MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr06.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr06.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0	null	1384-UNIMOD:21,1389-UNIMOD:4,632-UNIMOD:21	0.02	59.0	3	2	1
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	417-UNIMOD:21,416-UNIMOD:21	0.05	55.0	3	1	0
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	118-UNIMOD:21,96-UNIMOD:21,104-UNIMOD:4	0.16	52.0	2	2	2
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	62-UNIMOD:21,72-UNIMOD:35	0.05	51.0	2	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null		0.11	50.0	1	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	129-UNIMOD:21	0.29	49.0	9	2	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	null	145-UNIMOD:28,160-UNIMOD:21,155-UNIMOD:21	0.07	49.0	4	1	0
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	38-UNIMOD:21	0.14	48.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	377-UNIMOD:35	0.10	47.0	2	2	2
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	49-UNIMOD:21	0.06	47.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.06	47.0	8	2	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	846-UNIMOD:21	0.03	47.0	1	1	1
PRT	sp|Q96HP0|DOCK6_HUMAN	Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	878-UNIMOD:21	0.01	47.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	585-UNIMOD:21	0.03	47.0	2	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.03	47.0	2	2	2
PRT	sp|Q14376-2|GALE_HUMAN	Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.07	46.0	2	1	0
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	17-UNIMOD:21	0.07	46.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	3792-UNIMOD:21,3794-UNIMOD:35	0.01	46.0	1	1	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	854-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|O15056-3|SYNJ2_HUMAN	Isoform 2A of Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1122-UNIMOD:21,1124-UNIMOD:21	0.02	46.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	5749-UNIMOD:21,5739-UNIMOD:21,4486-UNIMOD:21,1833-UNIMOD:4	0.03	46.0	9	8	7
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	30-UNIMOD:21,37-UNIMOD:35	0.04	46.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	615-UNIMOD:21	0.01	46.0	3	1	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	72-UNIMOD:21,74-UNIMOD:21	0.01	46.0	2	1	0
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	92-UNIMOD:35,2-UNIMOD:1	0.17	46.0	4	2	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	552-UNIMOD:28,554-UNIMOD:21	0.03	46.0	7	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	220-UNIMOD:21,243-UNIMOD:4	0.02	46.0	1	1	1
PRT	sp|O94979-3|SC31A_HUMAN	Isoform 3 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	527-UNIMOD:21	0.02	45.0	2	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.05	45.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	153-UNIMOD:21,175-UNIMOD:35,145-UNIMOD:21	0.07	45.0	4	2	1
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	817-UNIMOD:21	0.02	45.0	2	1	0
PRT	sp|Q6P6C2-3|ALKB5_HUMAN	Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	360-UNIMOD:21,367-UNIMOD:4	0.05	45.0	1	1	1
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	395-UNIMOD:21,402-UNIMOD:4	0.01	45.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	60-UNIMOD:35,64-UNIMOD:21	0.04	45.0	2	1	0
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	56-UNIMOD:21,58-UNIMOD:21	0.06	45.0	2	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	45.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	53-UNIMOD:35,59-UNIMOD:21	0.04	45.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	942-UNIMOD:21	0.03	44.0	3	2	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	1	1	1
PRT	sp|Q9H841-2|NPAL2_HUMAN	Isoform 2 of NIPA-like protein 2 OS=Homo sapiens OX=9606 GN=NIPAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	360-UNIMOD:21,362-UNIMOD:21	0.06	44.0	2	1	0
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1202-UNIMOD:21,1211-UNIMOD:4	0.01	44.0	1	1	1
PRT	sp|P24821-6|TENA_HUMAN	Isoform 6 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	64-UNIMOD:4,392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4	0.02	44.0	2	2	2
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	41-UNIMOD:35,57-UNIMOD:4	0.06	44.0	2	2	2
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	490-UNIMOD:21,240-UNIMOD:21	0.03	44.0	6	3	2
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	491-UNIMOD:28	0.03	44.0	4	1	0
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	331-UNIMOD:21	0.07	44.0	1	1	1
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	178-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	622-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35,626-UNIMOD:21	0.02	44.0	5	1	0
PRT	sp|Q9UPN6|SCAF8_HUMAN	SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	617-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.07	44.0	2	2	2
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.12	44.0	3	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	383-UNIMOD:35	0.03	44.0	2	1	0
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	207-UNIMOD:21	0.07	43.0	2	1	0
PRT	sp|Q8IVF2|AHNK2_HUMAN	Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	294-UNIMOD:21	0.00	43.0	1	1	1
PRT	sp|Q96EV2-2|RBM33_HUMAN	Isoform 2 of RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	205-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	463-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	45-UNIMOD:21	0.18	43.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.11	43.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	627-UNIMOD:21,631-UNIMOD:21	0.03	43.0	2	1	0
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	190-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	872-UNIMOD:21,870-UNIMOD:21	0.02	43.0	7	1	0
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1062-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	1	0
PRT	sp|Q86U38-2|NOP9_HUMAN	Isoform 2 of Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	2	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	324-UNIMOD:21,334-UNIMOD:4,320-UNIMOD:35,322-UNIMOD:21,325-UNIMOD:21	0.07	43.0	5	1	0
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	3	1	0
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|O60716-32|CTND1_HUMAN	Isoform 4 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	530-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	375-UNIMOD:21,378-UNIMOD:35	0.03	43.0	2	1	0
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	56-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q8NF50-4|DOCK8_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	833-UNIMOD:35,836-UNIMOD:21	0.01	43.0	2	1	0
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	15-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	345-UNIMOD:28,346-UNIMOD:21,348-UNIMOD:21,613-UNIMOD:4,614-UNIMOD:21,618-UNIMOD:35	0.03	43.0	4	2	1
PRT	sp|Q9H0E3-3|SP130_HUMAN	Isoform 3 of Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	300-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	460-UNIMOD:21,456-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	246-UNIMOD:35	0.05	42.0	4	2	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	518-UNIMOD:35,519-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null		0.01	42.0	2	1	0
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	364-UNIMOD:35,365-UNIMOD:35	0.02	42.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	45-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	134-UNIMOD:21,133-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|P23229-7|ITA6_HUMAN	Isoform 7 of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	53-UNIMOD:35,61-UNIMOD:4	0.02	42.0	1	1	1
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	228-UNIMOD:21	0.05	42.0	3	2	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	493-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|Q9NS73-3|MBIP1_HUMAN	Isoform 3 of MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	91-UNIMOD:21	0.07	42.0	2	1	0
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	360-UNIMOD:35,361-UNIMOD:35	0.02	42.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	85-UNIMOD:21	0.19	42.0	1	1	1
PRT	sp|O75044|SRGP2_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	852-UNIMOD:21,873-UNIMOD:4	0.02	42.0	1	1	1
PRT	sp|Q8IY57-3|YAF2_HUMAN	Isoform 3 of YY1-associated factor 2 OS=Homo sapiens OX=9606 GN=YAF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	107-UNIMOD:21	0.19	42.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	821-UNIMOD:21,819-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	5-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	0.07	42.0	7	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	766-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|P01008|ANT3_HUMAN	Antithrombin-III OS=Homo sapiens OX=9606 GN=SERPINC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	68-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	350-UNIMOD:21,48-UNIMOD:21,348-UNIMOD:21	0.10	41.0	4	2	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.03	41.0	3	3	3
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	2251-UNIMOD:21,2246-UNIMOD:21,2807-UNIMOD:21,2813-UNIMOD:35,2008-UNIMOD:21,2019-UNIMOD:35,2250-UNIMOD:21,2231-UNIMOD:27	0.02	41.0	12	3	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.10	41.0	1	1	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	917-UNIMOD:21,915-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	132-UNIMOD:21	0.17	41.0	3	2	1
PRT	sp|P12532|KCRU_HUMAN	Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	155-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	36-UNIMOD:21	0.10	41.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	60-UNIMOD:21	0.10	41.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	801-UNIMOD:4,802-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	480-UNIMOD:21	0.00	41.0	2	1	0
PRT	sp|Q9Y485|DMXL1_HUMAN	DmX-like protein 1 OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	918-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q92574|TSC1_HUMAN	Hamartin OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1100-UNIMOD:21,1104-UNIMOD:4,1109-UNIMOD:35	0.02	41.0	1	1	1
PRT	sp|Q96NY7-2|CLIC6_HUMAN	Isoform A of Chloride intracellular channel protein 6 OS=Homo sapiens OX=9606 GN=CLIC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	293-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1274-UNIMOD:35	0.01	41.0	2	1	0
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	659-UNIMOD:21	0.02	41.0	5	1	0
PRT	sp|Q8IV36-3|HID1_HUMAN	Isoform 3 of Protein HID1 OS=Homo sapiens OX=9606 GN=HID1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	412-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	14-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	191-UNIMOD:4,199-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9NWS9-2|ZN446_HUMAN	Isoform 2 of Zinc finger protein 446 OS=Homo sapiens OX=9606 GN=ZNF446	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	137-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	479-UNIMOD:21,499-UNIMOD:21,503-UNIMOD:35	0.04	41.0	5	2	1
PRT	sp|O95251-4|KAT7_HUMAN	Isoform 4 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	135-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q9UJU6-6|DBNL_HUMAN	Isoform 6 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	53-UNIMOD:35	0.05	41.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1106-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P51784|UBP11_HUMAN	Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	648-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,25-UNIMOD:21	0.07	41.0	2	2	2
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	260-UNIMOD:21	0.06	41.0	3	1	0
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	939-UNIMOD:21,951-UNIMOD:35	0.02	40.0	3	1	0
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|Q9NQV6-6|PRD10_HUMAN	Isoform 6 of PR domain zinc finger protein 10 OS=Homo sapiens OX=9606 GN=PRDM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1097-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	670-UNIMOD:4,679-UNIMOD:21,686-UNIMOD:4,677-UNIMOD:21,400-UNIMOD:4,401-UNIMOD:35,415-UNIMOD:21	0.06	40.0	5	2	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	106-UNIMOD:21	0.10	40.0	2	1	0
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	13-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	66-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1226-UNIMOD:35,1232-UNIMOD:4,1237-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q0ZGT2-4|NEXN_HUMAN	Isoform 4 of Nexilin OS=Homo sapiens OX=9606 GN=NEXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	13-UNIMOD:35,16-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	220-UNIMOD:21,216-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	168-UNIMOD:21,20-UNIMOD:35	0.19	40.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	2	2	2
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	592-UNIMOD:21,388-UNIMOD:21	0.07	40.0	3	2	1
PRT	sp|Q5T8I3-2|F102B_HUMAN	Isoform 2 of Protein FAM102B OS=Homo sapiens OX=9606 GN=FAM102B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	276-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	255-UNIMOD:21,226-UNIMOD:21	0.06	40.0	32	3	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1305-UNIMOD:21,1311-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q9C0E8-2|LNP_HUMAN	Isoform 2 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	379-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	768-UNIMOD:21,781-UNIMOD:21	0.01	40.0	3	2	1
PRT	sp|Q66K14-2|TBC9B_HUMAN	Isoform 2 of TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	411-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	109-UNIMOD:35,102-UNIMOD:21,105-UNIMOD:21	0.28	40.0	9	2	0
PRT	sp|Q01484-7|ANK2_HUMAN	Isoform 5 of Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	412-UNIMOD:21,426-UNIMOD:4,355-UNIMOD:35,364-UNIMOD:21	0.08	40.0	2	2	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1671-UNIMOD:21	0.00	40.0	1	1	1
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	73-UNIMOD:21	0.22	40.0	2	2	2
PRT	sp|Q8NFA0|UBP32_HUMAN	Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1583-UNIMOD:35,1588-UNIMOD:21,1589-UNIMOD:35	0.01	40.0	2	1	0
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	315-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q92766-4|RREB1_HUMAN	Isoform 4 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	111-UNIMOD:21	0.05	40.0	1	1	0
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	114-UNIMOD:21,116-UNIMOD:4	0.05	40.0	4	1	0
PRT	sp|P51114|FXR1_HUMAN	Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	406-UNIMOD:21,409-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	174-UNIMOD:4,180-UNIMOD:35	0.04	40.0	3	2	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	360-UNIMOD:21,369-UNIMOD:4	0.04	40.0	1	1	1
PRT	sp|Q6P9F7|LRC8B_HUMAN	Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens OX=9606 GN=LRRC8B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	186-UNIMOD:21,195-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	318-UNIMOD:21,326-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|O15117|FYB1_HUMAN	FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	457-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	426-UNIMOD:21,143-UNIMOD:21	0.06	40.0	2	2	2
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1481-UNIMOD:21,1526-UNIMOD:21,1235-UNIMOD:21,372-UNIMOD:21,376-UNIMOD:21	0.07	40.0	5	5	5
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	438-UNIMOD:21	0.03	40.0	4	2	1
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	440-UNIMOD:21,400-UNIMOD:21,438-UNIMOD:21	0.04	40.0	3	2	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	162-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	78-UNIMOD:21,99-UNIMOD:21,101-UNIMOD:4,80-UNIMOD:21	0.12	40.0	7	2	0
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	315-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	276-UNIMOD:35	0.02	40.0	2	1	0
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	122-UNIMOD:21,982-UNIMOD:21,1167-UNIMOD:21,1175-UNIMOD:4	0.04	40.0	3	3	2
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	116-UNIMOD:4	0.04	40.0	1	1	1
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	1304-UNIMOD:28,1320-UNIMOD:21	0.01	40.0	1	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	494-UNIMOD:21	0.04	39.0	5	1	0
PRT	sp|Q8TE77-4|SSH3_HUMAN	Isoform 4 of Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	70-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P02751-4|FINC_HUMAN	Isoform 4 of Fibronectin OS=Homo sapiens OX=9606 GN=FN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	2	2
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	108-UNIMOD:4	0.13	39.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	19-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:21,9-UNIMOD:21	0.16	39.0	4	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	529-UNIMOD:21,713-UNIMOD:21,676-UNIMOD:21,642-UNIMOD:21,702-UNIMOD:21	0.11	39.0	11	5	3
PRT	sp|P02747|C1QC_HUMAN	Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	939-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	98-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1179-UNIMOD:21,1188-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	43-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	137-UNIMOD:35	0.04	39.0	5	5	5
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	391-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	649-UNIMOD:21,645-UNIMOD:21	0.03	39.0	3	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	107-UNIMOD:21,106-UNIMOD:28,113-UNIMOD:21	0.02	39.0	2	2	2
PRT	sp|P21359-2|NF1_HUMAN	Isoform 1 of Neurofibromin OS=Homo sapiens OX=9606 GN=NF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2576-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	391-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	958-UNIMOD:21,953-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	185-UNIMOD:21,110-UNIMOD:21,127-UNIMOD:35,890-UNIMOD:4	0.08	39.0	4	4	4
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	176-UNIMOD:21,162-UNIMOD:21	0.09	39.0	2	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	446-UNIMOD:21	0.04	39.0	3	2	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	18-UNIMOD:21,2-UNIMOD:1,9-UNIMOD:21	0.10	39.0	7	2	0
PRT	sp|Q9HAZ1|CLK4_HUMAN	Dual specificity protein kinase CLK4 OS=Homo sapiens OX=9606 GN=CLK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	138-UNIMOD:21,149-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q14134-2|TRI29_HUMAN	Isoform Beta of Tripartite motif-containing protein 29 OS=Homo sapiens OX=9606 GN=TRIM29	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	164-UNIMOD:21,173-UNIMOD:4,176-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	7	1	0
PRT	sp|Q53SF7|COBL1_HUMAN	Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	273-UNIMOD:21,324-UNIMOD:21,325-UNIMOD:35,335-UNIMOD:4,326-UNIMOD:21	0.03	39.0	4	2	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	155-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	841-UNIMOD:21,843-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	553-UNIMOD:21	0.05	39.0	4	2	0
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	117-UNIMOD:21,148-UNIMOD:21	0.06	39.0	2	2	2
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q9UKE5-8|TNIK_HUMAN	Isoform 8 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	862-UNIMOD:21,865-UNIMOD:35,873-UNIMOD:35,859-UNIMOD:21	0.02	39.0	4	1	0
PRT	sp|Q96EU7|C1GLC_HUMAN	C1GALT1-specific chaperone 1 OS=Homo sapiens OX=9606 GN=C1GALT1C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9P1Y6|PHRF1_HUMAN	PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	917-UNIMOD:21	0.02	39.0	1	1	0
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	111-UNIMOD:4	0.05	39.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	678-UNIMOD:21,683-UNIMOD:21	0.03	38.0	3	1	0
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	2	2	2
PRT	sp|P50443|S26A2_HUMAN	Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC26A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	25-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	185-UNIMOD:21,182-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	500-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	659-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|Q9H2Y7-2|ZN106_HUMAN	Isoform 2 of Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	556-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1379-UNIMOD:35,913-UNIMOD:35	0.02	38.0	4	2	1
PRT	sp|Q86VI3|IQGA3_HUMAN	Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	260-UNIMOD:35,264-UNIMOD:21	0.03	38.0	5	1	0
PRT	sp|Q9BTC0-2|DIDO1_HUMAN	Isoform 2 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	152-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P17612-2|KAPCA_HUMAN	Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q9NZV5-2|SELN_HUMAN	Isoform 2 of Selenoprotein N OS=Homo sapiens OX=9606 GN=SELENON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	13-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	188-UNIMOD:21,153-UNIMOD:21	0.16	38.0	5	3	2
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	299-UNIMOD:4	0.03	38.0	2	1	0
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	357-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9BZ71-3|PITM3_HUMAN	Isoform 3 of Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	285-UNIMOD:21,259-UNIMOD:21,274-UNIMOD:4	0.05	38.0	3	2	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	30-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	758-UNIMOD:21,337-UNIMOD:35	0.04	38.0	2	2	2
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P35442|TSP2_HUMAN	Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	5	1	0
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	471-UNIMOD:35,477-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q71F56|MD13L_HUMAN	Mediator of RNA polymerase II transcription subunit 13-like OS=Homo sapiens OX=9606 GN=MED13L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	915-UNIMOD:35,923-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	53-UNIMOD:21	0.02	38.0	3	1	0
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	246-UNIMOD:21,254-UNIMOD:21,253-UNIMOD:21	0.02	38.0	3	1	0
PRT	sp|Q9Y6R1-3|S4A4_HUMAN	Isoform 3 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	210-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:35	0.05	38.0	1	1	1
PRT	sp|P14780|MMP9_HUMAN	Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	256-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	166-UNIMOD:21,165-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|O75971-2|SNPC5_HUMAN	Isoform 2 of snRNA-activating protein complex subunit 5 OS=Homo sapiens OX=9606 GN=SNAPC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	66-UNIMOD:21	0.26	38.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	382-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P02788-2|TRFL_HUMAN	Isoform DeltaLf of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	479-UNIMOD:4,482-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	557-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q6ZT12|UBR3_HUMAN	E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens OX=9606 GN=UBR3 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	170-UNIMOD:4,172-UNIMOD:4,178-UNIMOD:35	0.01	38.0	3	1	0
PRT	sp|O43164-2|PJA2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	253-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	125-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9Y3M8-5|STA13_HUMAN	Isoform 5 of StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	326-UNIMOD:21,339-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	205-UNIMOD:4,206-UNIMOD:4,207-UNIMOD:21,227-UNIMOD:35,185-UNIMOD:21,188-UNIMOD:21	0.13	38.0	2	2	2
