571.6852	1571.6852	R	I	368	381
PSM	DESASETSTPSEHSAAPSPQVEVR	1308	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=8372	43.962	3	2577.0868	2577.0868	R	T	147	171
PSM	DFQDYMEPEEGCQGSPQR	1309	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9423	48.936	3	2187.8473	2187.8473	K	R	103	121
PSM	DHSPTPSVFNSDEER	1310	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=9874	51.086	2	1795.705	1795.7050	R	Y	416	431
PSM	DLLIAYYDVDYEK	1311	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20715	110.56	2	1618.7767	1618.7767	K	N	259	272
PSM	DLQEQDADAGSER	1312	sp|Q6P158-3|DHX57_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2934	17.418	2	1432.6066	1432.6066	R	G	15	28
PSM	DLQGAMDDLDADMK	1313	sp|P46939-2|UTRO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:35	ms_run[2]:scan=15534	79.26	2	1552.6385	1552.6385	R	E	2700	2714
PSM	DPAAPEPEEQEER	1314	sp|Q969T4|UB2E3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3785	21.636	2	1495.6427	1495.6427	R	K	26	39
PSM	DPDAQPGGELMLGGTDSK	1315	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35	ms_run[2]:scan=8999	46.932	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPTGMDPDDIWQLSSSLK	1316	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35	ms_run[2]:scan=20888	111.77	2	2019.9095	2019.9095	K	R	147	165
PSM	DPVQEAWAEDVDLR	1317	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18807	97.804	2	1641.7635	1641.7635	K	V	461	475
PSM	DSDDYAQLCNIPVTGR	1318	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:4	ms_run[2]:scan=15390	78.475	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSSDSADGRATPSENLVPSSAR	1319	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=9054	47.207	2	2297.9761	2297.9761	R	V	184	206
PSM	DTDDVPMILVGNK	1320	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=14347	73.04	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1321	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=16994	87.2	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1322	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=17810	91.912	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1323	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=18846	98.066	2	1431.6915	1431.6915	K	C	86	99
PSM	DYDEEEQGYDSEKEK	1324	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=4508	25.129	2	1942.6993	1942.6993	R	K	423	438
PSM	DYSTLTSVSSHDSR	1325	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=8407	44.118	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EDAGDNDDTEGAIGVR	1326	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6445	34.412	2	1632.6863	1632.6863	R	N	377	393
PSM	EDDLNSFNATDLK	1327	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13139	66.987	2	1480.6682	1480.6682	K	D	457	470
PSM	EDDLNSFNATDLK	1328	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14487	73.811	2	1480.6682	1480.6682	K	D	457	470
PSM	EDDVGTGAGLLEIK	1329	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16332	83.458	2	1415.7144	1415.7144	R	K	302	316
PSM	EDEIATMECINNGK	1330	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6293	33.681	2	1638.6865	1638.6865	R	S	18	32
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	1331	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=9166	47.731	3	3001.2673	3001.2673	R	E	120	150
PSM	EEAQSLEDLAGFK	1332	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17702	91.299	2	1435.6831	1435.6831	K	E	734	747
PSM	EEEAIQLDGLNASQIR	1333	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17006	87.277	3	1784.8905	1784.8905	R	E	52	68
PSM	EEFAIMQTPAGELYDK	1334	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35	ms_run[2]:scan=16603	84.947	2	1856.8502	1856.8502	R	S	761	777
PSM	EEPLSEEEPCTSTAIASPEKK	1335	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=10569	54.303	2	2411.0451	2411.0451	K	K	498	519
PSM	EFDEDSDEKEEEEDTYEK	1336	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=8499	44.558	2	2344.8268	2344.8268	R	V	619	637
PSM	EGEEPTVYSDEEEPKDESAR	1337	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=8684	45.464	3	2374.9326	2374.9326	K	K	121	141
PSM	EGGAGAVDEDDFIK	1338	sp|O75122-2|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12548	64.066	2	1421.6311	1421.6311	K	A	65	79
PSM	EGMNPSYDEYADSDEDQHDAYLER	1339	sp|Q08945|SSRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=12560	64.117	3	2944.0655	2944.0655	K	M	432	456
PSM	EIEMSVDDDDINSSK	1340	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35	ms_run[2]:scan=6895	36.54	2	1711.7094	1711.7094	R	V	512	527
PSM	EISDDEAEEEKGEK	1341	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=1350	9.302	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	1342	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=2545	15.376	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	1343	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=2736	16.383	2	1686.6509	1686.6509	K	E	224	238
PSM	ELEAAQEQLAELK	1344	sp|Q96CN9|GCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14754	75.186	2	1470.7566	1470.7566	K	E	516	529
PSM	ELMDEEDVLQECK	1345	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=14771	75.269	2	1636.696	1636.6960	K	A	26	39
PSM	EMEEELVPTGSEPGDTR	1346	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35	ms_run[2]:scan=9857	51.001	2	1890.8153	1890.8153	R	A	19	36
PSM	EQSHAEISPPAESGQAVEECK	1347	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=8645	45.286	3	2361.9784	2361.9784	R	E	141	162
PSM	ESEDKPEIEDVGSDEEEEK	1348	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=5930	32.013	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	1349	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=6955	36.852	2	2271.8792	2271.8792	K	K	251	270
PSM	ESLELEDPSSGLGVTK	1350	sp|P04233-2|HG2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15336	78.213	2	1659.8203	1659.8203	K	Q	209	225
PSM	ESQHIPTAEGASGSNTEEEIR	1351	sp|Q63ZY3-3|KANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=9243	48.063	2	2320.9809	2320.9809	R	M	567	588
PSM	ESSETPDQFMTADETR	1352	sp|P16070-18|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:35	ms_run[2]:scan=7791	40.996	2	1858.7527	1858.7527	K	N	314	330
PSM	ETNISYSQEADDR	1353	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5624	30.523	2	1526.6485	1526.6485	K	V	170	183
PSM	ETNLDSLPLVDTHSK	1354	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=16323	83.418	2	1747.803	1747.8030	R	R	425	440
PSM	ETTCSKESNEELTESCETK	1355	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4205	23.683	2	2340.8975	2340.8975	R	K	289	308
PSM	EVLDEDTDEEKETLK	1356	sp|Q9Y3P9|RBGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=9128	47.562	2	1871.7925	1871.7925	K	N	990	1005
PSM	EYQACGPAEEPTCK	1357	sp|Q02817|MUC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4573	25.413	2	1638.6654	1638.6654	R	S	4767	4781
PSM	GDDGIFDDNFIEER	1358	sp|O60493-2|SNX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19720	103.79	2	1640.6954	1640.6954	R	K	73	87
PSM	GDSESEEDEDLEVPVPSR	1359	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12954	66.047	2	1987.8494	1987.8494	K	F	76	94
PSM	GGTMTDLDEQEDESMETTGKDEDENSTGNK	1360	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,14-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=5324	29.127	3	3374.2447	3374.2447	K	G	374	404
PSM	GLSEDTTEETLK	1361	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7805	41.051	2	1321.6249	1321.6249	K	E	578	590
PSM	GNAEGSSDEEGKLVIDEPAK	1362	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=10214	52.631	3	2123.926	2123.9260	K	E	120	140
PSM	GTSTQGTSTHASSTQLAMVDDQR	1363	sp|Q9NPG1|FZD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=7167	37.908	3	2474.0381	2474.0381	R	S	550	573
PSM	GVEEEEEDGEMRE	1364	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5044	27.757	2	1536.5886	1536.5886	R	-	74	87
PSM	IDEDNLTCLEDLCK	1365	sp|Q92851-7|CASPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=18117	93.655	2	1736.7597	1736.7597	K	T	162	176
PSM	IDENSDKEMEVEESPEK	1366	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4407	24.625	3	2102.8239	2102.8239	K	I	495	512
PSM	IEDVGSDEEDDSGKDK	1367	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=1094	8.0821	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1368	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=1936	12.223	2	1816.6888	1816.6888	K	K	250	266
PSM	ITEIYEGTSEIQR	1369	sp|P16219|ACADS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11459	58.617	2	1537.7624	1537.7624	R	L	387	400
PSM	LDDAIEDCTNAVK	1370	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=9816	50.818	2	1462.661	1462.6610	K	L	254	267