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	241-UNIMOD:21,238-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	1
PRT	sp|Q9P2R6-2|RERE_HUMAN	Isoform 2 of Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	125-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1932-UNIMOD:21,1915-UNIMOD:21	0.01	38.0	2	2	2
PRT	sp|Q86UX7-2|URP2_HUMAN	Isoform 2 of Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9Y6R7|FCGBP_HUMAN	IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2208-UNIMOD:4,2211-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	121-UNIMOD:21,124-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1243-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	453-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	251-UNIMOD:27,263-UNIMOD:21	0.07	38.0	13	5	4
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	99-UNIMOD:21,101-UNIMOD:4	0.05	38.0	3	2	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	98-UNIMOD:28,100-UNIMOD:21,341-UNIMOD:27,347-UNIMOD:21	0.06	38.0	3	2	1
PRT	sp|Q9UGI8|TES_HUMAN	Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	46-UNIMOD:385,46-UNIMOD:4	0.04	38.0	2	1	0
PRT	sp|Q14683|SMC1A_HUMAN	Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	82-UNIMOD:35	0.01	37.0	1	1	1
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	84-UNIMOD:21,90-UNIMOD:35,58-UNIMOD:35,68-UNIMOD:21,63-UNIMOD:21	0.05	37.0	3	2	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:21	0.20	37.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.09	37.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	263-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q2T9K0-4|TMM44_HUMAN	Isoform 3 of Transmembrane protein 44 OS=Homo sapiens OX=9606 GN=TMEM44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	286-UNIMOD:21,295-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	352-UNIMOD:21,364-UNIMOD:35	0.06	37.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.07	37.0	2	2	2
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q02078-3|MEF2A_HUMAN	Isoform RSRFC4 of Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	96-UNIMOD:4,98-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	339-UNIMOD:4,351-UNIMOD:4,352-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q53TN4-3|CYBR1_HUMAN	Isoform 3 of Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	191-UNIMOD:35,202-UNIMOD:21,199-UNIMOD:35	0.11	37.0	2	1	0
PRT	sp|Q9UGM5-2|FETUB_HUMAN	Isoform 2 of Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	278-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.02	37.0	86	1	0
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1119-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1570-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	51-UNIMOD:35	0.10	37.0	4	4	4
PRT	sp|Q7KZ85-3|SPT6H_HUMAN	Isoform 3 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	124-UNIMOD:35,125-UNIMOD:21,78-UNIMOD:21	0.06	37.0	2	2	2
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1186-UNIMOD:21,1208-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	247-UNIMOD:21	0.08	37.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	2	1	0
PRT	sp|P02746|C1QB_HUMAN	Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2580-UNIMOD:21	0.01	37.0	2	2	2
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	264-UNIMOD:21,279-UNIMOD:35	0.07	37.0	1	1	1
PRT	sp|Q9Y6C2-2|EMIL1_HUMAN	Isoform 2 of EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	29-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q63HK5|TSH3_HUMAN	Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	85-UNIMOD:35,92-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q13555-9|KCC2G_HUMAN	Isoform 9 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	344-UNIMOD:21,343-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	100-UNIMOD:21,114-UNIMOD:21,107-UNIMOD:21	0.03	37.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1552-UNIMOD:21,1539-UNIMOD:21,1383-UNIMOD:21,383-UNIMOD:21,398-UNIMOD:21	0.02	37.0	6	3	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	201-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9UJF2|NGAP_HUMAN	Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	16-UNIMOD:21,29-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|Q8TF01-2|PNISR_HUMAN	Isoform 2 of Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	286-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q9BVS4-2|RIOK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	382-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q96PN7-2|TREF1_HUMAN	Isoform 2 of Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	825-UNIMOD:21,844-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	291-UNIMOD:21,303-UNIMOD:35	0.04	37.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1482-UNIMOD:21,1481-UNIMOD:21	0.01	37.0	2	1	0
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	2	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	204-UNIMOD:21,214-UNIMOD:21,58-UNIMOD:21	0.14	37.0	4	3	2
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1120-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	847-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	763-UNIMOD:35,764-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	3	3	3
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	921-UNIMOD:21,923-UNIMOD:21	0.02	37.0	5	1	0
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	252-UNIMOD:21,261-UNIMOD:21	0.02	37.0	3	1	0
PRT	sp|Q9UNP9-2|PPIE_HUMAN	Isoform B of Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens OX=9606 GN=PPIE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	871-UNIMOD:21	0.02	37.0	7	1	0
PRT	sp|Q9H1C4|UN93B_HUMAN	Protein unc-93 homolog B1 OS=Homo sapiens OX=9606 GN=UNC93B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	547-UNIMOD:21	0.05	37.0	3	1	0
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	1	1	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	726-UNIMOD:385,726-UNIMOD:4,733-UNIMOD:21,742-UNIMOD:4,735-UNIMOD:21	0.03	37.0	2	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	325-UNIMOD:35,329-UNIMOD:21	0.03	37.0	1	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	105-UNIMOD:28	0.06	37.0	1	1	1
PRT	sp|Q53TN4|CYBR1_HUMAN	Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	249-UNIMOD:35,257-UNIMOD:35,260-UNIMOD:21	0.09	37.0	1	1	0
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	283-UNIMOD:21,296-UNIMOD:4,282-UNIMOD:21	0.03	37.0	3	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1104-UNIMOD:21,1114-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	220-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	447-UNIMOD:4	0.03	36.0	2	1	0
PRT	sp|O60238-2|BNI3L_HUMAN	Isoform 2 of BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	80-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	71-UNIMOD:21,224-UNIMOD:21	0.11	36.0	2	2	2
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	194-UNIMOD:21,196-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1448-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	128-UNIMOD:21,133-UNIMOD:21,125-UNIMOD:21	0.10	36.0	3	1	0
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	697-UNIMOD:35,699-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O43491-4|E41L2_HUMAN	Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9BUH6-2|PAXX_HUMAN	Isoform 2 of Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:4,24-UNIMOD:4	0.15	36.0	1	1	1
PRT	sp|Q15124|PGM5_HUMAN	Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q5JRA6-4|TGO1_HUMAN	Isoform 4 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q5TCZ1-2|SPD2A_HUMAN	Isoform 2 of SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	602-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	640-UNIMOD:21,966-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q9HCN4-4|GPN1_HUMAN	Isoform 4 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	326-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1128-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1721-UNIMOD:4,1726-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P27816-6|MAP4_HUMAN	Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	635-UNIMOD:4,636-UNIMOD:21,278-UNIMOD:35,280-UNIMOD:21	0.03	36.0	4	3	2
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	267-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	345-UNIMOD:21,363-UNIMOD:4,350-UNIMOD:21	0.07	36.0	2	1	0
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1397-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.01	36.0	5	1	0
PRT	sp|P46100-5|ATRX_HUMAN	Isoform 5 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	441-UNIMOD:21,450-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|O94919|ENDD1_HUMAN	Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	34-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	587-UNIMOD:35,590-UNIMOD:21,597-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P00734|THRB_HUMAN	Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	274-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	61-UNIMOD:35	0.05	36.0	3	2	1
PRT	sp|Q5JTC6-2|AMER1_HUMAN	Isoform 2 of APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	286-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	886-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9NQ79-3|CRAC1_HUMAN	Isoform 3 of Cartilage acidic protein 1 OS=Homo sapiens OX=9606 GN=CRTAC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	120-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q96E11-8|RRFM_HUMAN	Isoform 8 of Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	189-UNIMOD:35	0.08	36.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	657-UNIMOD:21,659-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	719-UNIMOD:21,714-UNIMOD:21,261-UNIMOD:21	0.05	36.0	3	2	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	117-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|O75122-3|CLAP2_HUMAN	Isoform 3 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	255-UNIMOD:21,840-UNIMOD:35,842-UNIMOD:21,854-UNIMOD:4	0.03	36.0	2	2	2
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	34-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	944-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9UKN1-2|MUC12_HUMAN	Isoform 2 of Mucin-12 OS=Homo sapiens OX=9606 GN=MUC12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1557-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P52594-2|AGFG1_HUMAN	Isoform 2 of Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	251-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q96QF0-8|RAB3I_HUMAN	Isoform 8 of Rab-3A-interacting protein OS=Homo sapiens OX=9606 GN=RAB3IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	71-UNIMOD:35,72-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	610-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	770-UNIMOD:4,782-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1805-UNIMOD:21,1800-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q04637-5|IF4G1_HUMAN	Isoform D of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	933-UNIMOD:21	0.03	36.0	2	2	2
PRT	sp|Q8TD06|AGR3_HUMAN	Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	90-UNIMOD:35	0.10	36.0	1	1	1
PRT	sp|P01009|A1AT_HUMAN	Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	293-UNIMOD:35	0.02	36.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	221-UNIMOD:21,154-UNIMOD:21	0.13	36.0	3	2	1
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	579-UNIMOD:21,585-UNIMOD:4,594-UNIMOD:35,595-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q9UH99-3|SUN2_HUMAN	Isoform 3 of SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	886-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q01484|ANK2_HUMAN	Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	3788-UNIMOD:35,3792-UNIMOD:21	0.01	36.0	1	1	0
PRT	sp|Q02252|MMSA_HUMAN	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	530-UNIMOD:35,533-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	12-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	793-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9UBW5-2|BIN2_HUMAN	Isoform 2 of Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	325-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q16568|CART_HUMAN	Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	48-UNIMOD:21	0.14	35.0	2	1	0
PRT	sp|P23368|MAOM_HUMAN	NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|O00533|NCHL1_HUMAN	Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1137-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	711-UNIMOD:21,717-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|Q9Y3B9|RRP15_HUMAN	RRP15-like protein OS=Homo sapiens OX=9606 GN=RRP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	57-UNIMOD:21,74-UNIMOD:4	0.09	35.0	1	1	1
PRT	sp|P33241-2|LSP1_HUMAN	Isoform 2 of Lymphocyte-specific protein 1 OS=Homo sapiens OX=9606 GN=LSP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	77-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	985-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	184-UNIMOD:35	0.07	35.0	3	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	513-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	598-UNIMOD:21,604-UNIMOD:4,1315-UNIMOD:21,1324-UNIMOD:35	0.02	35.0	2	2	2
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	60-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	369-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	322-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O95671-3|ASML_HUMAN	Isoform 3 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	170-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|O14981|BTAF1_HUMAN	TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	502-UNIMOD:35,505-UNIMOD:35	0.02	35.0	3	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	924-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1543-UNIMOD:21	0.00	35.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:21	0.14	35.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35,1283-UNIMOD:21	0.03	35.0	7	2	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	129-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q15599-2|NHRF2_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P55268|LAMB2_HUMAN	Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	168-UNIMOD:4	0.18	35.0	2	2	2
PRT	sp|P55290-5|CAD13_HUMAN	Isoform 5 of Cadherin-13 OS=Homo sapiens OX=9606 GN=CDH13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	228-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	988-UNIMOD:35,994-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O75410-7|TACC1_HUMAN	Isoform 7 of Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	86-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9NQR1-2|KMT5A_HUMAN	Isoform 2 of N-lysine methyltransferase KMT5A OS=Homo sapiens OX=9606 GN=KMT5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	140-UNIMOD:21,145-UNIMOD:4	0.07	35.0	1	1	1
PRT	sp|Q2LD37-2|K1109_HUMAN	Isoform 2 of Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1225-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P23142-2|FBLN1_HUMAN	Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q6NUJ5-2|PWP2B_HUMAN	Isoform 2 of PWWP domain-containing protein 2B OS=Homo sapiens OX=9606 GN=PWWP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	447-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q96JK2-2|DCAF5_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 5 OS=Homo sapiens OX=9606 GN=DCAF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	566-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P78310-7|CXAR_HUMAN	Isoform 7 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	252-UNIMOD:21,264-UNIMOD:35,269-UNIMOD:35	0.07	35.0	1	1	1
PRT	sp|Q9NZN5-2|ARHGC_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	275-UNIMOD:4,290-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q96RU2-3|UBP28_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 28 OS=Homo sapiens OX=9606 GN=USP28	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	820-UNIMOD:21	0.06	35.0	2	2	2
PRT	sp|Q9UKY7-2|CDV3_HUMAN	Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	103-UNIMOD:35,107-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	333-UNIMOD:21,284-UNIMOD:21	0.11	35.0	2	2	2
PRT	sp|Q9NZN4-2|EHD2_HUMAN	Isoform 2 of EH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EHD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	332-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	452-UNIMOD:28,471-UNIMOD:21,1418-UNIMOD:21	0.05	35.0	3	3	3
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	711-UNIMOD:28,717-UNIMOD:21,839-UNIMOD:21,843-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	202-UNIMOD:28,204-UNIMOD:4,206-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	397-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.14	34.0	2	2	2
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1298-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1148-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|C9J069|AJM1_HUMAN	Apical junction component 1 homolog OS=Homo sapiens OX=9606 GN=AJM1 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	109-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	2638-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|Q5JTJ3-3|COA6_HUMAN	Isoform 3 of Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	22-UNIMOD:4,33-UNIMOD:4	0.18	34.0	1	1	1
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	87-UNIMOD:4,88-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q14766-3|LTBP1_HUMAN	Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1198-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	67-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:21,196-UNIMOD:21	0.05	34.0	4	1	0
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|O14523|C2C2L_HUMAN	Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	660-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	237-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1240-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1356-UNIMOD:35	0.03	34.0	6	4	2
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|O00767|ACOD_HUMAN	Acyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	198-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	24-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q13188|STK3_HUMAN	Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	316-UNIMOD:21,326-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q9HAS0|NJMU_HUMAN	Protein Njmu-R1 OS=Homo sapiens OX=9606 GN=C17orf75 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|O94988-6|FA13A_HUMAN	Isoform 5 of Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	243-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|O14526-3|FCHO1_HUMAN	Isoform 3 of F-BAR domain only protein 1 OS=Homo sapiens OX=9606 GN=FCHO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	236-UNIMOD:35,242-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q96QE3-2|ATAD5_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	1	1	1
PRT	sp|Q14687|GSE1_HUMAN	Genetic suppressor element 1 OS=Homo sapiens OX=9606 GN=GSE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	94-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	221-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|P06753-5|TPM3_HUMAN	Isoform 5 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|Q9H299|SH3L3_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.17	34.0	1	1	1
PRT	sp|Q9Y4E8-2|UBP15_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	601-UNIMOD:21,604-UNIMOD:4,605-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	114-UNIMOD:21	0.04	34.0	3	1	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1517-UNIMOD:21,1519-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q02218-3|ODO1_HUMAN	Isoform 3 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	208-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	4342-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|Q12778|FOXO1_HUMAN	Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	329-UNIMOD:21,332-UNIMOD:35,346-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|O94842-3|TOX4_HUMAN	Isoform 3 of TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	152-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|O95294-4|RASL1_HUMAN	Isoform 4 of RasGAP-activating-like protein 1 OS=Homo sapiens OX=9606 GN=RASAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	712-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q9H3H3-1|CK068_HUMAN	Isoform 1 of UPF0696 protein C11orf68 OS=Homo sapiens OX=9606 GN=C11orf68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:35	0.07	34.0	1	1	0
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	497-UNIMOD:35,499-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|O75815-2|BCAR3_HUMAN	Isoform 2 of Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens OX=9606 GN=BCAR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q8NAA4-2|A16L2_HUMAN	Isoform 2 of Autophagy-related protein 16-2 OS=Homo sapiens OX=9606 GN=ATG16L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	170-UNIMOD:21,181-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	357-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9Y2H0-3|DLGP4_HUMAN	Isoform 3 of Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	115-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|O60229-5|KALRN_HUMAN	Isoform 5 of Kalirin OS=Homo sapiens OX=9606 GN=KALRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	172-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q5SRD0|WAC2D_HUMAN	WASH complex subunit 2D OS=Homo sapiens OX=9606 GN=WASHC2D PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	262-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|Q96HH9-4|GRM2B_HUMAN	Isoform 4 of GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	55-UNIMOD:21,69-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q9BY89-2|K1671_HUMAN	Isoform 2 of Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	110-UNIMOD:21,119-UNIMOD:35,128-UNIMOD:4	0.10	34.0	1	1	1
PRT	sp|Q14680-3|MELK_HUMAN	Isoform 3 of Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	311-UNIMOD:21,321-UNIMOD:35	0.04	34.0	2	1	0
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	207-UNIMOD:21,209-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	77-UNIMOD:4,86-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9Y2Q0-3|AT8A1_HUMAN	Isoform 3 of Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	28-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	0
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	194-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1136-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.20	34.0	1	1	1
PRT	sp|Q16666-3|IF16_HUMAN	Isoform 3 of Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	212-UNIMOD:21,223-UNIMOD:35	0.03	34.0	1	1	1