PSM	LDETDDPDDYGDR	1371	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6004	32.381	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	1372	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6443	34.405	2	1524.5852	1524.5852	R	E	401	414
PSM	LECSEELGDLVK	1373	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=15087	76.909	2	1390.665	1390.6650	K	S	457	469
PSM	LEQLECLDDAEK	1374	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=12479	63.726	2	1461.6657	1461.6657	R	K	294	306
PSM	LFEESDDKEDEDADGK	1375	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=6851	36.33	3	1920.715	1920.7150	K	E	672	688
PSM	LGMSADPDNEDATDK	1376	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35	ms_run[2]:scan=2606	15.663	2	1593.6464	1593.6464	R	V	335	350
PSM	LLDEEEATDNDLR	1377	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9793	50.713	2	1531.7002	1531.7002	R	A	457	470
PSM	MDTIDQDDELIR	1378	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=11622	59.43	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	NEEPSEEEIDAPKPK	1379	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=6354	33.99	2	1790.7612	1790.7612	K	K	117	132
PSM	NEGVVGGEDYEEVDR	1380	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9781	50.664	2	1665.7118	1665.7118	R	Y	297	312
PSM	NPDDITNEEYGEFYK	1381	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14682	74.809	2	1832.7741	1832.7741	R	S	300	315
PSM	NSVVEASEAAYK	1382	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8133	42.79	2	1266.6092	1266.6092	K	E	144	156
PSM	PVTVEPMDQLDDEEGLPEK	1383	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:35	ms_run[2]:scan=13694	69.781	3	2155.9831	2155.9831	R	L	132	151
PSM	QAIPLDENEGIYVQDVK	1384	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16643	85.159	2	1929.9684	1929.9684	R	T	378	395
PSM	QCADLPEEDEELR	1385	sp|Q9P253|VPS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4	ms_run[2]:scan=10490	53.929	2	1602.6832	1602.6832	K	K	740	753
PSM	QMEVQLEEEYEDK	1386	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:35	ms_run[2]:scan=10483	53.896	2	1684.7138	1684.7138	K	Q	1573	1586
PSM	QSGEAFVELGSEDDVK	1387	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14544	74.108	2	1708.7792	1708.7792	R	M	53	69
PSM	QVCGDSIKPEETEQEVAADETR	1388	sp|Q96GM8-2|TOE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=12037	61.424	3	2570.0844	2570.0844	K	N	289	311
PSM	SDDEVDDPAVELK	1389	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10857	55.696	2	1430.6413	1430.6413	K	Q	741	754
PSM	SEAEDEDDEDYVPYVPLR	1390	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18068	93.368	2	2139.912	2139.9120	R	Q	23	41
PSM	SEILDESDMYTDNR	1391	sp|Q6P4Q7|CNNM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:35	ms_run[2]:scan=10716	54.995	2	1702.6992	1702.6992	K	S	506	520
PSM	SELEEQLTPVAEETR	1392	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13809	70.362	2	1729.837	1729.8370	K	A	94	109
PSM	SETAPAETATPAPVEKSPAK	1393	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:21	ms_run[2]:scan=6294	33.685	2	2060.9667	2060.9667	M	K	2	22
PSM	SFSKEELMSSDLEETAGSTSIPK	1394	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=15888	81.082	3	2568.119	2568.1190	K	R	511	534
PSM	SGAEVEAGDAAER	1395	sp|Q8IY67-3|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2570	15.501	2	1260.5582	1260.5582	K	R	17	30
PSM	SGELQGGPDDNLIEGGGTK	1396	sp|Q96A65|EXOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11628	59.455	2	1842.8595	1842.8595	R	F	468	487
PSM	SISVPPSPSDIPPPGPPR	1397	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=15005	76.5	2	1875.9132	1875.9132	R	V	137	155
PSM	SPGLVPPSPEFAPR	1398	sp|Q9H5H4|ZN768_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=16069	81.992	2	1529.7279	1529.7279	R	S	90	104
PSM	SQEPIPDDQKVSDDDK	1399	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=4149	23.411	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	1400	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=5219	28.594	2	1894.7833	1894.7833	K	E	415	431
PSM	SQQQDDIEELETK	1401	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10690	54.878	2	1561.7108	1561.7108	R	A	198	211
PSM	SRTSVQTEDDQLIAGQSAR	1402	sp|P26232-3|CTNA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9875	51.09	3	2220.9413	2220.9413	R	A	651	670