PRT	sp|P69892|HBG2_HUMAN	Hemoglobin subunit gamma-2 OS=Homo sapiens OX=9606 GN=HBG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|O15162-2|PLS1_HUMAN	Isoform 2 of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	67-UNIMOD:4,68-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|Q3L8U1-2|CHD9_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	654-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	188-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	435-UNIMOD:28,440-UNIMOD:21,443-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	456-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q5TBA9|FRY_HUMAN	Protein furry homolog OS=Homo sapiens OX=9606 GN=FRY PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1955-UNIMOD:21,1961-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|Q9H3H3|CK068_HUMAN	UPF0696 protein C11orf68 OS=Homo sapiens OX=9606 GN=C11orf68 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	42-UNIMOD:35	0.06	34.0	1	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	121-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|Q13433|S39A6_HUMAN	Zinc transporter ZIP6 OS=Homo sapiens OX=9606 GN=SLC39A6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	469-UNIMOD:28,471-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	888-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	294-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	176-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	150-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q9NUA8|ZBT40_HUMAN	Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	186-UNIMOD:35,190-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	646-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	333-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P02545-3|LMNA_HUMAN	Isoform ADelta10 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	403-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8TF05-2|PP4R1_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	520-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9BZF9-2|UACA_HUMAN	Isoform 2 of Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1219-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	317-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	402-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	337-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8NFW9-5|MYRIP_HUMAN	Isoform 5 of Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	561-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	466-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|P46736-5|BRCC3_HUMAN	Isoform 5 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:35,38-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q14183-2|DOC2A_HUMAN	Isoform 2 of Double C2-like domain-containing protein alpha OS=Homo sapiens OX=9606 GN=DOC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	1	1	1
PRT	sp|P39656|OST48_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	145-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	498-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	927-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	488-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9Y6X4|F169A_HUMAN	Soluble lamin-associated protein of 75 kDa OS=Homo sapiens OX=9606 GN=FAM169A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	17-UNIMOD:35,26-UNIMOD:35	0.08	33.0	1	1	1
PRT	sp|P55899|FCGRN_HUMAN	IgG receptor FcRn large subunit p51 OS=Homo sapiens OX=9606 GN=FCGRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q9UMY4-3|SNX12_HUMAN	Isoform 3 of Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	88-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q86VR2-2|RETR3_HUMAN	Isoform 2 of Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	125-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	208-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1369-UNIMOD:21,1340-UNIMOD:21	0.03	33.0	2	2	2
PRT	sp|P09493-3|TPM1_HUMAN	Isoform 3 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	61-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P67936-2|TPM4_HUMAN	Isoform 2 of Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	61-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	3	1	0
PRT	sp|Q07812-5|BAX_HUMAN	Isoform Epsilon of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	74-UNIMOD:35	0.09	33.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	217-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	525-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1113-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	168-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	483-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	6350-UNIMOD:4,6361-UNIMOD:21	0.00	33.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1291-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	183-UNIMOD:35,192-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	310-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	441-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	550-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	200-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	862-UNIMOD:21,867-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P23508|CRCM_HUMAN	Colorectal mutant cancer protein OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	118-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q5VT52-5|RPRD2_HUMAN	Isoform 5 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	708-UNIMOD:21,712-UNIMOD:35,713-UNIMOD:35,724-UNIMOD:35	0.03	33.0	1	1	1
PRT	sp|Q2TAK8-2|PWP3A_HUMAN	Isoform 2 of PWWP domain-containing DNA repair factor 3A OS=Homo sapiens OX=9606 GN=PWWP3A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q6IQ23-3|PKHA7_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	145-UNIMOD:21,139-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q9Y2J2-2|E41L3_HUMAN	Isoform 2 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	443-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q8IWB9|TEX2_HUMAN	Testis-expressed protein 2 OS=Homo sapiens OX=9606 GN=TEX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	746-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9BXL7|CAR11_HUMAN	Caspase recruitment domain-containing protein 11 OS=Homo sapiens OX=9606 GN=CARD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	593-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P0DOY3|IGLC3_HUMAN	Immunoglobulin lambda constant 3 OS=Homo sapiens OX=9606 GN=IGLC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	84-UNIMOD:21,87-UNIMOD:4	0.15	33.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	144-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1173-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	520-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q70E73|RAPH1_HUMAN	Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	805-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	370-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1318-UNIMOD:21,2475-UNIMOD:21	0.02	33.0	2	2	2
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q8NEY1-5|NAV1_HUMAN	Isoform 5 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	417-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9HAU4|SMUF2_HUMAN	E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	44-UNIMOD:21,47-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|O94762-4|RECQ5_HUMAN	Isoform 4 of ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	788-UNIMOD:21,797-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	184-UNIMOD:21,186-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	665-UNIMOD:21,681-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	175-UNIMOD:28,186-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q8IXQ4|GPAM1_HUMAN	GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	102-UNIMOD:28,105-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q06330|SUH_HUMAN	Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	270-UNIMOD:28	0.03	33.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.09	33.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	75-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.05	33.0	1	1	0
PRT	sp|Q9ULD4|BRPF3_HUMAN	Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	965-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P29590|PML_HUMAN	Protein PML OS=Homo sapiens OX=9606 GN=PML PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	530-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8IXS6|PALM2_HUMAN	Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	318-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q8NDF8-4|PAPD5_HUMAN	Isoform 4 of Terminal nucleotidyltransferase 4B OS=Homo sapiens OX=9606 GN=TENT4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	49-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1021-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q53F19-2|NCBP3_HUMAN	Isoform 2 of Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	408-UNIMOD:21,518-UNIMOD:21,527-UNIMOD:21	0.07	32.0	3	2	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1616-UNIMOD:21,1619-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q9NV96-2|CC50A_HUMAN	Isoform 2 of Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	17-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	832-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q5T0Z8|CF132_HUMAN	Uncharacterized protein C6orf132 OS=Homo sapiens OX=9606 GN=C6orf132 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	722-UNIMOD:21,906-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|O95239|KIF4A_HUMAN	Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1136-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	86-UNIMOD:35	0.11	32.0	2	1	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	540-UNIMOD:4,542-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P61224-3|RAP1B_HUMAN	Isoform 3 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:35	0.08	32.0	2	1	0
PRT	sp|Q9NRS6|SNX15_HUMAN	Sorting nexin-15 OS=Homo sapiens OX=9606 GN=SNX15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	229-UNIMOD:21,237-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	634-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	844-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	436-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9BVG4|PBDC1_HUMAN	Protein PBDC1 OS=Homo sapiens OX=9606 GN=PBDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	197-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|P17275|JUNB_HUMAN	Transcription factor jun-B OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	237-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	1	1	1
PRT	sp|Q2V2M9-2|FHOD3_HUMAN	Isoform 2 of FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	742-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	123-UNIMOD:21	0.14	32.0	1	1	1
PRT	sp|Q99549|MPP8_HUMAN	M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	84-UNIMOD:21,99-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	387-UNIMOD:4,396-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q14517|FAT1_HUMAN	Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.00	32.0	1	1	1
PRT	sp|Q8IWI9-3|MGAP_HUMAN	Isoform 2 of MAX gene-associated protein OS=Homo sapiens OX=9606 GN=MGA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1399-UNIMOD:35,1402-UNIMOD:4,1408-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	123-UNIMOD:21	0.11	32.0	1	1	1
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	183-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9NWZ8|GEMI8_HUMAN	Gem-associated protein 8 OS=Homo sapiens OX=9606 GN=GEMIN8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	170-UNIMOD:21,180-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	397-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	363-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	136-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|P51636-2|CAV2_HUMAN	Isoform Beta of Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:35,7-UNIMOD:21,10-UNIMOD:21	0.13	32.0	1	1	1
PRT	sp|Q9Y223-5|GLCNE_HUMAN	Isoform 5 of Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Homo sapiens OX=9606 GN=GNE	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|O95359-6|TACC2_HUMAN	Isoform 6 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	434-UNIMOD:35,437-UNIMOD:21,452-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|Q6GYQ0-4|RGPA1_HUMAN	Isoform 4 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	503-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	189-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q12912-2|LRMP_HUMAN	Isoform 2 of Lymphoid-restricted membrane protein OS=Homo sapiens OX=9606 GN=LRMP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q13615-3|MTMR3_HUMAN	Isoform C of Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1136-UNIMOD:21,1137-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9ULL1|PKHG1_HUMAN	Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1295-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P43007-2|SATT_HUMAN	Isoform 2 of Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	223-UNIMOD:21	0.12	32.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	660-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	775-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q96IK5|GMCL1_HUMAN	Germ cell-less protein-like 1 OS=Homo sapiens OX=9606 GN=GMCL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	60-UNIMOD:4,62-UNIMOD:4,66-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O95721|SNP29_HUMAN	Synaptosomal-associated protein 29 OS=Homo sapiens OX=9606 GN=SNAP29 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q6NUK4|REEP3_HUMAN	Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	210-UNIMOD:21,214-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|P09132|SRP19_HUMAN	Signal recognition particle 19 kDa protein OS=Homo sapiens OX=9606 GN=SRP19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	135-UNIMOD:21	0.12	32.0	1	1	1
PRT	sp|P07951-3|TPM2_HUMAN	Isoform 3 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q6H8Q1-8|ABLM2_HUMAN	Isoform 8 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	423-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q86TC9-2|MYPN_HUMAN	Isoform 2 of Myopalladin OS=Homo sapiens OX=9606 GN=MYPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	653-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	201-UNIMOD:21,211-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.00	32.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	303-UNIMOD:21,307-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9UI36-4|DACH1_HUMAN	Isoform 4 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8WU20|FRS2_HUMAN	Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	227-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	926-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|A6NEC2|PSAL_HUMAN	Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	967-UNIMOD:4	0.00	32.0	1	1	1
PRT	sp|Q07866-3|KLC1_HUMAN	Isoform G of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	1103-UNIMOD:28,1106-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	584-UNIMOD:21	0.03	32.0	1	1	0
PRT	sp|Q5VZL5|ZMYM4_HUMAN	Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	122-UNIMOD:21	0.01	32.0	1	1	0
PRT	sp|Q9UQV4|LAMP3_HUMAN	Lysosome-associated membrane glycoprotein 3 OS=Homo sapiens OX=9606 GN=LAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	209-UNIMOD:21,221-UNIMOD:21,222-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	729-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	315-UNIMOD:21,319-UNIMOD:35,321-UNIMOD:21,324-UNIMOD:21,327-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q8IWV8|UBR2_HUMAN	E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens OX=9606 GN=UBR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1005-UNIMOD:21,1008-UNIMOD:21,1014-UNIMOD:21,1022-UNIMOD:21	0.01	32.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KGSSSSVCSVASSSDISLGSTK	1	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	59.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=12790	61.32	2	2209.9774	2209.9774	R	T	1382	1404
PSM	LPNLSSPSAEGPPGPPSGPAPR	2	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	6-UNIMOD:21	ms_run[2]:scan=14820	70.667	2	2161.0205	2161.0205	R	K	412	434
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	3	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:21	ms_run[2]:scan=17792	86.047	3	2952.3714	2952.3714	R	E	118	147
PSM	SGSPSDNSGAEEMEVSLAKPK	4	sp|P31749-2|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21	ms_run[2]:scan=13071	62.578	2	2198.9403	2198.9403	R	H	60	81
PSM	GDQPAASGDSDDDEPPPLPR	5	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0		ms_run[1]:scan=9797	47.69333833333334	2	2034.876293	2034.876657	R	L	48	68
PSM	GDQPAASGDSDDDEPPPLPR	6	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=10463	50.719	2	2034.8767	2034.8767	R	L	48	68
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	7	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6523	33.01927333333333	3	3007.3299	3007.3290	K	S	145	174
PSM	GDQPAASGDSDDDEPPPLPR	8	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10012	48.696	2	2034.8767	2034.8767	R	L	48	68
PSM	GDQPAASGDSDDDEPPPLPR	9	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=10238	49.713	2	2034.8767	2034.8767	R	L	48	68
PSM	LPNLSSPSAEGPPGPPSGPAPR	10	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21	ms_run[2]:scan=14612	69.66	2	2161.0205	2161.0205	R	K	412	434
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK	11	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	5-UNIMOD:21	ms_run[1]:scan=17999	87.06525500000001	3	4458.072244	4458.072495	K	K	34	85
PSM	GDQPAASGDSDDDEPPPLPR	12	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=10630	51.41	2	2034.8767	2034.8767	R	L	48	68
PSM	GDQPAASGDSDDDEPPPLPR	13	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=10813	52.237	2	2034.8767	2034.8767	R	L	48	68
PSM	GTGGVDTAAVGGVFDVSNADR	14	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=17969	86.898	2	1963.9235	1963.9235	R	L	321	342
PSM	HSLDSDEEEDDDDGGSSK	15	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21	ms_run[2]:scan=2702	15.723	2	2015.6753	2015.6753	K	Y	45	63
PSM	LYGSAGPPPTGEEDTAEKDEL	16	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14047	67.113	2	2174.9855	2174.9855	K	-	634	655
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	17	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	15-UNIMOD:21	ms_run[2]:scan=8053	40.007	3	2967.2003	2967.2003	K	I	832	862
PSM	SKSISSSNPDLAVAPGSVDDEVSR	18	sp|Q96HP0|DOCK6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=14093	67.314	2	2496.1381	2496.1381	R	I	878	902
PSM	SSPPAPPLPPGSGSPGTPQALPR	19	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=15402	73.487	2	2244.094	2244.0940	R	R	585	608
PSM	WSLEDDDDDEDDPAEAEK	20	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14408	68.753	2	2092.7869	2092.7869	K	E	198	216
PSM	EALNVFGNDYDTEDGTGVR	21	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=17997	87.054	2	2070.913	2070.9130	R	D	147	166
PSM	GSSGSPAHAESYSSGGGGQQK	22	sp|P15408|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=1265	8.7688	2	2014.8018	2014.8018	R	F	15	36
PSM	REESPMDVDQPSPSAQDTQSIASDGTPQGEK	23	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=9892	48.144	3	3382.4144	3382.4144	R	E	3789	3820
PSM	RSPTDSDVSLDSEDSGAK	24	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:21	ms_run[2]:scan=6207	31.659	2	1944.795	1944.7950	R	S	853	871
PSM	SASDASISSGTHGQYSILQTAR	25	sp|O15056-3|SYNJ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=14643	69.804	2	2316.0383	2316.0383	K	L	1122	1144
PSM	SSKASLGSLEGEAEAEASSPK	26	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=17137	82.643	2	2113.9416	2113.9416	K	G	5745	5766
PSM	SVSKESVASMGADSGDDFASDGSSSR	27	sp|Q92805|GOGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=9035	44.354	3	2631.028	2631.0280	R	E	28	54
PSM	TSGPLSPPTGPPGPAPAGPAVR	28	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=15016	71.6	2	2060.0092	2060.0092	K	L	610	632
PSM	VASGSDLHLTDIDSDSNR	29	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=13843	66.174	2	1980.8426	1980.8426	K	G	70	88
PSM	VDPSLMEDSDDGPSLPTK	30	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:35	ms_run[2]:scan=12553	60.172	2	1917.8514	1917.8514	K	Q	87	105
PSM	QKSDAEEDGGTVSQEEEDR	31	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=6345	32.220245	2	2170.8185	2170.8170	K	K	552	571
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	32	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=6276	31.943785	3	3007.3308	3007.3290	K	S	145	174
PSM	RSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSR	33	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	2-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=12865	61.658993333333335	3	3558.481793	3557.500214	R	Q	219	254
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	34	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21	ms_run[2]:scan=17961	86.86	3	2861.224	2861.2240	K	E	520	546
PSM	GPGASGEQPEPGEAAAGGAAEEAR	35	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=7430	37.262	2	2164.9621	2164.9621	R	R	50	74
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	36	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21	ms_run[2]:scan=13270	63.54	3	4198.402	4198.4020	K	A	142	177
PSM	KLSSSDAPAQDTGSSAAAVETDASR	37	sp|Q7Z4S6-6|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=9815	47.781	2	2501.0919	2501.0919	R	T	815	840
PSM	KSYESSEDCSEAAGSPAR	38	sp|Q6P6C2-3|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2948	16.942	2	2009.7674	2009.7674	R	K	359	377
PSM	KYSASSGGLCEEATAAK	39	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=8336	41.333	2	1808.7652	1808.7652	R	V	393	410
PSM	LYGSAGPPPTGEEDTAEKDEL	40	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13594	65.074	2	2174.9855	2174.9855	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	41	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13823	66.083	2	2174.9855	2174.9855	K	-	634	655
PSM	STIGVMVTASHNPEEDNGVK	42	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10503	50.869	2	2179.9457	2179.9457	K	L	55	75
PSM	VAYEGSDSEKGEGAEPLK	43	sp|P78549-3|NTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=7235	36.323	2	1944.8354	1944.8354	R	V	51	69
PSM	YYSPCEEHPAETNQNEGAESGTIR	44	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9254	45.318	3	2818.1178	2818.1178	R	Q	182	206
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	45	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=14994	71.491035	3	3222.376885	3221.393230	R	S	38	70
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	46	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:21	ms_run[2]:scan=12087	57.919	3	3322.2318	3322.2318	K	D	929	958
PSM	GVVPLAGTDGETTTQGLDGLSER	47	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=18263	88.431	2	2272.1183	2272.1183	K	C	112	135
PSM	IQPDSHSLSYGTLPDGSDSTK	48	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21	ms_run[2]:scan=13020	62.344	2	2283.9897	2283.9897	K	S	354	375
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	49	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21,34-UNIMOD:35	ms_run[2]:scan=9935	48.327	3	4214.397	4214.3970	K	A	142	177
PSM	KSSADTEFSDECTTAER	50	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=6908	34.757	2	2012.767	2012.7670	R	V	1200	1217
PSM	LPVGSQCSVDLESASGEK	51	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:4	ms_run[2]:scan=12758	61.191	2	1861.8728	1861.8728	K	D	58	76
PSM	LQEALDAEMLEDEAGGGGAGPGGACK	52	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:35,25-UNIMOD:4	ms_run[2]:scan=16484	79.258	3	2518.0952	2518.0952	R	A	33	59
PSM	LSEGSQPAEEEEDQETPSR	53	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5700	29.418	2	2116.9033	2116.9033	K	N	239	258
PSM	QFEQNDLSFVGQDVDGDR	54	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17870	86.413	2	2067.9134	2067.9134	K	M	491	509
PSM	SEVERPASIPLSSGYSTASSDSTPR	55	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=14147	67.566	3	2660.1967	2660.1967	K	A	324	349
PSM	SIQGSSTSSSASSTLSHGEVK	56	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=7973	39.667	2	2115.9321	2115.9321	R	G	178	199
PSM	SLSKSDSDLLTCSPTEDATMGSR	57	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14280	68.179	2	2553.0612	2553.0612	R	S	622	645
PSM	SSEPVKETVQTTQSPTPVEK	58	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:21	ms_run[2]:scan=6576	33.254	2	2251.0621	2251.0621	K	E	604	624
PSM	TTTTNTQVEGDDEAAFLER	59	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=15043	71.72	2	2096.9498	2096.9498	K	L	75	94
PSM	VGDAIPAVEVFEGEPGNK	60	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=20111	98.796	2	1826.905	1826.9050	K	V	6	24
PSM	YDAFGEDSSSAMGVENR	61	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=13660	65.375	2	1833.7476	1833.7476	R	A	372	389
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	62	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7116	35.72453333333333	3	3007.3306	3007.3290	K	S	145	174
PSM	AAESVSKPDVSEEAPGPSK	63	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=6810	34.316	2	1963.8776	1963.8776	K	V	204	223
PSM	DAHDVSPTSTDTEAQLTVER	64	sp|Q8IVF2|AHNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=11644	55.911	2	2250.9642	2250.9642	R	Q	289	309
PSM	DIKEESDEEEEDDEESGR	65	sp|Q96EV2-2|RBM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=3703	20.428	2	2218.7911	2218.7911	K	L	200	218
PSM	EALGLGPPAAQLTPPPAPVGLR	66	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=21288	106.05	2	2201.161	2201.1610	R	G	451	473
PSM	GDAEKPEEELEEDDDEELDETLSER	67	sp|Q9NS69|TOM22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	23-UNIMOD:21	ms_run[2]:scan=17011	81.976	3	3000.1769	3000.1769	K	L	23	48
PSM	GDQPAASGDSDDDEPPPLPR	68	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11040	53.275	2	2034.8767	2034.8767	R	L	48	68
PSM	GDQPAASGDSDDDEPPPLPR	69	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9563	46.686	2	2034.8767	2034.8767	R	L	48	68
PSM	GPSSEGPEEEDGEGFSFK	70	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=13555	64.885	2	1883.7697	1883.7697	K	Y	125	143
PSM	GSDALSETSSVSHIEDLEK	71	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=17026	82.047	2	2082.8994	2082.8994	R	V	622	641
PSM	KELSQNTDESGLNDEAIAK	72	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=9984	48.562	2	2140.9525	2140.9525	R	Q	187	206
PSM	KETESEAEDNLDDLEK	73	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=9727	47.396	2	1943.7885	1943.7885	K	H	868	884
PSM	KNSSTDQGSDEEGSLQK	74	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=1689	10.797	2	1888.7688	1888.7688	R	E	1060	1077
PSM	LEGLGSSEADQDGLASTVR	75	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14313	68.322	2	1903.9123	1903.9123	R	S	455	474
PSM	LLGSAAEEEEEEEEDGK	76	sp|Q86U38-2|NOP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10108	49.124	2	1862.7905	1862.7905	R	D	156	173
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	77	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11206	53.97	3	3045.258	3045.2580	R	V	320	347
PSM	PFPSEETTENDDDVYR	78	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12129	58.105	2	1912.7963	1912.7963	R	S	128	144
PSM	PVIVEPLEQLDDEDGLPEK	79	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=21637	108.4	2	2134.0681	2134.0681	R	L	444	463
PSM	SLSKSDSDLLTCSPTEDATMGSR	80	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14013	66.954	2	2553.0612	2553.0612	R	S	622	645
PSM	SQSSHSYDDSTLPLIDR	81	sp|O60716-32|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=15820	75.319	2	1999.8524	1999.8524	R	N	530	547
PSM	SSSMSSIDLVSASDDVHR	82	sp|Q9Y5P4|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13065	62.547	2	1987.8194	1987.8194	R	F	375	393
PSM	STIGVMVTASHNPEEDNGVK	83	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=12886	61.749	2	2163.9508	2163.9508	K	L	55	75
PSM	SYEDLTESEDGAASGDSHK	84	sp|Q86VX9-5|MON1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=8321	41.274	2	2076.7797	2076.7797	R	E	56	75
PSM	VMSSSNPDLAGTHSAADEEVK	85	sp|Q8NF50-4|DOCK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=7390	37.084	2	2239.9304	2239.9304	R	N	832	853
PSM	VSESEGKLEGQATAVTPNK	86	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=9772	47.588	2	2023.9463	2023.9463	K	N	12	31
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	87	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:21,34-UNIMOD:35	ms_run[1]:scan=10181	49.43504333333333	3	4214.397093	4214.396954	K	A	142	177
PSM	QSLSSADNLESDAQGHQVAAR	88	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=14611	69.65603	2	2245.9595	2245.9596	R	F	345	366
PSM	AQSPVITTTAAHATDSALSR	89	sp|Q9H0E3-3|SP130_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=14173	67.686	2	2076.9841	2076.9841	R	P	298	318
PSM	DKEEIFGSDADSEDDADSDDEDR	90	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=11193	53.911	3	2653.9301	2653.9301	R	G	449	472
PSM	DPDAQPGGELMLGGTDSK	91	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=11410	54.839	2	1802.7993	1802.7993	R	Y	236	254
PSM	EELMSSDLEETAGSTSIPK	92	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=15518	74.034	2	2118.8916	2118.8916	K	R	515	534
PSM	ELDALDANDELTPLGR	93	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19317	94.237	2	1740.853	1740.8530	R	I	838	854
PSM	GGVTGSPEASISGSKGDLK	94	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=8969	44.07	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GIINDDEDDEDLMMASGR	95	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=12691	60.835	2	2026.8096	2026.8096	K	P	352	370
PSM	GRESDEDTEDASETDLAK	96	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=5704	29.437	2	2046.7903	2046.7903	R	H	42	60
PSM	GSSQPNLSTSHSEQEYGK	97	sp|O95208-3|EPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=5634	29.138	2	2014.8269	2014.8269	R	A	132	150
PSM	IEDDMDGGDWSFCDGR	98	sp|P23229-7|ITA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=14838	70.74	2	1889.6832	1889.6832	R	L	49	65
PSM	ILGENEEEEDLAESGR	99	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12929	61.941	2	1788.8014	1788.8014	R	L	388	404
PSM	IQPDSHSLSYGTLPDGSDSTK	100	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=13234	63.37	2	2283.9897	2283.9897	K	S	354	375
PSM	KAEQGSEEEGEGEEEEEEGGESK	101	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=2784	16.123	2	2560.945	2560.9450	K	A	223	246
PSM	KETESEAEDNLDDLEK	102	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=12278	58.825	2	1943.7885	1943.7885	K	H	868	884
PSM	KTSASDVTNIYPGDAGK	103	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=10474	50.761	2	1802.8088	1802.8088	K	A	491	508
PSM	LPDSDDDEDEETAIQR	104	sp|Q96K21-4|ANCHR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9028	44.327	2	1846.7705	1846.7705	R	V	176	192
PSM	LQSPIKEENTTAVEEIGR	105	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=13607	65.127	2	2093.0042	2093.0042	K	T	89	107
PSM	LYGSAGPPPTGEEDTAEKDEL	106	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13384	64.065	2	2174.9855	2174.9855	K	-	634	655
PSM	MMDYLQGSGETPQTDVR	107	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=10542	51.031	2	1958.835	1958.8350	K	W	360	377
PSM	PFPSEETTENDDDVYR	108	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11907	57.102	2	1912.7963	1912.7963	R	S	128	144
PSM	PVPAAPVPSPVAPAPVPSR	109	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=14615	69.675	2	1884.9863	1884.9863	K	R	77	96
PSM	SDSHGLSSSLTDSSSPGVGASCR	110	sp|O75044|SRGP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=11202	53.949	2	2329.9482	2329.9482	R	P	852	875
PSM	SPPASSAASADQHSQSGSSSDNTER	111	sp|Q8IY57-3|YAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=1043	7.7887	3	2540.0049	2540.0049	K	G	94	119
PSM	SSSPAELDLKDDLQQTQGK	112	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=15142	72.211	2	2138.9733	2138.9733	R	C	819	838
PSM	TCEERPAEDGSDEEDPDSMEAPTR	113	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=5182	27.087	3	2818.0219	2818.0219	R	I	4	28
PSM	ADFTVVAGDEGSSTTGGSSEENKGPSGSAVSR	114	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:21	ms_run[2]:scan=11937	57.237	3	3122.3313	3122.3313	K	K	749	781
PSM	ATEDEGSEQKIPEATNR	115	sp|P01008|ANT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=4946	26.099	2	1953.8317	1953.8317	K	R	62	79
PSM	DHTPSQELALTQSVGGDSSADR	116	sp|Q86U44|MTA70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=14063	67.188	2	2350.0074	2350.0074	K	L	346	368
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	117	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=12423	59.523	3	3322.2318	3322.2318	K	D	929	958
PSM	DPDAQPGGELMLGGTDSK	118	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:35	ms_run[2]:scan=11170	53.816	2	1802.7993	1802.7993	R	Y	236	254
PSM	EAQAALAEAQEDLESER	119	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17167	82.806	2	1858.8545	1858.8545	R	V	1132	1149
PSM	EDALDDSVSSSSVHASPLASSPVR	120	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=14720	70.171	2	2492.1068	2492.1068	R	K	2231	2255
PSM	FGIVTSSAGTGTTEDTEAK	121	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11225	54.043	2	1870.8796	1870.8796	R	K	181	200
PSM	GAVAAEGASDTEREEPTESQGLAAR	122	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=9320	45.593	3	2581.1293	2581.1293	R	L	907	932
PSM	GDQPAASGDSDDDEPPPLPR	123	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11326	54.457	2	2034.8767	2034.8767	R	L	48	68
PSM	GNAEGSSDEEGKLVIDEPAK	124	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=11001	53.106	2	2123.926	2123.9260	K	E	127	147
PSM	GNAEGSSDEEGKLVIDEPAK	125	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=11251	54.145	2	2123.926	2123.9260	K	E	127	147
PSM	GPPQEEEEEEDEEEEATK	126	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=7345	36.88	2	2102.8288	2102.8288	R	E	209	227
PSM	GSDALSETSSVSHIEDLEK	127	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=15549	74.169	2	2082.8994	2082.8994	R	V	622	641
PSM	GTGGVDTAATGGVFDISNLDR	128	sp|P12532|KCRU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=20651	101.99	2	2021.9654	2021.9654	R	L	354	375
PSM	GVGIISEGNETVEDIAAR	129	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19127	93.137	2	1828.9167	1828.9167	K	L	630	648
PSM	IYISNTFSPSKAEGDSAGTAGTPGGTPAGDK	130	sp|Q92925-3|SMRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=15093	71.971	3	3033.3605	3033.3605	R	V	148	179
PSM	KETESEAEDNLDDLEK	131	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=11399	54.791	2	1943.7885	1943.7885	K	H	868	884
PSM	KLSGDQITLPTTVDYSSVPK	132	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=18994	92.375	2	2228.0977	2228.0977	R	Q	34	54
PSM	KSLDSDESEDEEDDYQQK	133	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=6257	31.86	2	2238.8325	2238.8325	K	R	56	74
PSM	LCSSSDTLVSEGEENQKPK	134	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=9315	45.57	2	2186.9403	2186.9403	R	K	800	819
PSM	LEGDSDDLLEDSDSEEHSR	135	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=10939	52.815	2	2226.8438	2226.8438	K	S	469	488
PSM	LEGLGSSEADQDGLASTVR	136	sp|Q07065|CKAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14688	70.006	2	1903.9123	1903.9123	R	S	455	474
PSM	LSEAVWQPEEHYSSSPEK	137	sp|Q9Y485|DMXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=14470	69.024	2	2181.9256	2181.9256	K	I	904	922
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	138	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10644	51.469	3	3061.253	3061.2530	R	V	320	347
PSM	NKSESQCDEDGMTSSLSESLK	139	sp|Q92574|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=9156	44.886	3	2426.9455	2426.9455	R	T	1098	1119
PSM	PFPSEETTENDDDVYR	140	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12336	59.115	2	1912.7963	1912.7963	R	S	128	144
PSM	RVSGEPQQSGDGSLSPQAEAIEVAAGESAGR	141	sp|Q96NY7-2|CLIC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=18157	87.889	3	3119.4157	3119.4157	R	S	291	322
PSM	SGSPSDNSGAEEMEVSLAKPK	142	sp|P31749-2|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=8769	43.171	2	2214.9352	2214.9352	R	H	60	81
PSM	SIFDDDMDDIFSSGIQAK	143	sp|Q641Q2-2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:35	ms_run[2]:scan=21735	109.07	2	2018.8779	2018.8779	K	T	1268	1286
PSM	SQSESSDEVTELDLSHGK	144	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=11950	57.294	2	2026.8368	2026.8368	R	K	657	675
PSM	SQVSEDGTLRSLEPEPQQSLEDGSPAK	145	sp|Q8IV36-3|HID1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=15579	74.303	3	2963.3397	2963.3397	K	G	402	429
PSM	SSPPAPPLPPGSGSPGTPQALPR	146	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=15622	74.497	2	2244.094	2244.0940	R	R	585	608
PSM	TAKDSDDDDDVAVTVDR	147	sp|Q16623-3|STX1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=7462	37.427	2	1915.7684	1915.7684	R	D	10	27
PSM	TCDSITPSKSSPVPVSDTQK	148	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=7842	39.119	2	2212.9923	2212.9923	R	L	190	210
PSM	TEEPLGSPHPSGTVESPGEGPQDTR	149	sp|Q9NWS9-2|ZN446_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=10473	50.758	3	2640.1341	2640.1341	K	I	131	156
PSM	TGRDTPENGETAIGAENSEK	150	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=4980	26.233	2	2154.9066	2154.9067	K	I	475	495
PSM	TPTGNAPSSESDIDISSPNVSHDESIAK	151	sp|O95251-4|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=13630	65.232	3	2934.2768	2934.2768	R	D	128	156
PSM	VAGTGEGGLEEMVEELNSGK	152	sp|Q9UJU6-6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:35	ms_run[2]:scan=17153	82.733	2	2020.9259	2020.9259	R	V	42	62
PSM	VDPSLMEDSDDGPSLPTK	153	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15330	73.142	2	1901.8564	1901.8564	K	Q	87	105
PSM	VGDAIPAVEVFEGEPGNK	154	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=20288	99.812	2	1826.905	1826.9050	K	V	6	24
PSM	VPDEEENEESDNEKETEK	155	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=2219	13.429	2	2228.8482	2228.8482	K	S	1097	1115
PSM	YVTKPNSDDEDDGDEK	156	sp|P51784|UBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=1639	10.554	2	1905.7153	1905.7153	R	E	642	658
PSM	AAAAAAAPSGGGGGGEEERLEEK	157	sp|P51608-2|MECP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1	ms_run[1]:scan=9803	47.7201	2	2125.9858	2125.9871	M	S	2	25
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	158	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6797	34.258475	3	3007.3321	3007.3290	K	S	145	174
PSM	EREESEDELEEANGNNPIDIEVDQNK	159	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	5-UNIMOD:21	ms_run[1]:scan=16921	81.52801	3	3095.276504	3094.288807	R	E	256	282
PSM	AATEALGEKSPDSATVSGYDIMK	160	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=12847	61.576	2	2436.0768	2436.0768	K	S	930	953
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	161	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14094	67.318	3	2789.2772	2789.2772	R	T	112	140
PSM	AVTSGHYVLSESQSELEEK	162	sp|Q9NQV6-6|PRD10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=12922	61.914	2	2171.9624	2171.9624	K	Q	1086	1105
PSM	CTLPEHESPSQDISDACEAESTER	163	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13932	66.566	3	2827.095	2827.0950	R	C	670	694
PSM	DDDDIDLFGSDDEEESEEAKR	164	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=17118	82.554	2	2507.9337	2507.9337	K	L	97	118
PSM	DPHSPEDEEQPQGLSDDDILR	165	sp|Q86VM9-2|ZCH18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=15756	75.087	2	2471.0126	2471.0126	R	D	10	31
PSM	DSSESQLASTESDKPTTGR	166	sp|Q96B23-2|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=5312	27.7	2	2074.8692	2074.8692	R	V	65	84
PSM	EMEHNTVCAAGTSPVGEIGEEK	167	sp|P18583-2|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:35,8-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=10449	50.654	3	2439.9924	2439.9924	K	I	1225	1247
PSM	EMLASDDEEDVSSKVEK	168	sp|Q0ZGT2-4|NEXN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=9703	47.297	2	2005.8075	2005.8075	K	A	12	29
PSM	ESTQLSPADLTEGKPTDPSK	169	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=12177	58.329	2	2179.9886	2179.9886	R	L	215	235
PSM	GEALSALDSKANNLSSLSK	170	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=17529	84.697	2	1983.9514	1983.9514	R	K	160	179
PSM	GIVDQSQQAYQEAFEISK	171	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=20410	100.56	2	2039.98	2039.9800	K	K	140	158
PSM	HGSGADSDYENTQSGDPLLGLEGK	172	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=17747	85.795	3	2526.0548	2526.0548	R	R	590	614
PSM	IAEPNLDTADKEDTASEK	173	sp|Q5T8I3-2|F102B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=9061	44.453	2	2025.878	2025.8780	K	L	261	279
PSM	IEDVGSDEEDDSGKDK	174	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=4588	24.502	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	175	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=5064	26.587	2	1816.6888	1816.6888	K	K	250	266
PSM	IETDEEESCDNAHGDANQPAR	176	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3482	19.427	2	2436.9125	2436.9125	R	D	1303	1324
PSM	IPATEQTNQVIEKASDSEEPEEK	177	sp|Q9C0E8-2|LNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=10150	49.306	3	2651.1851	2651.1851	K	Q	365	388
PSM	IVSSSDVGHDEYSTQSLVK	178	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=13600	65.098	2	2129.9518	2129.9518	K	K	766	785
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	179	sp|Q66K14-2|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=11914	57.134	3	3259.4882	3259.4882	R	Q	409	441
PSM	KEESEESDDDMGFGLFD	180	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=18811	91.374	2	1964.7469	1964.7469	K	-	99	116
PSM	KETESEAEDNLDDLEK	181	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=8844	43.515	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	182	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=12931	61.948	2	1943.7885	1943.7885	K	H	868	884
PSM	KTSLVIVESADNQPETCER	183	sp|Q01484-7|ANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12251	58.685	2	2255.0141	2255.0141	R	L	410	429
PSM	LEGPVSPDVEPGKEETEESK	184	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=10298	49.971	2	2234.9832	2234.9832	K	K	1666	1686
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	185	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=9333	45.646	3	2796.2339	2796.2339	K	K	68	94
PSM	MADTSSMDEDFESDYKK	186	sp|Q8NFA0|UBP32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:35,6-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=8015	39.844	2	2109.7432	2109.7432	K	Y	1583	1600
PSM	NDQEPPPEALDFSDDEKEK	187	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=13693	65.526	2	2281.9264	2281.9264	K	E	303	322
PSM	QVAGDAPVEQATAETASPVHR	188	sp|Q92766-4|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=9636	47.014	2	2213.0114	2213.0114	R	E	95	116
PSM	RASVCAEAYNPDEEEDDAESR	189	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9637	47.018	2	2491.9435	2491.9435	R	I	112	133
PSM	RGPNYTSGYGTNSELSNPSETESER	190	sp|P51114|FXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=10827	52.29	3	2891.1284	2891.1284	R	K	391	416
PSM	SAEIDSDDTGGSAAQK	191	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=1843	11.528	2	1550.6696	1550.6696	K	Q	814	830
PSM	SEAGHASSPDSEVTSLCQK	192	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=9532	46.536	2	2068.8409	2068.8409	K	E	353	372
PSM	SKILLSSSGCSADIDSGK	193	sp|Q6P9F7|LRC8B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=10778	52.073	2	1903.8598	1903.8598	K	Q	186	204
PSM	SPADELSHCVEPEPSQVPGGSSR	194	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=12852	61.599	2	2501.053	2501.0530	R	D	318	341
PSM	SPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASK	195	sp|O15117|FYB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	26-UNIMOD:21	ms_run[2]:scan=14236	67.982	3	4159.6411	4159.6411	K	E	432	470
PSM	SQEPIPDDQKVSDDDK	196	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=5792	29.807	2	1894.7833	1894.7833	K	E	415	431
PSM	SSVKTPETVVPTAPELQASASTDQPVTSEPTSR	197	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=16465	79.159	3	3476.656	3476.6560	R	T	1481	1514
PSM	STGDIAGTVVPETNKEPR	198	sp|Q9UDY2-3|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=11584	55.641	2	1949.9096	1949.9096	K	Y	438	456
PSM	TIASDSEEEAGKELSDK	199	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=8517	42.066	2	1887.7987	1887.7987	K	K	435	452
PSM	TNSDSALHTSALSTK	200	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=6901	34.724	2	1611.7141	1611.7141	R	P	160	175
PSM	VADAKGDSESEEDEDLEVPVPSR	201	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=13698	65.55	2	2552.0803	2552.0803	R	F	71	94
PSM	VADGLPLAASMQEDEQSGR	202	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:35	ms_run[2]:scan=12089	57.926	2	1988.9109	1988.9109	R	D	10	29
PSM	VASGSDLHLTDIDSDSNR	203	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=13439	64.327	2	1980.8426	1980.8426	K	G	70	88
PSM	VEEEGSPGDPDHEASTQGR	204	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=2768	16.039	2	2075.8069	2075.8069	K	T	310	329
PSM	VLAVNQENEQLMEDYEK	205	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:35	ms_run[2]:scan=13672	65.431	2	2066.9467	2066.9467	K	L	265	282
PSM	VTQHESDNENEIQIQNK	206	sp|Q5VZL5-2|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=6110	31.225	2	2104.9063	2104.9063	R	L	117	134
PSM	YDAFGEDSSSAMGVENR	207	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:35	ms_run[2]:scan=10392	50.39	2	1849.7425	1849.7425	R	A	372	389
PSM	YLVVNADEGEPGTCK	208	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:4	ms_run[2]:scan=10879	52.528	2	1650.7559	1650.7559	K	D	103	118
PSM	QKSDAEEDGGTVSQEEEDR	209	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=6104	31.199790000000004	2	2170.8180	2170.8170	K	K	552	571
PSM	PDAQPGGELMLGGTDSK	210	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	10-UNIMOD:35	ms_run[1]:scan=10412	50.48310333333333	2	1687.7713	1687.7718	D	Y	237	254
PSM	QVAGDAPVEQATAETASPVHR	211	sp|Q92766|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,17-UNIMOD:21	ms_run[1]:scan=12740	61.099758333333334	2	2195.9853	2195.9843	R	E	1304	1325
PSM	AGLESGAEPGDGDSDTTKK	212	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=3379	18.968	2	1913.7892	1913.7892	K	K	481	500
PSM	APSEEELHGDQTDFGQGSQSPQK	213	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=9556	46.655	3	2551.05	2551.0500	K	Q	68	91
PSM	CECDDGFTGADCGELK	214	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=11076	53.438	2	1832.6651	1832.6652	R	C	392	408
PSM	CTLPEHESPSQDISDACEAESTER	215	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13699	65.553	3	2827.095	2827.0950	R	C	670	694
PSM	DKEEIFGSDADSEDDADSDDEDR	216	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=11470	55.123	3	2653.9301	2653.9301	R	G	449	472
PSM	EDAGDNDDTEGAIGVR	217	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6758	34.062	2	1632.6863	1632.6863	R	N	377	393
PSM	EDALDDSVSSSSVHASPLASSPVR	218	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=15594	74.375	2	2492.1068	2492.1068	R	K	2231	2255
PSM	EESPLLIGQQSTVSDVPR	219	sp|P02751-4|FINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17202	82.997	2	1954.0007	1954.0007	R	D	1435	1453
PSM	EILGTAQSVGCNVDGR	220	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=12114	58.036	2	1674.7995	1674.7995	K	H	98	114
PSM	ELVSSSSSGSDSDSEVDKK	221	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=4028	21.877	2	2021.8314	2021.8314	K	L	6	25
PSM	ESEDDLNKESEEEVGPTK	222	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=6210	31.67	2	2113.8576	2113.8576	K	E	520	538
PSM	FNAVLTNPQGDYDTSTGK	223	sp|P02747|C1QC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13874	66.308	2	1926.8959	1926.8959	R	F	140	158
PSM	FSGEEGEIEDDESGTENREEK	224	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=8274	41.069	2	2464.9391	2464.9391	K	D	927	948
PSM	GAAEEAELEDSDDEEKPVK	225	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=7759	38.741	2	2139.8733	2139.8733	K	Q	88	107
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	226	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21,29-UNIMOD:21	ms_run[2]:scan=13802	65.997	3	3371.3239	3371.3239	R	S	1160	1192
PSM	GKLSAEENPDDSEVPSSSGINSTK	227	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=9823	47.824	2	2527.0963	2527.0963	K	S	40	64
PSM	GSSQPNLSTSHSEQEYGK	228	sp|O95208-3|EPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=5409	28.123	2	2014.8269	2014.8269	R	A	132	150
PSM	IAQLEEELEEEQGNTELINDR	229	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=20220	99.421	3	2471.1664	2471.1664	R	L	1731	1752
PSM	IDCDNLEQYFIQQGGGPDK	230	sp|Q92499-3|DDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4	ms_run[2]:scan=20942	103.83	2	2195.9793	2195.9793	K	K	389	408