PSM	STSPTSDSISSSSSSADDHYEFATK	1403	sp|O00409-2|FOXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=11108	56.961	3	2673.0603	2673.0603	R	G	325	350
PSM	SVSEINSDDELSGK	1404	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7822	41.118	2	1478.6736	1478.6736	R	G	338	352
PSM	SVTNEDVTQEELGGAK	1405	sp|P05166|PCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8908	46.517	2	1675.7901	1675.7901	K	T	233	249
PSM	SYNPFDDDGEDEGAR	1406	sp|O95721|SNP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11484	58.751	2	1685.6441	1685.6441	K	P	7	22
PSM	TCVADESAENCDK	1407	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=3141	18.42	2	1497.5712	1497.5712	K	S	76	89
PSM	TEGDGVYTLNDK	1408	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7785	40.97	2	1310.599	1310.5990	R	K	60	72
PSM	TELEDTLDSTAAQQELR	1409	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15915	81.222	3	1918.912	1918.9120	K	S	1146	1163
PSM	TFMDMDQDSEEEK	1410	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2565	15.479	2	1635.5916	1635.5916	K	E	41	54
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	1411	sp|Q15637-5|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=16337	83.484	3	2925.2471	2925.2471	R	R	192	218
PSM	TGSTPSIASTHSELSTYSNNSGNAAVIK	1412	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=14717	75.011	3	2873.308	2873.3080	R	Y	797	825
PSM	TITLEVEPSDTIENVK	1413	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16932	86.851	2	1786.92	1786.9200	K	A	12	28
PSM	TLNAETPKSSPLPAK	1414	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6688	35.506	2	1712.7787	1712.7787	R	G	208	223
PSM	TLTTVQGIADDYDK	1415	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14615	74.468	2	1538.7464	1538.7464	K	K	43	57
PSM	TRSPSPDDILER	1416	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=11710	59.859	2	1544.6273	1544.6273	R	V	576	588
PSM	TSDIFEADIANDVK	1417	sp|O94763-2|RMP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17729	91.437	2	1536.7308	1536.7308	K	S	111	125
PSM	TSDIFEADIANDVK	1418	sp|O94763-2|RMP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17737	91.488	2	1536.7308	1536.7308	K	S	111	125
PSM	TVSASESEDRLVAEQETEPSK	1419	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=10060	51.917	3	2371.0428	2371.0428	K	E	184	205
PSM	VASETHSEGSEYEELPK	1420	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=9602	49.821	2	1970.8146	1970.8146	R	R	1130	1147
PSM	VAVGELTDEDVK	1421	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10618	54.562	2	1273.6402	1273.6402	K	M	451	463
PSM	VDINTEDLEDGTCR	1422	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=10985	56.351	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VDNSSLTGESEPQTR	1423	sp|P50993|AT1A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4858	26.812	2	1618.7435	1618.7435	K	S	211	226
PSM	VEEEAAPSIFDEPLER	1424	sp|P29536-2|LMOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18376	95.154	2	1829.8683	1829.8683	K	V	281	297
PSM	VETVSQPSESPKDTIDK	1425	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=6575	35.003	2	1938.8823	1938.8823	K	T	452	469
PSM	VFDDESDEKEDEEYADEK	1426	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=10082	52.013	3	2270.8264	2270.8264	K	G	637	655
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	1427	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=9719	50.366	3	2835.1244	2835.1244	K	A	213	238
PSM	VTPDIEESLLEPENEK	1428	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17838	92.067	2	1840.8942	1840.8942	K	I	200	216
PSM	VTVDTGVIPASEEK	1429	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10715	54.992	2	1443.7457	1443.7457	K	A	285	299
PSM	VVSPTKEQVSDTEDK	1430	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=3868	22.016	2	1740.7819	1740.7819	R	Q	451	466
PSM	VYDEEVEEPVLK	1431	sp|Q9Y4E1-3|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12317	62.909	2	1447.7082	1447.7082	R	A	44	56
PSM	YLEEDNSDESDAEGEHGDGAEEEAPPAGPR	1432	sp|Q9H1C4|UN93B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=9193	47.857	3	3251.2324	3251.2324	R	P	541	571
PSM	MDVNVGDIDIEGPEGK	1433	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35	ms_run[1]:scan=15456	78.81717833333333	2	1702.773051	1702.771981	K	L	1620	1636
PSM	EISDDEAEEEKGEK	1434	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:27,3-UNIMOD:21	ms_run[1]:scan=2651	15.918920000000002	2	1668.6355	1668.6398	K	E	224	238
PSM	NPDDITNEEYGEFYK	1435	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=15725	80.25458	2	1833.766904	1832.774089	R	S	300	315
PSM	SSDSDESYGEGCIALR	1436	sp|Q92835|SHIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:4	ms_run[1]:scan=11612	59.38143	2	1744.723289	1744.721008	K	L	808	824
PSM	TGIEQGSDAGYLCESQK	1437	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:4	ms_run[1]:scan=9970	51.52146166666667	2	1842.827008	1841.810158	K	F	310	327
PSM	SETAPAETATPAPVEKSPAK	1438	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5956	32.132306666666665	2	2102.9800	2102.9768	M	K	2	22
PSM	CTSHSETPTVDDEEK	1439	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=7443	39.258113333333334	2	1796.6495	1796.6443	R	V	671	686
PSM	DTDDVPMILVGNK	1440	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:35	ms_run[1]:scan=17167	88.2107	2	1431.701394	1431.691546	K	C	105	118
PSM	SQGDSNPAAIPHAAEDIQGDDR	1441	sp|P68402|PA1B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=12512	63.905683333333336	3	2305.0230	2305.0202	M	W	2	24
PSM	CDSSPDSAEDVR	1442	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4	ms_run[1]:scan=2261	13.918465	2	1336.520406	1336.520124	K	K	132	144
PSM	QDDSPPRPIIGPALPPGFIK	1443	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=22143	120.87784333333333	2	2177.0957	2177.0917	K	S	102	122
PSM	LESIDNHSSTGGQSDQGYGSK	1444	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=6193	33.23450666666667	3	2246.902687	2245.912465	R	D	951	972
PSM	QASTDAGTAGALTPQHVR	1445	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=9970	51.52146166666667	2	1842.8265	1842.8256	R	A	107	125
PSM	SISVPPSPSDIPPPGPPR	1446	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=14781	75.31709833333333	2	1876.919867	1875.913180	R	V	563	581
PSM	MDTIDQDDELIR	1447	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35	ms_run[1]:scan=12659	64.62195666666666	2	1480.664483	1478.655889	R	Y	1956	1968
PSM	VDGIPNDSSDSEMEDK	1448	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:35	ms_run[1]:scan=5481	29.850488333333335	2	1753.697899	1752.699604	R	T	1082	1098
PSM	NPGSVAENNLCSQYEEK	1449	sp|P20591|MX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:4	ms_run[1]:scan=9067	47.27100333333333	2	1938.827918	1937.842520	K	V	32	49
PSM	IEENSLKEEESIEGEK	1450	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=9198	47.879623333333335	2	1942.832564	1941.845614	K	E	1566	1582
PSM	SLDEADSENKEEVSPLGSK	1451	sp|Q6ZV73|FGD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=9735	50.453765000000004	3	2112.913052	2112.910005	R	A	1197	1216
PSM	SFSSGSALNRHQRIHTGEK	1452	sp|Q14585|ZN345_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=14678	74.78974833333332	2	2271.008045	2270.994709	K	P	406	425
PSM	IEETTMTTQTPACPSCSR	1453	sp|Q14624-2|ITIH4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,6-UNIMOD:35,7-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=8376	43.98121	2	2324.796128	2324.780284	K	S	686	704
PSM	NIYTPPDSSTSFIQDYSR	1454	sp|Q9UKZ4|TEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=10225	52.68888166666667	2	2332.849805	2329.858258	R	D	1935	1953
PSM	SRSSCAREAYPVECAVPTK	1455	sp|A2RRH5|WDR27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=6464	34.499718333333334	3	2406.926778	2406.914016	R	P	484	503
PSM	SDGSAPSTSTASSKLKSPSQK	1456	sp|Q96T37|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=9747	50.50603666666667	3	2452.843526	2449.849497	R	Q	749	770
	2	1876.919867	1875.913180	R	V	563	581
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	1436	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=16337	83.48403666666667	3	2925.250555	2925.247080	R	R	67	93
PSM	YLEEDNSDESDAEGEHGDGAEEEAPPAGPR	1437	sp|Q9H1C4|UN93B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=9193	47.856970000000004	3	3251.225212	3251.232415	R	P	541	571
PSM	QCADLPEEDEELR	1438	sp|Q9P253|VPS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:4	ms_run[1]:scan=10490	53.92922166666667	2	1602.684946	1602.683166	K	K	740	753
PSM	TGSTPSIASTHSELSTYSNNSGNAAVIK	1439	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=14717	75.011395	3	2873.308259	2873.308027	R	Y	797	825
PSM	DSSDSADGRATPSENLVPSSAR	1440	sp|Q8N684|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=9054	47.20729	2	2297.978969	2297.976128	R	V	193	215