PSM	IEDVGSDEEDDSGKDK	231	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=3691	20.372	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEVLSPEGSPSKSPSK	232	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=8879	43.676	2	1849.871	1849.8710	K	K	636	653
PSM	KAEQGSEEEGEGEEEEEEGGESK	233	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=2752	15.971	3	2560.945	2560.9450	K	A	223	246
PSM	KETESEAEDNLDDLEK	234	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=13145	62.953	2	1943.7885	1943.7885	K	H	868	884
PSM	KQSFDDNDSEELEDK	235	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=7668	38.347	2	1877.7204	1877.7204	K	D	105	120
PSM	KVSVSESNVLLDEEVLTDPK	236	sp|P21359-2|NF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=20996	104.16	2	2280.1138	2280.1138	R	I	2574	2594
PSM	LASGEDDPFDSDFSCPVK	237	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=18238	88.284	2	1984.836	1984.8360	K	L	377	395
PSM	LESIDNHSSTGGQSDQGYGSK	238	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=5678	29.326	3	2245.9125	2245.9125	R	D	951	972
PSM	LGIYDADGDGDFDVDDAK	239	sp|Q12797-7|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17881	86.467	2	1899.801	1899.8010	K	V	102	120
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	240	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10871	52.488	3	3061.253	3061.2530	R	V	320	347
PSM	NTDVAQSPEAPKQEAPAK	241	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=3389	19.014	2	1959.8939	1959.8939	R	K	179	197
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	242	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=5204	27.184	3	3336.3553	3336.3553	R	R	157	186
PSM	PSWADQVEEEGEDDK	243	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12990	62.212	2	1732.7064	1732.7064	K	C	10	25
PSM	QFEQNDLSFVGQDVDGDR	244	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17563	84.862	2	2067.9134	2067.9134	K	M	491	509
PSM	SDAEEDGGTVSQEEEDR	245	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=4817	25.516	2	1931.6906	1931.6906	K	K	446	463
PSM	SEDFGVNEDLADSDAR	246	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14108	67.382	2	1738.7282	1738.7282	R	A	189	205
PSM	SETAPAETATPAPVEKSPAK	247	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=5597	28.964	2	2060.9667	2060.9667	M	K	2	22
PSM	SIEDDEEGHLICQSGDVLR	248	sp|Q9HAZ1|CLK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=17297	83.501	2	2250.9464	2250.9464	R	A	138	157
PSM	SISSPSVSSETMDKPVDLSTR	249	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=12406	59.447	2	2318.0349	2318.0349	K	K	2802	2823
PSM	SKSGSEEVLCDSCIGNK	250	sp|Q14134-2|TRI29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9875	48.066	2	1948.7908	1948.7908	R	Q	164	181
PSM	SLGDDISSETSGDFR	251	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13028	62.374	2	1584.6904	1584.6904	K	K	139	154
PSM	SNTISKPYISNTLPSDAPK	252	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=14196	67.795	2	2112.014	2112.0140	R	K	273	292
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	253	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=13165	63.04	3	3059.1789	3059.1789	R	S	373	399
PSM	SSTPSHGQTTATEPTPAQK	254	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=1559	10.16	2	2004.879	2004.8790	R	T	153	172
PSM	TCEERPAEDGSDEEDPDSMEAPTR	255	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8285	41.118	3	2802.027	2802.0270	R	I	4	28
PSM	TEDSDDIHFEPVVQMPEK	256	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15210	72.535	3	2210.9079	2210.9079	K	V	2005	2023
PSM	TEPHDSDCSVDLGISK	257	sp|Q96RT1-7|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10615	51.34	2	1838.7394	1838.7394	R	S	836	852
PSM	THSVNGITEEADPTIYSGK	258	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=13561	64.912	2	2097.9256	2097.9256	K	V	551	570
PSM	VDPSLMEDSDDGPSLPTK	259	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:35	ms_run[2]:scan=12347	59.166	2	1917.8514	1917.8514	K	Q	87	105
PSM	VELKSEANDAVNSSTK	260	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=9561	46.678	2	1770.8037	1770.8037	K	E	113	129
PSM	VLLGEEEALEDDSESR	261	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15538	74.121	2	1789.8218	1789.8218	K	S	443	459
PSM	VSTHSQEMDSGTEYGMGSSTK	262	sp|Q9UKE5-8|TNIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,8-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=2359	14.14	2	2329.8716	2329.8716	R	A	858	879
PSM	YAGVFAENAEDADGK	263	sp|Q96EU7|C1GLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11388	54.743	2	1555.6791	1555.6791	K	D	229	244
PSM	QKSDAEEDGGTVSQEEEDR	264	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=6627	33.46311	2	2170.8185	2170.8170	K	K	552	571
PSM	GAVAAEGASDTEREEPTESQGLAAR	265	sp|Q9P1Y6|PHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=10021	48.73916	3	2582.114904	2581.129334	R	L	907	932
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	266	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11310	54.395543333333336	3	3062.246335	3061.252957	R	V	320	347
PSM	LTVVDTPGYGDAINCR	267	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:4	ms_run[1]:scan=14914	71.10368833333332	2	1749.825340	1749.835585	R	D	97	113
PSM	AAPEASSPPASPLQHLLPGK	268	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19071	92.81	2	2126.9803	2126.9803	K	A	673	693
PSM	AGLESGAEPGDGDSDTTKK	269	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=3601	19.984	2	1913.7892	1913.7892	K	K	481	500
PSM	AIEQADLLQEEDESPR	270	sp|P61966|AP1S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14193	67.78	2	1841.8643	1841.8643	K	S	134	150
PSM	CTLPEHESPSQDISDACEAESTER	271	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13955	66.686	2	2827.095	2827.0950	R	C	670	694
PSM	DNDSDDVESNLLLPAGIALR	272	sp|Q9NZM1-5|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23755	123.61	2	2126.0491	2126.0491	R	W	337	357
PSM	DSAEGNDSYPSGIHLELQR	273	sp|P50443|S26A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=16651	80.131	2	2166.9219	2166.9219	R	E	15	34
PSM	DSTSQHDDDNISTTSGFSSR	274	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=8211	40.746	2	2235.8553	2235.8553	K	A	171	191
PSM	EDALDDSVSSSSVHASPLASSPVR	275	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:21	ms_run[2]:scan=15164	72.312	3	2492.1068	2492.1068	R	K	2231	2255
PSM	EEEEKESDSDSEGPIQYR	276	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=7896	39.345	2	2205.8587	2205.8587	R	D	492	510
PSM	EEFGAEPELAVSAPGR	277	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15749	75.059	2	1657.7948	1657.7948	R	V	22	38
PSM	EKPDSDDDLDIASLVTAK	278	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=20682	102.19	2	2010.9035	2010.9035	R	L	655	673
PSM	ELVSSSSSGSDSDSEVDKK	279	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=3777	20.758	2	2021.8314	2021.8314	K	L	6	25
PSM	EPHSPADQPEQQAESTLTSAETR	280	sp|Q9H2Y7-2|ZN106_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=14482	69.079	3	2588.1028	2588.1028	K	G	553	576
PSM	ESTQLSPADLTEGKPTDPSK	281	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=12626	60.521	2	2179.9886	2179.9886	R	L	215	235
PSM	FDVPGDENAEMDAR	282	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=10558	51.098	2	1580.6413	1580.6413	K	T	1369	1383
PSM	FEGLEADADDSNTR	283	sp|Q86VI3|IQGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9610	46.9	2	1538.6485	1538.6485	K	S	1350	1364
PSM	FGESEEVEMEVESDEEDDKQEK	284	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=13801	65.994	2	2712.0157	2712.0157	K	A	252	274
PSM	GGDDHDDTSDSDSDGLTLK	285	sp|Q9BTC0-2|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=8075	40.101	2	2028.7433	2028.7433	K	E	144	163
PSM	GPGDTSNFDDYEEEEIR	286	sp|P17612-2|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14755	70.343	2	1971.797	1971.7970	K	V	313	330
PSM	GPPSPGPAAQPPAPPR	287	sp|Q9NZV5-2|SELN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=8089	40.166	2	1572.745	1572.7450	R	R	10	26
PSM	IEDVGSDEEDDSGKDK	288	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=1110	8.0862	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	289	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=1980	12.236	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	290	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=2384	14.263	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	291	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=3467	19.36	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	292	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4344	23.404	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	293	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=3917	21.383	2	1816.6888	1816.6888	K	K	250	266
PSM	LDEDEDEDDADLSK	294	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6252	31.84	2	1607.6322	1607.6322	K	Y	169	183
PSM	LFDEEEDSSEKLFDDSDER	295	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=16906	81.451	2	2383.9217	2383.9217	K	G	706	725
PSM	LFEESDDKEDEDADGK	296	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=6993	35.157	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	297	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=7203	36.157	2	1920.715	1920.7150	K	E	672	688
PSM	LLGSAAEEEEEEEEDGK	298	sp|Q86U38-2|NOP9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9114	44.69	2	1862.7905	1862.7905	R	D	156	173
PSM	LNQVCFDDDGTSSPQDR	299	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4	ms_run[2]:scan=10597	51.266	2	1952.817	1952.8170	K	L	295	312
PSM	LPEEVATPTTDEEKDSLIAIDR	300	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=18190	88.053	3	2521.1837	2521.1837	K	S	351	373
PSM	LSKSNIDISSGLEDEEPK	301	sp|Q9BZ71-3|PITM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=15099	71.996	2	2039.93	2039.9300	R	R	282	300
PSM	LSLEGDHSTPPSAYGSVK	302	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=12796	61.346	2	1923.8615	1923.8615	K	A	29	47
PSM	LSSASTGKPPLSVEDDFEK	303	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=15609	74.437	2	2085.9507	2085.9507	R	L	757	776
PSM	LSSGFDDIDLPSAVK	304	sp|Q9Y446|PKP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19593	95.755	2	1562.7828	1562.7828	R	Y	312	327
PSM	LVFNPDQEDLDGDGR	305	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15607	74.429	2	1688.7642	1688.7642	R	G	914	929
PSM	LYGSAGPPPTGEEDTAEKDEL	306	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14273	68.148	2	2174.9855	2174.9855	K	-	634	655
PSM	MESSFGSPSKQESSESLPK	307	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=9177	44.979	2	2136.8922	2136.8922	K	E	471	490
PSM	MEVEDGLGSPKPEEIK	308	sp|Q71F56|MD13L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=10826	52.286	2	1852.8166	1852.8166	K	D	915	931
PSM	NEEPSEEEIDAPKPK	309	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=6722	33.902	2	1790.7612	1790.7612	K	K	49	64
PSM	NFDDEDSVDGNRPSSASSTSSK	310	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=5823	29.935	2	2380.9292	2380.9292	K	A	240	262
PSM	NLTSSSLNDISDKPEK	311	sp|Q9Y6R1-3|S4A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=11276	54.252	2	1826.8299	1826.8299	R	D	208	224
PSM	PVTVEPMDQLDDEEGLPEK	312	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:35	ms_run[2]:scan=14373	68.594	2	2155.9831	2155.9831	R	L	132	151
PSM	RVSVCAETYNPDEEEEDTDPR	313	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11451	55.023	3	2590.0167	2590.0167	R	V	97	118
PSM	SDGLPWCSTTANYDTDDR	314	sp|P14780|MMP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4	ms_run[2]:scan=16612	79.937	2	2072.8382	2072.8382	R	F	250	268
PSM	SDSPVPTAPTSGGPKPSTASAVPELATDPELEK	315	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=17392	84.031	3	3312.565	3312.5650	R	K	48	81
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	316	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=15808	75.279	3	2927.271	2927.2710	K	K	158	184
PSM	SHVTEEEEEEEEEESDS	317	sp|O75971-2|SNPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=3747	20.626	2	2101.7009	2101.7009	K	-	52	69
PSM	SLLEGQEDHYNNLSASK	318	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=12738	61.089	2	1983.8575	1983.8575	R	V	382	399
PSM	SNLCALCIGDEQGENK	319	sp|P02788-2|TRFL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=13569	64.953	2	1806.7876	1806.7876	R	C	476	492
PSM	SNSQENVEASHPSQDGK	320	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=1105	8.0656	2	1892.7538	1892.7538	R	R	555	572
PSM	SQAGGACDCGDSNVMR	321	sp|Q6ZT12|UBR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=1149	8.2588	2	1699.6349	1699.6349	R	E	164	180
PSM	SQAGGACDCGDSNVMR	322	sp|Q6ZT12|UBR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3634	20.121	2	1683.6399	1683.6399	R	E	164	180
PSM	SSAGDTEFVHQNSQEIQR	323	sp|O43164-2|PJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=8778	43.216	2	2111.8909	2111.8909	K	S	241	259
PSM	SSEDLAGPLPSSVSSSSTTSSKPK	324	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11930	57.208	2	2415.1054	2415.1054	R	L	125	149
PSM	SSGESSPSEHSSSGVSTPCLK	325	sp|Q9Y3M8-5|STA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=7152	35.912	3	2185.8835	2185.8835	K	E	321	342
PSM	SSSQPSSCCSDPSKPGGNVEGATQSLAEQMR	326	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,30-UNIMOD:35	ms_run[2]:scan=11321	54.439	3	3334.3537	3334.3538	K	K	198	229
PSM	STPSHGSVSSLNSTGSLSPK	327	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=9428	46.067	2	2008.9103	2008.9103	R	H	238	258
PSM	SVSESHTSCPAESASDAAPLQR	328	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8619	42.503	2	2365.9846	2365.9846	K	S	96	118
PSM	TCEERPAEDGSDEEDPDSMEAPTR	329	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=4706	25.039	3	2818.0219	2818.0219	R	I	4	28
PSM	TPAVEGLTEAEEEELR	330	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17438	84.272	2	1771.8476	1771.8476	R	A	12	28
PSM	TQEISRPNSPSEGEGESSDSR	331	sp|Q9P2R6-2|RERE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=3958	21.564	3	2327.9503	2327.9503	K	S	117	138
PSM	TTKTPEDGDYSYEIIEK	332	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=13915	66.49	2	2067.8926	2067.8926	K	T	1929	1946
PSM	TVEVAEGEAVRTPQSVTAK	333	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=9721	47.369	2	2050.9936	2050.9936	R	Q	132	151
PSM	VFDDESDEKEDEEYADEK	334	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=9987	48.577	2	2270.8264	2270.8264	K	G	637	655
PSM	VFVGEEDPEAESVTLR	335	sp|Q86UX7-2|URP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16134	77.381	2	1775.8578	1775.8578	R	V	20	36
PSM	VMSSSNPDLAGTHSAADEEVK	336	sp|Q8NF50-4|DOCK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=9386	45.877	2	2223.9355	2223.9355	R	N	832	853
PSM	VPAAYAGSLCGLCGNYNQDPADDLK	337	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=19369	94.502	3	2668.1898	2668.1898	R	A	2199	2224
PSM	VQEHEDSGDSEVENEAK	338	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=3407	19.088	2	1980.7586	1980.7586	R	G	115	132
PSM	VQVAALQASPPLDQDDR	339	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14704	70.092	2	1821.9221	1821.9221	K	A	99	116
PSM	VTGTEGSSSTLVDYTSTSSTGGSPVRK	340	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:21	ms_run[2]:scan=11480	55.168	2	2740.244	2740.2440	K	S	1221	1248
PSM	VVSPTKEQVSDTEDK	341	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=3967	21.601	2	1740.7819	1740.7819	R	Q	451	466
PSM	ESEDKPEIEDVGSDEEEEK	342	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:27,13-UNIMOD:21	ms_run[1]:scan=10839	52.34361666666667	2	2253.8666	2253.8681	K	K	251	270
PSM	SETAPAETATPAPVEKSPAK	343	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8040	39.949565	2	2102.9793	2102.9768	M	K	2	22
PSM	SETAPAETATPAPVEKSPAKK	344	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6379	32.3703	2	2231.0722	2231.0717	M	K	2	23
PSM	RVSVCAETYNPDEEEEDTDPR	345	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=12073	57.862678333333335	3	2591.002536	2590.016672	R	V	97	118
PSM	QESDPEDDDVKKPALQSSVVATSK	346	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11247	54.13255	3	2635.1897	2635.1897	R	E	98	122
PSM	CGQEEHDVLLSNEEDR	347	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=13341	63.87824333333334	2	1911.7885	1911.7900	K	K	46	62
PSM	AAPEASSPPASPLQHLLPGK	348	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19249	93.817	2	2126.9803	2126.9803	K	A	673	693
PSM	AFVSMVYSEEGAEDR	349	sp|Q14683|SMC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:35	ms_run[2]:scan=12784	61.29	2	1704.7301	1704.7301	R	T	78	93
PSM	AMIVPSSPSKTPEEVSTPAEEEK	350	sp|Q01484-7|ANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=10654	51.515	3	2538.1448	2538.1448	K	L	354	377
PSM	ATSSHFSASEESMDFLDK	351	sp|Q9ULU4-4|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=15003	71.53	2	2083.8082	2083.8082	K	S	78	96
PSM	DASTLQSQKAEGTGDAK	352	sp|O00479|HMGN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=1619	10.467	2	1785.7782	1785.7782	R	-	74	91
PSM	DCDLQEDACYNCGR	353	sp|P62633-7|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8343	41.355	2	1774.6345	1774.6345	K	G	49	63
PSM	DKPEIEDVGSDEEEEK	354	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=8429	41.705	2	1926.7619	1926.7619	K	K	254	270
PSM	EARESPDTQALLTCAEK	355	sp|Q2T9K0-4|TMM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13243	63.413	2	1997.8765	1997.8765	K	E	282	299
PSM	EDALDDSVSSSSVHASPLASSPVR	356	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:21	ms_run[2]:scan=14951	71.276	3	2492.1068	2492.1068	R	K	2231	2255
PSM	EEKGSPLNAAPYGIESMSQDTEVR	357	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=14145	67.558	3	2703.1735	2703.1735	K	S	348	372
PSM	EKPDSDDDLDIASLVTAK	358	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=20519	101.18	2	2010.9035	2010.9035	R	L	655	673
PSM	ELTVSNNDINEAGVR	359	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11583	55.637	2	1629.7958	1629.7958	K	V	174	189
PSM	ESEDKPEIEDVGSDEEEEK	360	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=9043	44.386	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	361	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=9277	45.41	2	2271.8792	2271.8792	K	K	251	270
PSM	GADFLVTEVENGGSLGSK	362	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20393	100.46	2	1778.8687	1778.8687	K	K	174	192
PSM	GCDSPDPDTSYVLTPHTEEK	363	sp|Q02078-3|MEF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=12526	60.042	2	2326.9301	2326.9301	R	Y	95	115
PSM	GCITIIGGGDTATCCAK	364	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12280	58.831	2	1753.7797	1753.7797	R	W	338	355
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	365	sp|Q53TN4-3|CYBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=11095	53.519	3	2725.0997	2725.0997	R	K	189	214
PSM	GSVQYLPDLDDKNSQEK	366	sp|Q9UGM5-2|FETUB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=14491	69.115	2	2014.8885	2014.8885	R	G	265	282
PSM	GVVDSDDLPLNVSR	367	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17494	84.543	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	368	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20775	102.76	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	369	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21549	107.8	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	370	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=26414	145.09	2	1484.7471	1484.7471	K	E	435	449
PSM	IEDSEPHIPLIDDTDAEDDAPTK	371	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=19119	93.09	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEDVGSDEEDDSGKDK	372	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=1569	10.221	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	373	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=2819	16.318	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	374	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3244	18.336	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	375	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=2187	13.257	2	1816.6888	1816.6888	K	K	250	266
PSM	IEENSLKEEESIEGEK	376	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=9869	48.04	2	1941.8456	1941.8456	K	E	1566	1582
PSM	ILEDSGFDEQQEFR	377	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15614	74.459	2	1711.7689	1711.7689	R	S	300	314
PSM	ILGADTSVDLEETGR	378	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14828	70.701	2	1574.7788	1574.7788	R	V	59	74
PSM	IVSSSDVGHDEYSTQSLVK	379	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=12326	59.061	2	2129.9518	2129.9518	K	K	766	785
PSM	KETESEAEDNLDDLEK	380	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=12063	57.817	2	1943.7885	1943.7885	K	H	868	884
PSM	KMSDDEDDDEEEYGK	381	sp|Q7KZ85-3|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=2221	13.436	2	1899.6241	1899.6241	K	E	123	138
PSM	KSEDGTPAEDGTPAATGGSQPPSMGR	382	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=4505	24.136	3	2596.0749	2596.0749	R	K	1185	1211
PSM	KVEEEQEADEEDVSEEEAESK	383	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=6687	33.737	3	2516.9803	2516.9803	K	E	234	255
PSM	LDDDDEGVPSSALR	384	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10440	50.613	2	1487.674	1487.6740	R	E	37	51
PSM	LEQGENVFLQATDK	385	sp|P02746|C1QB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15781	75.183	2	1590.789	1590.7890	K	N	216	230
PSM	LFEESDDKEDEDADGK	386	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=6713	33.86	2	1920.715	1920.7150	K	E	672	688
PSM	LLDPEDVDVPQPDEK	387	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15962	76.237	2	1707.8203	1707.8203	R	S	203	218
PSM	LNESDEQHQENEGTNQLVMGIQK	388	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=12735	61.077	3	2736.1698	2736.1698	K	Q	261	284
PSM	LNQVCFDDDGTSSPQDR	389	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4	ms_run[2]:scan=10365	50.257	2	1952.817	1952.8170	K	L	295	312
PSM	LQQEATEHATESEER	390	sp|Q9Y6C2-2|EMIL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=2136	12.989	2	1836.7527	1836.7527	R	F	18	33
PSM	MADFESGSIKNEEETK	391	sp|Q63HK5|TSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=7439	37.305	2	1909.7653	1909.7653	R	E	85	101
PSM	NFDDEDSVDGNRPSSASSTSSK	392	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=6102	31.193	2	2380.9292	2380.9292	K	A	240	262
PSM	NSLEPQTTVVHNATDGIK	393	sp|Q13555-9|KCC2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=13828	66.105	2	2002.9361	2002.9361	K	G	337	355
PSM	QFEQNDLSFVGQDVDGDR	394	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18120	87.677	2	2067.9134	2067.9134	K	M	491	509
PSM	QSLSSADNLESDAQGHQVAAR	395	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=11564	55.551	2	2262.9866	2262.9866	R	F	345	366
PSM	RCSVTSMESTVSSGTQTTVQDDPEQFEVIK	396	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=16982	81.833	3	3441.4953	3441.4953	R	Q	612	642
PSM	RPPSPDVIVLSDNEQPSSPR	397	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15423	73.582	3	2349.0403	2349.0403	R	V	97	117
PSM	RVSVCAETYNPDEEEEDTDPR	398	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11309	54.393	2	2590.0167	2590.0167	R	V	97	118
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	399	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=15565	74.238	3	2927.271	2927.2710	K	K	158	184
PSM	SGSSQELDVKPSASPQER	400	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=6459	32.738	2	1980.879	1980.8790	R	S	1539	1557
PSM	SGSTSSLSYSTWTSSHSDK	401	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=12925	61.925	2	2083.8372	2083.8372	R	T	197	216
PSM	SISGTSTSEKPNSMDTANTSPFK	402	sp|Q9UJF2|NGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=9531	46.532	2	2482.0571	2482.0571	R	V	16	39
PSM	SKFDSDEEEEDTENVEAASSGK	403	sp|Q8TF01-2|PNISR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=10807	52.204	3	2481.9544	2481.9544	R	V	286	308
PSM	SLGDDISSETSGDFR	404	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14585	69.53	2	1584.6904	1584.6904	K	K	139	154
PSM	SLGDDISSETSGDFR	405	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15241	72.699	2	1584.6904	1584.6904	K	K	139	154
PSM	SLSKSDSDLLTCSPTEDATMGSR	406	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14252	68.054	3	2553.0612	2553.0612	R	S	622	645
PSM	SSGDPEQIKEDSLSEESADAR	407	sp|Q9BVS4-2|RIOK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=9885	48.115	2	2328.9595	2328.9595	R	S	369	390
PSM	SSPSHSTTSGETDPTTIFPCK	408	sp|Q96PN7-2|TREF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=13367	63.992	2	2315.9617	2315.9617	K	E	825	846
PSM	SSSSSSQPEHSAMLVSTAASPSLIK	409	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=15651	74.63	2	2584.1728	2584.1728	K	E	291	316
PSM	STGEAFVQFASQEIAEK	410	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21922	110.33	2	1840.8843	1840.8843	R	A	151	168
PSM	SYQNSPSSDDGIRPLPEYSTEK	411	sp|Q15648|MED1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=13795	65.967	2	2549.0959	2549.0959	K	H	1475	1497
PSM	TCEERPAEDGSDEEDPDSMEAPTR	412	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=4481	24.044	3	2818.0219	2818.0219	R	I	4	28
PSM	TCEERPAEDGSDEEDPDSMEAPTR	413	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=4936	26.054	3	2818.0219	2818.0219	R	I	4	28
PSM	TCEERPAEDGSDEEDPDSMEAPTR	414	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=5450	28.298	3	2818.0219	2818.0219	R	I	4	28
PSM	TEDSDDIHFEPVVQMPEK	415	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15120	72.104	2	2210.9079	2210.9079	K	V	2005	2023
PSM	TEDSDDIHFEPVVQMPEK	416	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=18620	90.421	2	2194.913	2194.9130	K	V	2005	2023
PSM	TIQEVLEEQSEDEDR	417	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15615	74.462	2	1818.8119	1818.8119	R	E	132	147
PSM	TLSQGESQTSEHELFLDTK	418	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=15055	71.773	2	2228.9838	2228.9838	K	I	973	992
PSM	TPSPKEEDEEPESPPEK	419	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=4821	25.536	2	2003.8249	2003.8249	K	K	202	219
PSM	TQLEELEDELQATEDAK	420	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=22136	111.8	2	1960.9113	1960.9113	K	L	1539	1556
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	421	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=13692	65.522	3	2909.304	2909.3040	R	V	1118	1147
PSM	TTSLGDSLNAHSAAEK	422	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7899	39.361	2	1680.7356	1680.7356	R	A	845	861
PSM	VAEEDEDDDGGIMMR	423	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4180	22.566	2	1712.6505	1712.6505	K	S	751	766
PSM	VANPSGNLTETYVQDR	424	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12106	58.002	2	1762.8486	1762.8486	R	G	1297	1313
PSM	VAYEGSDSEKGEGAEPLK	425	sp|P78549-3|NTH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=7026	35.31	2	1944.8354	1944.8354	R	V	51	69
PSM	VESDLKGPEVDIEGPEGK	426	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=14349	68.48	2	1976.898	1976.8980	K	L	4484	4502
PSM	VIPEDASESEEKLDQK	427	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=9528	46.522	2	1895.8401	1895.8401	K	E	915	931
PSM	VIPEDASESEEKLDQK	428	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=9763	47.551	2	1895.8401	1895.8401	K	E	915	931
PSM	VISDSESDIGGSDVEFKPDTK	429	sp|P52701-2|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=14310	68.311	3	2304.0046	2304.0046	R	E	250	271
PSM	VISDSESDIGGSDVEFKPDTK	430	sp|P52701-2|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=14328	68.384	2	2304.0046	2304.0046	R	E	250	271
PSM	VLYVGGLAEEVDDK	431	sp|Q9UNP9-2|PPIE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18090	87.541	2	1505.7613	1505.7613	R	V	7	21
PSM	VSTLAGPSSDDENEEESKPEK	432	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=6031	30.883	2	2326.969	2326.9690	K	E	624	645
PSM	YGLQDSDEEEEEHPSK	433	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=6235	31.775	2	1970.7419	1970.7419	K	T	866	882
PSM	YLEEDNSDESDAEGEHGDGAEEEAPPAGPR	434	sp|Q9H1C4|UN93B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=9899	48.173	3	3251.2324	3251.2324	R	P	541	571
PSM	YNLDASEEEDSNKK	435	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=5660	29.247	2	1720.6829	1720.6829	K	K	183	197
PSM	YPDLYPQEDEDEEEER	436	sp|Q8N4Q1|MIA40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13895	66.394	2	2054.8229	2054.8229	K	E	101	117
PSM	QKSDAEEDGGTVSQEEEDR	437	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5190	27.12146	2	2170.8191	2170.8170	K	K	552	571
PSM	DLGHPVEEEDELESGDQEDEDDESED	438	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0		ms_run[1]:scan=13666	65.40587333333333	3	2960.0951	2960.0958	K	P	929	955
PSM	CTLPEHESPSQDISDACEAESTER	439	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=16352	78.58919833333333	3	2812.0682	2810.0682	R	C	726	750
PSM	RVSVCAETYNPDEEEEDTD	440	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=11653	55.94501666666666	2	2336.8618	2336.8623	R	P	97	116
PSM	QSFDDNDSEELEDKDSK	441	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=10506	50.87998333333333	2	2062.7522	2062.7523	K	S	106	123
PSM	FGESEEVEMEVESDEEDDKQEK	442	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=13663	65.390295	3	2712.014863	2712.015729	K	A	317	339
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	443	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=15231	72.64490166666667	3	3222.375962	3221.393230	R	S	38	70
PSM	CGQEEHDVLLSNEEDR	444	sp|Q9UGI8|TES_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=13399	64.13736666666667	2	1911.7885	1911.7900	K	K	46	62
PSM	QHLENDPGSNEDTDIPK	445	sp|O43396|TXNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=9955	48.428255	2	1890.8204	1890.8226	K	G	105	122
PSM	ELDALDANDELTPLGR	446	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=19390	94.61993000000001	2	1740.852511	1740.853008	R	I	838	854
PSM	LTVVDTPGYGDAINCR	447	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:4	ms_run[1]:scan=14895	71.01921333333333	2	1749.825340	1749.835585	R	D	97	113
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	448	sp|Q53TN4|CYBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=9418	46.025835	3	2742.079391	2741.094605	R	K	247	272
PSM	LSSERPSSDGEGVVENGITTCNGK	449	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=11127	53.64495333333333	3	2573.089976	2572.111241	K	E	276	300
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	450	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=11665	55.997	3	3090.3373	3090.3373	R	V	1094	1125
PSM	AAVLSDSEDEEKASAK	451	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=4835	25.599	2	1728.7455	1728.7455	K	K	394	410
PSM	ALQDLENAASGDATVR	452	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14378	68.617	2	1629.7958	1629.7958	K	Q	183	199
PSM	ANSDDERPVASDNDDEK	453	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=1231	8.6201	2	1955.7382	1955.7382	K	Q	210	227
PSM	APSEEELHGDQTDFGQGSQSPQK	454	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9796	47.69	3	2551.05	2551.0500	K	Q	68	91
PSM	CIPALDSLTPANEDQK	455	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4	ms_run[2]:scan=16927	81.56	2	1770.8458	1770.8458	R	I	447	463
PSM	DHSSQSEEEVVEGEK	456	sp|O60238-2|BNI3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=5555	28.778	2	1767.6836	1767.6836	R	E	75	90
PSM	DLDEDELLGNLSETELK	457	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22582	114.93	2	1931.9211	1931.9211	K	Q	14	31
PSM	DSPSKSSAEAQTPEDTPNK	458	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=1877	11.686	2	2067.8634	2067.8634	K	S	65	84
PSM	DSTSQHDDDNISTTSGFSSR	459	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=8531	42.126	2	2235.8553	2235.8553	K	A	171	191
PSM	DTFEHDPSESIDEFNK	460	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=15175	72.364	2	1988.7677	1988.7677	K	S	187	203
PSM	DYSTLTSVSSHDSR	461	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=8514	42.05	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	462	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=9817	47.789	3	3001.2673	3001.2673	R	E	120	150
PSM	EFAGEDTSDLFLEER	463	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19686	96.28	2	1756.7792	1756.7792	K	E	1024	1039
PSM	ELDQDMVTEDEDDPGSHK	464	sp|Q9NRL2-2|BAZ1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=6208	31.663	2	2154.7937	2154.7937	K	R	692	710
PSM	ESEDKPEIEDVGSDEEEEK	465	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=8032	39.917	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	466	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=8808	43.352	2	2271.8792	2271.8792	K	K	251	270
PSM	EVAENQQNQSSDPEEEKGSQPPPAAESQSSLR	467	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=7333	36.827	3	3532.5227	3532.5227	K	R	29	61
PSM	FADQDDIGNVSFDR	468	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15656	74.653	2	1597.7009	1597.7009	K	V	489	503
PSM	FGESEEVEMEVESDEEDDKQEK	469	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=14258	68.084	3	2712.0157	2712.0157	K	A	252	274
PSM	FGESEEVEMEVESDEEDDKQEK	470	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=14516	69.218	3	2696.0208	2696.0208	K	A	252	274
PSM	FVCYCEGEESGEGDR	471	sp|Q9BUH6-2|PAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=8209	40.734	2	1792.6669	1792.6669	R	G	20	35
PSM	GGEYGFGAAFDADGDR	472	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16654	80.146	2	1603.6539	1603.6539	K	Y	283	299
PSM	GGNDSDELANGEVGGDR	473	sp|Q5JRA6-4|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6279	31.955	2	1660.6925	1660.6925	K	N	305	322
PSM	GPSLDIDTPDVNIEGPEGK	474	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18409	89.225	2	1951.9375	1951.9375	K	L	4423	4442
PSM	GSKSEDSELPPQTASEAPSEGSR	475	sp|Q5TCZ1-2|SPD2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=7470	37.478	3	2425.0282	2425.0282	K	R	601	624
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	476	sp|Q53TN4-3|CYBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=9070	44.495	3	2741.0946	2741.0946	R	K	189	214
PSM	GSQEDDPAATQRPPSNGGAK	477	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=2511	14.834	2	2061.8753	2061.8753	K	E	626	646
PSM	GTLDEEDEEADSDTDDIDHR	478	sp|Q9HCN4-4|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=9743	47.471	2	2355.85	2355.8500	R	V	315	335
PSM	GVVDSDDLPLNVSR	479	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27562	154.25	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	480	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=28766	162.64	2	1484.7471	1484.7471	K	E	435	449
PSM	IAEFTTNLTEEEEK	481	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14724	70.195	2	1652.7781	1652.7781	R	S	1001	1015
PSM	IEDVGSDEEDDSGKDK	482	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=5296	27.626	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEIKTPDSFEESQGEEIGK	483	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=14728	70.214	3	2344.0359	2344.0359	R	V	1123	1143
PSM	IQFENNEDQDVNPLK	484	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15047	71.735	2	1801.8483	1801.8483	K	L	488	503
PSM	ITETGAVKPTGECSGEQSPDTNYEPPGEDK	485	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=9902	48.181	3	3272.3704	3272.3704	K	T	1709	1739
PSM	KCSLPAEEDSVLEK	486	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10274	49.876	2	1683.7427	1683.7427	K	L	634	648
PSM	KESESEDSSDDEPLIK	487	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=7638	38.218	2	1886.767	1886.7670	K	K	265	281
PSM	KGGSYTQAASSDSAQGSDVSLTACK	488	sp|P04439|HLAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=9436	46.1	3	2555.0847	2555.0847	R	V	340	365
PSM	KNSTDLDSAPEDPTSPK	489	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=6259	31.867	2	1880.8041	1880.8041	R	R	1395	1412
PSM	KYSEVDDSLPSGGEK	490	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9627	46.978	2	1689.7135	1689.7135	R	P	26	41
PSM	LAEFSSQAAEEEEK	491	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9548	46.608	2	1566.7049	1566.7049	R	V	1025	1039
PSM	LPPNTNDEVDEDPTGNK	492	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6968	35.021	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LPPNTNDEVDEDPTGNK	493	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7641	38.229	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQSPIKEENTTAVEEIGR	494	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=13605	65.121	3	2093.0042	2093.0042	K	T	89	107
PSM	LTPVSLSNSPIKGADCQEVPQDK	495	sp|P46100-5|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=14616	69.679	3	2562.2037	2562.2037	K	D	435	458
PSM	LVGEEEAGFGECDK	496	sp|O94919|ENDD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:4	ms_run[2]:scan=10501	50.863	2	1538.6559	1538.6559	R	F	23	37
PSM	MADTSSMDEDFESDYKK	497	sp|Q8NFA0|UBP32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=11713	56.212	2	2093.7483	2093.7483	K	Y	1583	1600
PSM	MDRTPPPPTLSPAAITVGR	498	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:35,4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=16120	77.306	3	2151.9789	2151.9789	R	G	587	606
PSM	NPDGDEEGVWCYVAGK	499	sp|P00734|THRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4	ms_run[2]:scan=18732	90.996	2	1794.7519	1794.7519	R	P	264	280
PSM	NQVAMNPTNTVFDAK	500	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35	ms_run[2]:scan=11240	54.103	2	1664.7828	1664.7828	K	R	57	72
PSM	NSLEPQTTVVHNATDGIK	501	sp|Q13555-9|KCC2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=11280	54.267	2	2002.9361	2002.9361	K	G	337	355
PSM	PAPEASSLEEPHSPETGEK	502	sp|Q5JTC6-2|AMER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=7769	38.789	2	2070.8783	2070.8783	K	V	274	293
PSM	PEIEDVGSDEEEEK	503	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=8372	41.473	2	1683.64	1683.6400	K	K	256	270
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	504	sp|Q96FS4|SIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:21	ms_run[2]:scan=11269	54.225	3	2720.1814	2720.1814	K	G	866	892
PSM	QGNAIGVTACDIDGDGR	505	sp|Q9NQ79-3|CRAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4	ms_run[2]:scan=10688	51.66	2	1717.769	1717.7690	R	E	111	128
PSM	QISQMADDTVAELDR	506	sp|Q96E11-8|RRFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35	ms_run[2]:scan=13325	63.806	2	1706.7781	1706.7781	K	H	185	200
PSM	RNSSSPVSPASVPGQR	507	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=6150	31.403	2	1784.7608	1784.7608	R	R	655	671
PSM	SASQSSLDKLDQELK	508	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=14077	67.252	2	1727.7979	1727.7979	R	E	714	729
PSM	SDSRAQAVSEDAGGNEGR	509	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=2903	16.699	2	1884.7599	1884.7599	R	A	117	135
PSM	SEAEDEDDEDYVPYVPLR	510	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19002	92.418	2	2139.912	2139.9120	R	Q	23	41
PSM	SETAPAETATPAPVEKSPAK	511	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=5836	29.991	2	2060.9667	2060.9667	M	K	2	22
PSM	SFDDEESVDGNRPSSAASAFK	512	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=13432	64.291	2	2294.9329	2294.9329	K	V	241	262
PSM	SGDEEFKGEDELCDSGR	513	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11112	53.585	2	2008.7357	2008.7357	R	Q	339	356
PSM	SIQEIQELDKDDESLR	514	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=16804	80.925	2	1996.899	1996.8990	K	K	34	50
PSM	SLGDDISSETSGDFR	515	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13313	63.753	2	1584.6904	1584.6904	K	K	139	154
PSM	SLGDDISSETSGDFR	516	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15033	71.68	2	1584.6904	1584.6904	K	K	139	154
PSM	SLIGVEYKPVSATGAEDK	517	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=14830	70.708	2	1942.9289	1942.9289	K	D	944	962
PSM	SMSVDETDKSPCEAGR	518	sp|Q53SF7|COBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2701	15.719	2	1863.7016	1863.7016	K	V	324	340
PSM	SPDTTLSPASTTSSGVSEESTTSHSR	519	sp|Q9UKN1-2|MUC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=9015	44.269	3	2688.14	2688.1400	R	P	1557	1583
PSM	SQSESSDEVTELDLSHGK	520	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=11419	54.879	2	2026.8368	2026.8368	R	K	657	675
PSM	SQSESSDEVTELDLSHGK	521	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=12023	57.639	3	2026.8368	2026.8368	R	K	657	675
PSM	SSSADFGTFNTSQSHQTASAVSK	522	sp|P52594-2|AGFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=11563	55.547	2	2424.0231	2424.0231	K	V	251	274
PSM	SSVKTPETVVPAAPELQPSTSTDQPVTPEPTSR	523	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=16388	78.781	3	3512.6924	3512.6924	R	A	1522	1555
PSM	STPSHGSVSSLNSTGSLSPK	524	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=9662	47.125	2	2008.9103	2008.9103	R	H	238	258
PSM	STSSAMSGSHQDLSVIQPIVK	525	sp|Q96QF0-8|RAB3I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=15718	74.924	2	2267.0505	2267.0505	K	D	66	87
PSM	SYSSPDITQAIQEEEKR	526	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=17136	82.639	2	2059.9099	2059.9099	R	K	610	627
PSM	TCSDGGPSSELAHSPTNSGK	527	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4335	23.347	2	2067.8205	2067.8205	R	K	769	789
PSM	TDYNASVSVPDSSGPER	528	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10113	49.147	2	1779.7911	1779.7911	R	I	70	87
PSM	TLSSPSLQTDGIAATPVPPPPPPK	529	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=17197	82.966	3	2447.2349	2447.2349	R	S	1800	1824
PSM	VDIEGPDVNIEGPEGK	530	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15283	72.92	2	1666.805	1666.8050	K	L	2546	2562
PSM	VEYTLGEESEAPGQR	531	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=10475	50.764	2	1663.7689	1663.7689	K	A	1258	1273
PSM	VFAQNEEIQEMAQNK	532	sp|Q8TD06|AGR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=8675	42.76	2	1793.8254	1793.8254	K	F	80	95
PSM	VFSNGADLSGVTEEAPLK	533	sp|P01009|A1AT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17020	82.017	2	1832.9156	1832.9156	K	L	335	353
PSM	VGAEDADGIDMAYR	534	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:35	ms_run[2]:scan=9966	48.48	2	1497.6406	1497.6406	K	V	283	297
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	535	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=10362	50.246	2	2835.1244	2835.1244	K	A	213	238
PSM	VQVAALQASPPLDQDDR	536	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14484	69.086	2	1821.9221	1821.9221	K	A	99	116
PSM	VSNQDSKSPLGFYCDQNPVESSMCQSNSR	537	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,14-UNIMOD:4,23-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=15353	73.253	3	3416.3745	3416.3745	K	D	572	601
PSM	YLEEDNSDESDAEGEHGDGAEEEAPPAGPR	538	sp|Q9H1C4|UN93B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=10137	49.25	3	3251.2324	3251.2324	R	P	541	571
PSM	YLTESYGTGQDIDDR	539	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11232	54.07	2	1731.7588	1731.7588	R	I	167	182
PSM	YNLDASEEEDSNKK	540	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=5203	27.181	2	1720.6829	1720.6829	K	K	183	197
PSM	YNLDASEEEDSNKK	541	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=5431	28.214	2	1720.6829	1720.6829	K	K	183	197
PSM	YSQGDDDGSSSSGGSSVAGSQSTLFKDSPLR	542	sp|Q9UH99-3|SUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	28-UNIMOD:21	ms_run[2]:scan=15090	71.956	3	3158.3313	3158.3313	R	T	11	42
PSM	NPDDITNEEYGEFYK	543	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=16054	76.85149666666666	2	1833.774989	1832.774089	R	S	300	315
PSM	QKSDAEEDGGTVSQEEEDR	544	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5692	29.384198333333334	2	2171.8242	2170.8172	K	K	552	571
PSM	SEDLDNSIDKTEAGIK	545	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21	ms_run[1]:scan=10727	51.829856666666664	2	1813.788493	1813.798270	R	E	880	896
PSM	QESDPEDDDVKKPALQSSVVATSK	546	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11473	55.13914499999999	3	2635.1891	2635.1897	R	E	98	122
PSM	AMIVPSSPSKTPEEVSTPAEEEK	547	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=11580	55.62228666666667	2	2538.142882	2538.144833	K	L	3787	3810
PSM	EEDATLSSPAVVMPTMGR	548	sp|Q02252|MMSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=11195	53.91878333333334	2	1922.879002	1921.876129	K	-	518	536
PSM	EREESEDELEEANGNNPIDIEVDQNK	549	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21	ms_run[1]:scan=16700	80.39787833333334	3	3095.271388	3094.288807	R	E	256	282
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	550	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:35,6-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11519	55.34644833333333	3	3062.237315	3061.252957	R	V	320	347
PSM	DVIIKSDAPDTLLLEK	551	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21	ms_run[1]:scan=19650	96.068875	2	1849.967334	1848.948563	K	H	7	23
PSM	AADEEAFEDNSEEYIR	552	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14919	71.127	2	1886.7806	1886.7806	R	R	300	316
PSM	ACLISLGYDVENDR	553	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=19350	94.406	2	1623.7563	1623.7563	K	Q	792	806
PSM	AESPAEKVPEESVLPLVQK	554	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=18284	88.55	3	2129.0657	2129.0657	K	S	488	507
PSM	AGLESGAEPGDGDSDTTKK	555	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=3837	21.03	2	1913.7892	1913.7892	K	K	481	500
PSM	AGLESGAEPGDGDSDTTKK	556	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=3228	18.262	2	1913.7892	1913.7892	K	K	481	500
PSM	AKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLR	557	sp|Q9UBW5-2|BIN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=18023	87.182	3	3617.7462	3617.7462	R	T	323	359
PSM	ALDIYSAVDDASHEK	558	sp|Q16568|CART_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=14903	71.053	2	1712.7295	1712.7295	R	E	37	52
PSM	ALTSQLTDEELAQGR	559	sp|P23368|MAOM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14070	67.217	2	1630.8162	1630.8162	K	L	497	512
PSM	APAVAVAPTPVQPPIIVAPVATVPAMPQEK	560	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=21298	106.11	3	3054.6229	3054.6229	R	L	102	132
PSM	CIPALDSLTPANEDQK	561	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=16733	80.552	2	1770.8458	1770.8458	R	I	447	463
PSM	CTLPEHESPSQDISDACEAESTER	562	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13187	63.144	3	2827.095	2827.0950	R	C	670	694
PSM	DETFGEYSDSDEKPLK	563	sp|O00533|NCHL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=11780	56.518	2	1938.7772	1938.7772	K	G	1130	1146
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	564	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=16569	79.711	3	2897.0899	2897.0899	K	T	701	725
PSM	DGSNKSGAEEQGPIDGPSK	565	sp|O43493-4|TGON2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=3399	19.054	2	1951.816	1951.8160	K	S	219	238
PSM	DHFYSDDDAIEADSEGDAEPCDK	566	sp|Q9Y3B9|RRP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=14761	70.378	3	2679.9432	2679.9432	K	E	54	77
PSM	DHTPSQELALTQSVGGDSSADR	567	sp|Q86U44|MTA70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=13893	66.387	3	2350.0074	2350.0074	K	L	346	368
PSM	DPHSPEDEEQPQGLSDDDILR	568	sp|Q86VM9-2|ZCH18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=15686	74.786	3	2471.0126	2471.0126	R	D	10	31
PSM	DTFEHDPSESIDEFNK	569	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=13867	66.279	2	1988.7677	1988.7677	K	S	187	203
PSM	EDALDDSVSSSSVHASPLASSPVR	570	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=15600	74.401	3	2492.1068	2492.1068	R	K	2231	2255
PSM	EDSDEVHLEELSLSK	571	sp|P33241-2|LSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=15939	76.067	2	1808.7717	1808.7717	K	E	66	81
PSM	EKEISDDEAEEEK	572	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=2677	15.601	2	1629.6295	1629.6295	R	G	222	235
PSM	ELSLAGNELGDEGAR	573	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14197	67.799	2	1529.7322	1529.7322	K	L	288	303
PSM	ESEDKPEIEDVGSDEEEEK	574	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=8344	41.359	2	2271.8792	2271.8792	K	K	251	270
PSM	ESLPVSGEESQLTPEKSPK	575	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=12126	58.089	2	2120.9879	2120.9879	K	F	969	988
PSM	EVEDKESEGEEEDEDEDLSK	576	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=6027	30.863	2	2418.8959	2418.8959	K	Y	147	167
PSM	FGYVDFESAEDLEK	577	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20358	100.23	2	1647.7304	1647.7304	K	A	349	363