PSM	NEGVVGGEDYEEVDR	1441	sp|Q86UK7|ZN598_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=9781	50.66434666666667	2	1665.715705	1665.711824	R	Y	297	312
PSM	TLNAETPKSSPLPAK	1442	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=6688	35.505993333333336	2	1712.779406	1712.778735	R	G	208	223
PSM	EVLDEDTDEEKETLK	1443	sp|Q9Y3P9|RBGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=9128	47.56176833333333	2	1871.796804	1871.792516	K	N	990	1005
PSM	SYNPFDDDGEDEGAR	1444	sp|O95721|SNP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=11484	58.751281666666664	2	1685.646046	1685.644138	K	P	7	22
PSM	QVCGDSIKPEETEQEVAADETR	1445	sp|Q96GM8|TOE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=12037	61.42411333333333	3	2570.089549	2570.084358	K	N	369	391
PSM	SPGLVPPSPEFAPR	1446	sp|Q9H5H4|ZN768_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=16069	81.99175666666666	2	1529.729620	1529.727946	R	S	90	104
PSM	STSPTSDSISSSSSSADDHYEFATK	1447	sp|O00409|FOXN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=11108	56.9613	3	2673.064191	2673.060311	R	G	347	372
PSM	MDTIDQDDELIR	1448	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35	ms_run[1]:scan=12659	64.62195666666666	2	1480.664483	1478.655889	R	Y	1956	1968
PSM	TRSPSPDDILER	1449	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=11710	59.85918666666667	2	1544.629876	1544.627319	R	V	576	588
PSM	QMEVQLEEEYEDK	1450	sp|Q92614|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:35	ms_run[1]:scan=10483	53.896	2	1684.714473	1684.713798	K	Q	1610	1623
PSM	EISDDEAEEEKGEK	1451	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1350	9.302035	2	1686.652671	1686.650937	K	E	203	217
PSM	EISDDEAEEEKGEK	1452	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=2545	15.375803333333332	2	1686.652686	1686.650937	K	E	203	217
PSM	EISDDEAEEEKGEK	1453	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=2736	16.383383333333335	2	1686.652686	1686.650937	K	E	203	217
PSM	VVSPTKEQVSDTEDK	1454	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=3868	22.015723333333334	2	1740.783138	1740.781891	R	Q	451	466
PSM	VDGIPNDSSDSEMEDK	1455	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:35	ms_run[1]:scan=5481	29.850488333333335	2	1753.697899	1752.699604	R	T	1082	1098
PSM	DASTLQSQKAEGTGDAK	1456	sp|O00479|HMGN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1599	10.584003333333333	2	1785.779959	1785.778203	R	-	74	91
PSM	NPGSVAENNLCSQYEEK	1457	sp|P20591|MX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:4	ms_run[1]:scan=9067	47.27100333333333	2	1938.827918	1937.842520	K	V	32	49
PSM	DYDEEEQGYDSEKEK	1458	sp|Q05519|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=4508	25.128856666666668	2	1942.699380	1942.699344	R	K	424	439
PSM	IEENSLKEEESIEGEK	1459	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=9198	47.879623333333335	2	1942.832564	1941.845614	K	E	1566	1582
PSM	VASETHSEGSEYEELPK	1460	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=9602	49.82133666666667	2	1970.817241	1970.814648	R	R	1130	1147
PSM	QSEDDDSETEKPEADDPK	1461	sp|Q9UHR5|S30BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1743	11.288425	2	2113.787653	2113.784864	R	D	71	89
PSM	SLDEADSENKEEVSPLGSK	1462	sp|Q6ZV73|FGD6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=9735	50.453765000000004	3	2112.913052	2112.910005	R	A	1197	1216
PSM	SFSSGSALNRHQRIHTGEK	1463	sp|Q14585|ZN345_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=14678	74.78974833333332	2	2271.008045	2270.994709	K	P	406	425
PSM	IEETTMTTQTPACPSCSR	1464	sp|Q14624-2|ITIH4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,6-UNIMOD:35,7-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=8376	43.98121	2	2324.796128	2324.780284	K	S	686	704
PSM	NIYTPPDSSTSFIQDYSR	1465	sp|Q9UKZ4|TEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=10225	52.68888166666667	2	2332.849805	2329.858258	R	D	1935	1953
PSM	SRSSCAREAYPVECAVPTK	1466	sp|A2RRH5|WDR27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=6464	34.499718333333334	3	2406.926778	2406.914016	R	P	484	503
PSM	SDGSAPSTSTASSKLKSPSQK	1467	sp|Q96T37|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=9747	50.50603666666667	3	2452.843526	2449.849497	R	Q	749	770