PSM	FNADEFEDMVAEK	578	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20325	100.04	2	1543.6501	1543.6501	K	R	176	189
PSM	GATYPSEIPKEDSTTFAK	579	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=13327	63.814	2	2020.9031	2020.9031	K	R	501	519
PSM	GDDTDTRDDISILATGCK	580	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14445	68.912	2	2031.8456	2031.8456	K	G	588	606
PSM	GNASPGAATHDSLSDYGPQDSR	581	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=10537	51.013	3	2281.9237	2281.9237	R	P	963	985
PSM	GPPSPGPAAQPPAPPR	582	sp|Q9NZV5-2|SELN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=7852	39.162	2	1572.745	1572.7450	R	R	10	26
PSM	GPSAAGEQEPDKESGASVDEVAR	583	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=7412	37.182	3	2365.0071	2365.0071	K	Q	47	70
PSM	GSGGSSGDELREDDEPVK	584	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=6295	32.016	2	1912.7688	1912.7688	R	K	365	383
PSM	GSSGGSGAKPSDAASEAAR	585	sp|Q04637-5|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=1551	10.121	2	1741.7268	1741.7268	K	P	932	951
PSM	GTVPDDAVEALADSLGKK	586	sp|P20810-3|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=19668	96.169	2	1864.8819	1864.8819	K	E	309	327
PSM	GVVDSDDLPLNVSR	587	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=27287	152.23	2	1484.7471	1484.7471	K	E	435	449
PSM	HDSIPAADTFEDLSDVEGGGSEPTQR	588	sp|O95671-3|ASML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=20015	98.246	3	2809.1716	2809.1716	K	D	168	194
PSM	IEDSEPHIPLIDDTDAEDDAPTK	589	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=19291	94.093	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEDVGSDEEDDSGKDK	590	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=884	7.083	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	591	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=1334	9.0908	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	592	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=2612	15.299	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	593	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=4145	22.397	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEVLSPEGSPSKSPSK	594	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=9118	44.708	2	1849.871	1849.8710	K	K	636	653
PSM	IIEGLQDLDDDVR	595	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18518	89.849	2	1499.7468	1499.7468	R	A	435	448
PSM	ILDSVGIEADDDR	596	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12585	60.326	2	1416.6733	1416.6733	K	L	26	39
PSM	ILDSVGIEADDDR	597	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12797	61.35	2	1416.6733	1416.6733	K	L	26	39
PSM	IMVDMLDSDGSGK	598	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=7814	38.989	2	1398.6007	1398.6007	K	L	501	514
PSM	IPDPDSDDVSEVDAR	599	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10532	50.987	2	1628.7166	1628.7166	K	H	690	705
PSM	KCSLPAEEDSVLEK	600	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12060	57.808	2	1683.7427	1683.7427	K	L	634	648
PSM	KDSSSEVFSDAAK	601	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=6575	33.251	2	1449.6025	1449.6025	R	E	922	935
PSM	KTLDELSQGTTTVK	602	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=8860	43.591	2	1599.7757	1599.7757	R	E	1542	1556
PSM	KTLTTVQGIADDYDK	603	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=14541	69.319	2	1746.8077	1746.8077	R	K	42	57
PSM	LDSSEMDHSENEDYTMSSPLPGK	604	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10153	49.316	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LEQGQAIDDLMPAQK	605	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=11323	54.446	2	1671.8138	1671.8138	R	-	367	382
PSM	LFDEEEDSSEKLFDDSDER	606	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=17930	86.691	2	2383.9217	2383.9217	K	G	706	725
PSM	LLDEEEATDNDLR	607	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11493	55.229	2	1531.7002	1531.7002	R	A	457	470
PSM	LLGSMPENAQIDDDVFDK	608	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35	ms_run[2]:scan=17879	86.46	2	2021.9252	2021.9252	K	I	125	143
PSM	LLVVDQETDEELR	609	sp|Q15599-2|NHRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15352	73.249	2	1557.7886	1557.7886	R	R	85	98
PSM	LPPNTNDEVDEDPTGNK	610	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7376	37.028	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQAALDDEEAGGR	611	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7003	35.207	2	1343.6317	1343.6317	R	P	38	51
PSM	LQELEGTYEENER	612	sp|P55268|LAMB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9733	47.428	2	1608.7267	1608.7267	R	A	1752	1765
PSM	LQGQLEQGDDTAAER	613	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5530	28.649	2	1629.7594	1629.7594	R	L	397	412
PSM	LTAEFEEAQTSACR	614	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=10576	51.17	2	1611.7199	1611.7199	K	L	878	892
PSM	LYTLVLTDPDAPSR	615	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18676	90.716	2	1559.8195	1559.8195	K	K	63	77
PSM	MTAFDADDPATDNALLR	616	sp|P55290-5|CAD13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35	ms_run[2]:scan=17217	83.076	2	1851.8309	1851.8309	R	Y	228	245
PSM	NAEPLINLDVNNPDFK	617	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20383	100.4	2	1811.9054	1811.9054	K	A	116	132
PSM	NPDDITQEEYGEFYK	618	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16403	78.858	2	1846.7897	1846.7897	R	S	292	307
PSM	NQLTSNPENTVFDAK	619	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13853	66.219	2	1676.8006	1676.8006	K	R	82	97
PSM	PAAMISQPPTPPTGQPVR	620	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=11090	53.496	2	1939.9227	1939.9227	R	E	985	1003
PSM	PEIEDVGSDEEEEKK	621	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=6617	33.419	2	1811.735	1811.7350	K	D	256	271
PSM	PSENEVPQQAIDSHSVK	622	sp|O75410-7|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=8447	41.78	3	1943.8626	1943.8626	K	N	72	89
PSM	QKSDAEEDGGTVSQEEEDR	623	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=3165	17.981	2	2187.8441	2187.8441	K	K	444	463
PSM	RPPSPDVIVLSDNEQPSSPR	624	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=14407	68.749	3	2349.0403	2349.0403	R	V	97	117
PSM	RVSVCAETYNPDEEEEDTDPR	625	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11674	56.034	3	2590.0167	2590.0167	R	V	97	118
PSM	SEAAEPPKTPPSSCDSTNAAIAK	626	sp|Q9NQR1-2|KMT5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=7167	35.982	3	2408.0567	2408.0567	K	Q	132	155
PSM	SGSSQELDVKPSASPQER	627	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=7149	35.896	2	1980.879	1980.8790	R	S	1539	1557
PSM	SHSSSSSSEENSSSSAAQPLLAGEK	628	sp|Q2LD37-2|K1109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=9094	44.604	3	2543.0661	2543.0661	R	E	1225	1250
PSM	SLGDDISSETSGDFR	629	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15452	73.718	2	1584.6904	1584.6904	K	K	139	154
PSM	SLSKSDSDLLTCSPTEDATMGSR	630	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=13966	66.732	3	2553.0612	2553.0612	R	S	622	645
PSM	SMSVDETDKSPCEAGR	631	sp|Q53SF7|COBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2486	14.714	2	1863.7016	1863.7016	K	V	324	340
PSM	SQETGDLDVGGLQETDK	632	sp|P23142-2|FBLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12192	58.398	2	1790.817	1790.8170	K	I	147	164
PSM	SQSESSDEVTELDLSHGK	633	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=11648	55.925	2	2026.8368	2026.8368	R	K	657	675
PSM	SRLTPVSPESSSTEEK	634	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5645	29.183	2	1892.7806	1892.7806	R	S	182	198
PSM	SSGHSSSELSPDAVEK	635	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=6275	31.94	2	1695.6989	1695.6989	R	A	1378	1394
PSM	SSGSEGTPADTGDLSPGHGASAPSVSR	636	sp|Q6NUJ5-2|PWP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=9234	45.232	2	2563.0824	2563.0824	R	E	433	460
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	637	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=17295	83.494	3	3904.8619	3904.8619	R	G	1235	1271
PSM	STSTLEIQPSRASPTSDIESVER	638	sp|Q96JK2-2|DCAF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=16291	78.273	3	2569.1909	2569.1909	R	K	554	577
PSM	SYIGSNHSSLGSMSPSNMEGYSK	639	sp|P78310-7|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9239	45.254	3	2530.9982	2530.9982	R	T	252	275
PSM	TDCSSGDASRPSSDNADSPK	640	sp|Q9NZN5-2|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=713	6.306	2	2132.7954	2132.7954	R	S	273	293
PSM	TIASDSEEEAGKELSDK	641	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=13491	64.594	2	1887.7987	1887.7987	K	K	435	452
PSM	TLSSPSLQTDGIAATPVPPPPPPK	642	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=17381	83.981	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TSGPLSPPTGPPGPAPAGPAVR	643	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=14860	70.847	3	2060.0092	2060.0092	K	L	610	632
PSM	TSSGTSLSAMHSSGSSGK	644	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=979	7.4793	2	1763.7033	1763.7033	R	G	1315	1333
PSM	TTDGVYEGVAIGGDR	645	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12079	57.887	2	1508.7107	1508.7107	R	Y	406	421
PSM	TVEIPDPVEAGEEVK	646	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17015	81.995	2	1610.8039	1610.8039	K	V	635	650
PSM	VAAAAGSGPSPPGSPGHDR	647	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3900	21.308	2	1846.7401	1846.7401	R	E	38	57
PSM	VDVEGPDVNIEGPEGK	648	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13681	65.473	2	1652.7893	1652.7893	K	L	2930	2946
PSM	VIPEDASESEEKLDQK	649	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=10109	49.128	2	1895.8401	1895.8401	K	E	915	931
PSM	VKEPSQDTVATEPSEVEGSAANK	650	sp|Q96RU2-3|UBP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=9416	46.018	3	2452.1007	2452.1007	R	E	63	86
PSM	VLAGETLSVNDPPDVLDR	651	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18768	91.178	2	1908.9793	1908.9793	K	Q	183	201
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	652	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=10405	50.456	3	2835.1244	2835.1244	K	A	213	238
PSM	VQAMQISSEKEEDDNEK	653	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=2460	14.602	2	2074.8402	2074.8402	R	R	100	117
PSM	VQNEEVGPEHDSQETK	654	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=2423	14.445	2	1904.7789	1904.7789	R	K	322	338
PSM	VQVAALQASPPLDQDDR	655	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14948	71.26	2	1821.9221	1821.9221	K	A	99	116
PSM	WDVDDWDNENSSAR	656	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16547	79.604	2	1707.6761	1707.6761	R	L	25	39
PSM	YDEIFYNLAPADGKLSGSK	657	sp|Q9NZN4-2|EHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=20122	98.846	2	2166.9875	2166.9875	K	A	317	336
PSM	YESYGMHSDDDANSDASSACSER	658	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,8-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=5177	27.064	3	2648.8905	2648.8905	R	S	835	858
PSM	YGLQDSDEEEEEHPSK	659	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=6700	33.793	2	1970.7419	1970.7419	K	T	866	882
PSM	QEASTGQSPEDHASLAPPLSPDHSSLEAK	660	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=15076	71.87741333333334	3	3048.3342	3048.3344	R	D	452	481
PSM	IDENSDKEMEVEESPEK	661	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=4891	25.848916666666664	3	2103.827290	2102.823893	K	I	495	512
PSM	QSLSSADNLESDAQGHQVAAR	662	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=14331	68.39545666666666	2	2245.9593	2245.9596	R	F	345	366
PSM	LPPNTNDEVDEDPTGNK	663	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=7741	38.661795	2	1854.822865	1853.827916	R	A	1058	1075
PSM	QEEIDESDDDLDDKPSPIK	664	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=14291	68.22822166666667	2	2249.9074	2249.9095	R	K	711	730
PSM	QPCPSESDIITEEDKSK	665	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=13514	64.69657	2	2024.8244	2024.8281	K	K	202	219
PSM	SQSESSDEVTELDLSHGK	666	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=12368	59.263548333333326	2	2027.821950	2026.836840	R	K	657	675
PSM	TGRDTPENGETAIGAENSEK	667	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=5967	30.602251666666668	2	2155.893510	2154.906651	K	I	475	495
PSM	QKFNDSEGDDTEETEDYR	668	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21	ms_run[1]:scan=8443	41.760848333333335	2	2257.818792	2256.833211	K	Q	392	410
PSM	LSSERPSSDGEGVVENGITTCNGK	669	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=10853	52.406328333333335	3	2573.089922	2572.111241	K	E	276	300
PSM	AAEDDEDDDVDTK	670	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1368	9.2331	2	1436.5427	1436.5427	R	K	90	103
PSM	AATEALGEKSPDSATVSGYDIMK	671	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=12833	61.512	3	2436.0768	2436.0768	K	S	930	953
PSM	ADAPDAGAQSDSELPSYHQNDVSLDR	672	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=13659	65.371	3	2837.1777	2837.1777	R	G	1289	1315
PSM	AGLASPEEEDAVGKEPLK	673	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=12733	61.066	2	1918.8925	1918.8925	K	A	1144	1162
PSM	AGLESGAEPGDGDSDTTKK	674	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=1055	7.8431	2	1913.7892	1913.7892	K	K	481	500
PSM	AGQSAAGAAPGGGVDTR	675	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2444	14.537	2	1441.691	1441.6910	R	D	8	25
PSM	APPGLTPAPASPPVLPR	676	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=16505	79.372	2	1716.8964	1716.8964	R	R	99	116
PSM	ATQQQHDFTLTQTADGR	677	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=10143	49.276	2	1996.864	1996.8640	R	S	2637	2654
PSM	AVTEQGAELSNEER	678	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=5860	30.103	2	1531.7114	1531.7114	K	N	28	42
PSM	CLDENLEDASQCK	679	sp|Q5JTJ3-3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9646	47.055	2	1580.6447	1580.6447	K	K	22	35
PSM	CSTHSEDSTGTATSLDTAASLTSTK	680	sp|Q96CN9|GCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=13419	64.236	3	2608.0848	2608.0848	R	G	87	112
PSM	DASDDLDDLNFFNQK	681	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22346	113.26	2	1755.7588	1755.7588	K	K	65	80
PSM	DQFGFINYEVGDSK	682	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20177	99.167	2	1617.7311	1617.7311	K	K	652	666
PSM	DSDDYAQLCNIPVTGR	683	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=16374	78.703	3	1822.8156	1822.8156	K	R	1190	1206
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	684	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=17753	85.825	3	2861.224	2861.2240	K	E	520	546
PSM	DSGRGDSVSDSGSDALR	685	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=4484	24.058	2	1759.701	1759.7010	R	S	59	76
PSM	DSSDSADGRATPSENLVPSSAR	686	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=9522	46.497	3	2297.9761	2297.9761	R	V	184	206
PSM	DVPNPNQDDDDDEGFSFNPLK	687	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20258	99.635	2	2376.9982	2376.9982	K	I	523	544
PSM	EAGLSQSHDDLSNATATPSVR	688	sp|O14523|C2C2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=11137	53.683	2	2234.9805	2234.9805	K	K	656	677
PSM	EDALDDSVSSSSVHASPLASSPVR	689	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:21	ms_run[2]:scan=14738	70.263	3	2492.1068	2492.1068	R	K	2231	2255
PSM	EDILENEDEQNSPPKK	690	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=7608	38.096	2	1963.8412	1963.8412	K	G	1272	1288
PSM	EDKSLSEAPEDTSTR	691	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=3751	20.646	2	1743.72	1743.7200	R	G	234	249
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	692	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=8681	42.794	3	3001.2673	3001.2673	R	E	120	150
PSM	EDSRGSLIPEGATGFPDQGNTGENTR	693	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=16314	78.383	3	2784.1988	2784.1988	R	Q	1235	1261
PSM	EEDEEPESPPEKK	694	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=1909	11.84	2	1621.6396	1621.6396	K	T	207	220
PSM	EELAEELASSLSGR	695	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21884	110.07	2	1489.726	1489.7260	K	N	1711	1725
PSM	EFDPTITDASLSLPSR	696	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19818	97.061	2	1747.8628	1747.8628	K	R	114	130
PSM	EGEEAGPGDPLLEAVPK	697	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18213	88.158	2	1706.8363	1706.8363	K	T	353	370
PSM	EKEISDDEAEEEK	698	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=1425	9.4603	2	1629.6295	1629.6295	R	G	222	235
PSM	EKEISDDEAEEEK	699	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=3086	17.627	2	1629.6295	1629.6295	R	G	222	235
PSM	EKGSTLDLSDLEAEK	700	sp|O00767|ACOD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=15760	75.106	2	1713.771	1713.7710	K	L	195	210
PSM	ELDEATESNEAMGR	701	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6996	35.173	2	1550.6519	1550.6519	R	E	1906	1920
PSM	ELDVEEAHAASTEEK	702	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=7244	36.366	2	1736.7142	1736.7142	R	E	14	29
PSM	ELEEEEENSDEDELDSHTMVK	703	sp|Q13188|STK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=11509	55.292	2	2601.9789	2601.9789	R	T	308	329
PSM	ELESSEEGGSAEER	704	sp|Q9HAS0|NJMU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=2008	12.39	2	1507.6274	1507.6274	K	R	15	29
PSM	ELVSSSSSGSDSDSEVDKK	705	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=3543	19.712	2	2021.8314	2021.8314	K	L	6	25
PSM	ENSDSDEAHLSPQAGR	706	sp|O94988-6|FA13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=3821	20.966	2	1791.7061	1791.7061	R	L	233	249
PSM	ESEDKPEIEDVGSDEEEEK	707	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=8581	42.339	2	2271.8792	2271.8792	K	K	251	270
PSM	ESTQLSPADLTEGKPTDPSK	708	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=12384	59.345	2	2179.9886	2179.9886	R	L	215	235
PSM	FDDGAGGDNEVQR	709	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4007	21.788	2	1378.5749	1378.5749	R	T	285	298
PSM	FDVPGDENAEMDAR	710	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:35	ms_run[2]:scan=10580	51.19	2	1580.6413	1580.6413	K	T	1369	1383
PSM	FDVPGDENAEMDAR	711	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13022	62.35	2	1564.6464	1564.6464	K	T	1369	1383
PSM	FGESEEVEMEVESDEEDDKQEK	712	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=13898	66.41	3	2712.0157	2712.0157	K	A	252	274
PSM	FIPDDITFDDEPK	713	sp|Q9H501|ESF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18798	91.314	2	1550.7141	1550.7141	R	D	469	482
PSM	FNPETDYLTGTDGK	714	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14215	67.886	2	1556.6995	1556.6995	K	K	507	521
PSM	FSSSDSDFDDEEPR	715	sp|O14526-3|FCHO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9834	47.873	2	1631.6223	1631.6223	R	K	292	306
PSM	GAVAAEGASDTEREEPTESQGLAAR	716	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=8921	43.86	3	2581.1293	2581.1293	R	L	907	932
PSM	GFINDDDDEDEGEEDEGSDSGDSEDDVGHK	717	sp|Q7KZ85-3|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	23-UNIMOD:21	ms_run[2]:scan=10658	51.534	3	3307.123	3307.1230	K	K	56	86
PSM	GGKPEPPAMPQPVPTA	718	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=7532	37.757	2	1668.7583	1668.7583	K	-	228	244
PSM	GIDSDDVQDNSQLK	719	sp|Q96QE3-2|ATAD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7491	37.577	2	1532.6954	1532.6954	R	A	611	625
PSM	GPFVEAEVPDVDLECPDAK	720	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:4	ms_run[2]:scan=20077	98.584	2	2085.9565	2085.9565	K	L	1819	1838
PSM	GPVEGYEENEEFLR	721	sp|Q9UI30-2|TR112_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15624	74.509	2	1666.7475	1666.7475	K	T	64	78
PSM	GSSLSSESSPVSSPATNHSSPASTPK	722	sp|Q14687|GSE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:21	ms_run[2]:scan=7884	39.295	3	2565.1232	2565.1232	R	R	76	102
PSM	GVVDSDDLPLNVSR	723	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15831	75.357	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	724	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15980	76.364	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	725	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16136	77.391	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	726	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16318	78.401	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	727	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16515	79.42	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	728	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17108	82.509	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	729	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17299	83.517	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	730	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17700	85.56	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	731	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17906	86.579	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	732	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18103	87.601	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	733	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18294	88.606	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	734	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18478	89.626	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	735	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18659	90.633	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	736	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18860	91.642	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	737	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19043	92.648	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	738	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19220	93.656	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	739	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19401	94.673	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	740	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19584	95.697	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	741	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19758	96.702	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	742	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19928	97.72	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	743	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20100	98.731	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	744	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20275	99.742	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	745	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20448	100.75	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	746	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20932	103.78	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	747	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21094	104.78	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	748	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21248	105.79	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	749	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21400	106.8	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	750	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21697	108.81	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	751	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21842	109.81	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	752	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21991	110.82	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	753	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22139	111.82	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	754	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22285	112.84	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	755	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22428	113.84	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	756	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22569	114.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	757	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22714	115.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	758	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23117	118.88	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	759	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23257	119.89	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	760	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23396	120.9	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	761	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23532	121.9	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	762	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23666	122.91	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	763	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23797	123.92	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	764	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23937	124.93	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	765	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24066	125.94	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	766	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24200	126.94	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	767	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24325	127.95	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	768	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24458	128.96	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	769	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24590	129.97	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	770	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24849	131.99	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	771	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24971	133	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	772	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25215	135.02	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	773	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25338	136.03	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	774	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25454	137.03	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	775	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25577	138.04	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	776	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25700	139.05	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	777	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25819	140.05	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	778	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26056	142.07	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	779	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26175	143.08	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	780	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26765	148.11	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	781	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26881	149.12	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	782	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=27005	150.13	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	783	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=27127	151.14	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	784	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=28879	163.7	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	785	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20614	101.75	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	786	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22837	116.86	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	787	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22979	117.87	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSEDLPLNISR	788	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17822	86.203	2	1512.7784	1512.7784	R	E	387	401
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	789	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=14237	67.985	3	3011.3427	3011.3427	R	D	374	402
PSM	HGSGADSDYENTQSGDPLLGLEGK	790	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=17698	85.547	3	2526.0548	2526.0548	R	R	590	614
PSM	IAQLEEQLDNETK	791	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12901	61.82	2	1529.7573	1529.7573	K	E	1816	1829
PSM	IAQLEEQVEQEAR	792	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13519	64.72	2	1541.7686	1541.7686	K	E	1823	1836
PSM	IDNDGDGFVTTEELK	793	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14602	69.614	2	1651.7577	1651.7577	R	T	91	106
PSM	IEDVGSDEEDDSGKDK	794	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=4820	25.532	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	795	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=5531	28.652	2	1816.6888	1816.6888	K	K	250	266
PSM	IINEPTAAAIAYGLDK	796	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19628	95.964	2	1658.8879	1658.8879	R	K	172	188
PSM	ILDQGEDFPASEMTR	797	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:35	ms_run[2]:scan=11997	57.506	2	1723.7723	1723.7723	K	I	209	224
PSM	ILDSVGIEADDDR	798	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13282	63.598	2	1416.6733	1416.6733	K	L	26	39
PSM	IMVDMLDSDGSGK	799	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8050	39.998	2	1398.6007	1398.6007	K	L	501	514
PSM	IQVLQQQADDAEER	800	sp|P06753-5|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9874	48.062	2	1641.7958	1641.7958	K	A	14	28
PSM	IQYQLVDISQDNALR	801	sp|Q9H299|SH3L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19353	94.423	2	1774.9214	1774.9214	R	D	33	48
PSM	ISTETEETEGSLHCCK	802	sp|Q9Y4E8-2|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=5446	28.278	2	1959.7591	1959.7591	K	D	591	607
PSM	IYEFPETDDEEENK	803	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12997	62.239	2	1756.7316	1756.7316	K	L	221	235
PSM	KGSITEYTAAEEK	804	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=6856	34.527	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSITEYTAAEEK	805	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7077	35.543	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSITEYTAAEEK	806	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7282	36.554	2	1505.6651	1505.6651	R	E	112	125
PSM	KLSSSDAPAQDTGSSAAAVETDASR	807	sp|Q7Z4S6-6|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=8667	42.723	3	2501.0919	2501.0919	R	T	815	840
PSM	KVVEAVNSDSDSEFGIPK	808	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=15387	73.411	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LCSSSDTLVSEGEENQKPK	809	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=9298	45.5	3	2186.9403	2186.9403	R	K	800	819
PSM	LDSSEMDHSENEDYTMSSPLPGK	810	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=9690	47.241	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	811	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=11895	57.053	3	2664.0245	2664.0245	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	812	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=14527	69.261	3	2648.0295	2648.0295	R	K	1174	1197
PSM	LEEKSEDQDLQGLK	813	sp|P51608-2|MECP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=9543	46.585	2	1710.7713	1710.7713	R	D	21	35
PSM	LEGALGADTTEDGDEK	814	sp|Q9NZM1-5|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7156	35.931	2	1619.7162	1619.7162	K	S	1094	1110
PSM	LEGDSDDLLEDSDSEEHSR	815	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=11058	53.359	3	2226.8438	2226.8438	K	S	469	488
PSM	LESIDNHSSTGGQSDQGYGSK	816	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5718	29.494	2	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	817	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=7415	37.193	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	818	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=7716	38.553	2	1920.715	1920.7150	K	E	672	688
PSM	LGFYGLDESDLDK	819	sp|Q02218-3|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19935	97.761	2	1470.6878	1470.6878	K	V	172	185
PSM	LIASYCNVGDIEGASK	820	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=14940	71.221	2	1695.8138	1695.8138	R	I	203	219
PSM	LSLHEEEGSSGSEQK	821	sp|Q12955|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=5809	29.881	2	1695.6989	1695.6989	R	Q	4341	4356
PSM	LSPIMTEQDDLGEGDVHSMVYPPSAAK	822	sp|Q12778|FOXO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21,5-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=16224	77.891	3	2998.2977	2998.2977	R	M	328	355
PSM	LSTTPSPTSSLHEDGVEDFR	823	sp|O94842-3|TOX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=15488	73.882	2	2253.9791	2253.9791	R	R	147	167
PSM	LVDVDGDEEAGVPAR	824	sp|O95294-4|RASL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10388	50.371	2	1540.7369	1540.7369	R	A	545	560
PSM	LVFNPDQEDLDGDGR	825	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14597	69.591	2	1688.7642	1688.7642	R	G	914	929
PSM	LVFNPDQEDLDGDGR	826	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15017	71.604	2	1688.7642	1688.7642	R	G	914	929
PSM	LVFNPDQEDLDGDGR	827	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15435	73.637	2	1688.7642	1688.7642	R	G	914	929
PSM	LVFNPDQEDLDGDGR	828	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15748	75.055	2	1688.7642	1688.7642	R	G	914	929
PSM	LYAQDADGCPIDIK	829	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=13484	64.559	2	1577.7396	1577.7396	K	V	704	718
PSM	LYGSAGPPPTGEEDTAEKDEL	830	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13458	64.419	3	2174.9855	2174.9855	K	-	634	655
PSM	MEPGEELEEEGSPGGR	831	sp|Q9H3H3-1|CK068_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35	ms_run[2]:scan=8557	42.238	2	1717.7101	1717.7101	-	E	1	17
PSM	MPTKEDEEEDEPVVIK	832	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=9235	45.236	2	1982.8432	1982.8432	R	A	497	513
PSM	NLPIYSEEIVEMYK	833	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:35	ms_run[2]:scan=20512	101.15	2	1742.8437	1742.8437	K	G	126	140
PSM	NSGVNYLILDDDDR	834	sp|O75815-2|BCAR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17671	85.416	2	1607.7427	1607.7427	R	E	146	160
PSM	NSLQEQQEEEEEAR	835	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4886	25.831	2	1717.7391	1717.7391	K	K	1346	1360
PSM	RASVCAEAYNPDEEEDDAESR	836	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9855	47.975	3	2491.9435	2491.9435	R	I	112	133
PSM	RASVCAEAYNPDEEEDDAESR	837	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10078	48.993	3	2491.9435	2491.9435	R	I	112	133
PSM	RVSVCAETYNPDEEEEDTDPR	838	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11919	57.155	3	2590.0167	2590.0167	R	V	97	118
PSM	SASATSLTLSHCVDVVK	839	sp|Q8NAA4-2|A16L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=15455	73.728	2	1853.8594	1853.8594	R	G	170	187
PSM	SASQSSLDKLDQELK	840	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=15696	74.83	2	1727.7979	1727.7979	R	E	714	729
PSM	SDPLGSTQDHALSQESSEPGCR	841	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=10539	51.02	3	2436.9853	2436.9853	R	V	1155	1177
PSM	SEESLTSLHAVDGDSK	842	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11787	56.56	2	1753.7408	1753.7408	K	L	357	373
PSM	SEQGTLTSSESHPEAAPK	843	sp|Q9Y2H0-3|DLGP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=4612	24.605	2	1934.8259	1934.8259	K	R	105	123
PSM	SETAPAETATPAPVEKSPAKK	844	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:21	ms_run[2]:scan=4293	23.124	2	2189.0617	2189.0617	M	K	2	23
PSM	SFDLGSPKPGDETTPQGDSADEK	845	sp|O60229-5|KALRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11951	57.298	3	2457.0221	2457.0221	K	S	172	195
PSM	SGDETPGSEVPGDK	846	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3564	19.817	2	1373.5947	1373.5947	R	A	161	175
PSM	SIFDDDMDDIFSTGIQAK	847	sp|Q5SRD0|WAC2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:35	ms_run[2]:scan=22054	111.24	2	2032.8936	2032.8936	K	T	256	274
PSM	SLSKSDSDLLTCSPTEDATMGSR	848	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=13159	63.015	3	2553.0612	2553.0612	R	S	622	645
PSM	SPMSTNSSVHTGSDVEQDAEK	849	sp|Q9ULU4-4|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5413	28.142	3	2300.9104	2300.9104	R	K	56	77
PSM	SQAGGACDCGDSNVMR	850	sp|Q6ZT12|UBR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=1177	8.3768	3	1699.6349	1699.6349	R	E	164	180
PSM	SSEEVDGQHPAQEEVPESPQTSGPEAENR	851	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:21	ms_run[2]:scan=8626	42.537	3	3199.3215	3199.3215	R	C	267	296
PSM	SSFDGASLASDKNDCK	852	sp|Q96HH9-4|GRM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=7942	39.541	2	1780.6975	1780.6975	K	T	55	71
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	853	sp|Q9BY89-2|K1671_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9705	47.305	3	3138.2319	3138.2319	R	R	103	132
PSM	STVTGERQSGDGQESTEPVENK	854	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=3299	18.601	2	2414.0235	2414.0235	K	V	140	162
PSM	SVELDLNQAHMEETPK	855	sp|Q14680-3|MELK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=11853	56.862	2	1935.8285	1935.8285	R	R	311	327
PSM	SVELDLNQAHMEETPK	856	sp|Q14680-3|MELK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=14842	70.76	2	1919.8336	1919.8336	R	R	311	327
PSM	TAANKSPCETISSPSSTLESK	857	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9863	48.009	2	2274.0087	2274.0087	K	D	202	223
PSM	TAGPLESSETEEASQLK	858	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12050	57.758	2	1775.8425	1775.8425	R	E	901	918
PSM	TCVADESAENCDK	859	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1628	10.506	2	1497.5712	1497.5712	K	S	76	89
PSM	TDDVSEKTSLADQEEVR	860	sp|Q9Y2Q0-3|AT8A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=8297	41.168	2	2000.8576	2000.8576	K	T	21	38
PSM	TIGGGDDSFNTFFSETGAGK	861	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21129	105.02	2	2006.8858	2006.8858	K	H	6	26
PSM	TQDPVPPETPSDSDHK	862	sp|A0JLT2|MED19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=5081	26.666	2	1828.7517	1828.7517	R	K	184	200
PSM	TSGPLSPPTGPPGPAPAGPAVR	863	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=15073	71.863	3	2060.0092	2060.0092	K	L	610	632
PSM	TTKSPSDSGYSYETIGK	864	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=9461	46.209	3	1899.8139	1899.8139	R	T	1912	1929
PSM	VASETHSEGSEYEELPK	865	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9681	47.205	2	1970.8146	1970.8146	R	R	1130	1147
PSM	VDIEAPDVSLEGPEGK	866	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16834	81.081	2	1653.8097	1653.8097	K	L	1162	1178
PSM	VDNALQSGNSQESVTEQDSK	867	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6215	31.693	3	2134.9614	2134.9614	K	D	43	63
PSM	VESDLKGPEVDIEGPEGK	868	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=14587	69.537	3	1976.898	1976.8980	K	L	4484	4502
PSM	VIPEDASESEEKLDQK	869	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9807	47.741	2	1895.8401	1895.8401	K	E	915	931
PSM	VLSTTKPFEYETPEMEK	870	sp|Q16666-3|IF16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15343	73.208	2	2123.9374	2123.9374	K	K	209	226
PSM	VNVEDAGGETLGR	871	sp|P69892|HBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9063	44.465	2	1315.6368	1315.6368	K	L	19	32
PSM	VYFAAEDTDCCTR	872	sp|O15162-2|PLS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=10188	49.463	2	1606.6392	1606.6392	R	N	58	71
PSM	YAEDIEGKQSEEEVK	873	sp|Q3L8U1-2|CHD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=6567	33.215	2	1832.7717	1832.7717	K	G	645	660
PSM	YGLQDSDEEEEEHPSK	874	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=6467	32.779	2	1970.7419	1970.7419	K	T	866	882
PSM	YLEEDNSDESDAEGEHGDGAEEEAPPAGPR	875	sp|Q9H1C4|UN93B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9661	47.122	3	3251.2324	3251.2324	R	P	541	571
PSM	GVVDSDDLPLNVSR	876	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=16586	79.80895333333333	2	1484.746634	1484.747087	K	E	435	449
PSM	GVVDSDDLPLNVSR	877	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=26529	146.0971	2	1485.749915	1484.747087	K	E	435	449
PSM	GVVDSDDLPLNVSR	878	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=16716	80.47148333333334	2	1484.746634	1484.747087	K	E	435	449
PSM	QKSDAEEDGGTVSQEEEDR	879	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=6428	32.603876666666665	3	2170.8205	2170.8170	K	K	552	571
PSM	CTLPEHESPSQDISDACEAESTER	880	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=16814	80.98117333333333	3	2810.0673	2810.0679	R	C	726	750
PSM	YNLDASEEEDSNKK	881	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=5895	30.265081666666664	2	1720.672628	1720.682906	K	K	183	197
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVK	882	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=17834	86.25992833333333	3	3635.4666	3635.4667	K	R	435	470
PSM	EIAIVHSDAEKEQEEEEQK	883	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:27,7-UNIMOD:21	ms_run[1]:scan=13096	62.713475	3	2301.9982	2301.9997	K	Q	341	360
PSM	ESTQLSPADLTEGKPTD	884	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=13645	65.30007333333333	2	1867.8084	1867.8083	R	P	451	468
PSM	KSTGQLNMNPGTTSGNTATAER	885	sp|Q5TBA9|FRY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=3921	21.39773	3	2331.021088	2331.016219	R	S	1954	1976
PSM	MEPGEELEEEGSPGGR	886	sp|Q9H3H3|CK068_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:35	ms_run[1]:scan=8784	43.24185833333333	2	1718.714486	1717.710109	R	E	42	58
PSM	NEEPSEEEIDAPKPK	887	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21	ms_run[1]:scan=7468	37.465531666666664	2	1791.766778	1790.761156	K	K	117	132
PSM	QLSKYESQLSTNEEK	888	sp|Q13433|S39A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=17883	86.47830166666667	2	1845.8052	1845.8028	K	V	469	484
PSM	YGLQDSDEEEEEHPSK	889	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=7296	36.629565	2	1971.728443	1970.741877	K	T	883	899
PSM	QSSSTNYTNELKASGGEIK	890	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=10935	52.79564666666667	2	2092.932278	2092.931409	K	I	281	300
PSM	TGRDTPENGETAIGAENSEK	891	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21	ms_run[1]:scan=5737	29.579796666666667	2	2155.891204	2154.906651	K	I	475	495
PSM	GGEYGFGAAFDADGDR	892	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=16859	81.20738	2	1603.652601	1603.653915	K	Y	283	299
PSM	AAEDDEDDDVDTKK	893	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=963	7.4047	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAKLSEGSQPAEEEEDQETPSR	894	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=6645	33.552	3	2467.0388	2467.0388	R	N	236	258
PSM	AALAHSEEVTASQVAATK	895	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=10533	50.991	2	1862.8775	1862.8775	R	T	2575	2593
PSM	AATEALGEKSPDSATVSGYDIMK	896	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=16301	78.319	3	2420.0818	2420.0818	K	S	930	953
PSM	AATSGVPSIYAPSTYAHLSPAK	897	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=18109	87.626	2	2268.0828	2268.0828	K	T	158	180
PSM	AEDGATPSPSNETPKK	898	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=1167	8.3355	2	1707.7353	1707.7353	K	K	138	154
PSM	AESPAEKVPEESVLPLVQK	899	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=17896	86.534	3	2129.0657	2129.0657	K	S	488	507
PSM	AESPAEKVPEESVLPLVQK	900	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=18089	87.539	3	2129.0657	2129.0657	K	S	488	507
PSM	AETEEAAHSVSQEMSVNSPTAQESQR	901	sp|Q9NUA8|ZBT40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=6310	32.077	3	2898.1975	2898.1975	K	N	173	199
PSM	AFLDEDDMSLEEIK	902	sp|Q86XL3|ANKL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:35	ms_run[2]:scan=18029	87.208	2	1669.7393	1669.7393	R	N	639	653
PSM	AFTFDDEDDELSQLK	903	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20259	99.639	2	1771.7788	1771.7788	K	E	19	34
PSM	ALDIYSAVDDASHEK	904	sp|Q16568|CART_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=14978	71.404	2	1712.7295	1712.7295	R	E	37	52
PSM	ALEEGLTPQEICDK	905	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4	ms_run[2]:scan=13626	65.212	2	1601.7607	1601.7607	K	Y	322	336
PSM	AQPFGFIDSDTDAEEER	906	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17908	86.585	2	1925.8279	1925.8279	R	I	321	338
PSM	ASSHSSQTQGGGSVTK	907	sp|P02545-3|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=524	5.3421	2	1597.6733	1597.6733	R	K	402	418
PSM	ASSLDAHEETISIEK	908	sp|Q8TF05-2|PP4R1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=11257	54.173	2	1708.7557	1708.7557	R	R	519	534
PSM	ATKSDLETQISSLNEK	909	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=14921	71.134	2	1842.8612	1842.8612	K	L	1218	1234
PSM	AVTELNEPLSNEDR	910	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11109	53.576	2	1585.7584	1585.7584	K	N	29	43
PSM	DAALAVAEAMADK	911	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:35	ms_run[2]:scan=11303	54.367	2	1290.6126	1290.6126	R	A	308	321
PSM	DDDDIDLFGSDDEEESEEAKR	912	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=17189	82.92	3	2507.9337	2507.9337	K	L	97	118
PSM	DDKEEEEDGTGSPQLNNR	913	sp|P49407-2|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=2859	16.498	2	2111.8281	2111.8281	K	-	393	411
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	914	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=16371	78.688	3	2897.0899	2897.0899	K	T	701	725
PSM	DGESDGFADEEESGEEGEEDQEEGREPGAGR	915	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=9992	48.6	3	3377.2237	3377.2237	R	W	1406	1437
PSM	DHTPSQELALTQSVGGDSSADR	916	sp|Q86U44|MTA70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=14111	67.397	3	2350.0074	2350.0074	K	L	346	368
PSM	DIEISTEEEKDTGDLK	917	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=12327	59.065	2	1900.8191	1900.8191	R	D	333	349
PSM	DLDTHQVSDDLSETDISNEAR	918	sp|Q8NFW9-5|MYRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=14999	71.515	3	2439.0075	2439.0075	R	D	550	571
PSM	DPDAQPGGELMLGGTDSK	919	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13644	65.296	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSDDYAQLCNIPVTGR	920	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=16342	78.537	2	1822.8156	1822.8156	K	R	1190	1206
PSM	EALNVFGNDYDTEDGTGVR	921	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18018	87.155	3	2070.913	2070.9130	R	D	147	166
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	922	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=8965	44.049	3	3001.2673	3001.2673	R	E	120	150
PSM	EEDEEPESPPEKK	923	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=1693	10.816	2	1621.6396	1621.6396	K	T	207	220
PSM	EEETSIDVAGKPNEVTK	924	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=8881	43.682	2	1924.8667	1924.8667	K	A	463	480
PSM	EELAEELASSLSGR	925	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18948	92.133	2	1489.726	1489.7260	K	N	1711	1725
PSM	EEVMGLCIGELNDDTR	926	sp|P46736-5|BRCC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=17365	83.895	2	1865.8135	1865.8135	K	S	32	48
PSM	EGEEPTVYSDEEEPKDESAR	927	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=7872	39.243	2	2374.9326	2374.9326	K	K	121	141
PSM	ELEQAEQGQGLLEER	928	sp|Q14183-2|DOC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13378	64.039	2	1727.8326	1727.8326	K	G	120	135
PSM	ELGSECGIEFDEEK	929	sp|P39656|OST48_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=13904	66.434	2	1640.6876	1640.6876	R	T	140	154
PSM	ELVSSSSSGSDSDSEVDKK	930	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=4488	24.07	2	2021.8314	2021.8314	K	L	6	25
PSM	ENPPVEDSSDEDDKR	931	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=1800	11.33	2	1810.6894	1810.6894	R	N	491	506
PSM	ESEDKPEIEDVGSDEEEEK	932	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=9554	46.643	2	2271.8792	2271.8792	K	K	251	270
PSM	ESVSTASDQPSHSLER	933	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=4872	25.767	2	1808.7578	1808.7578	R	Q	915	931
PSM	EVGEAFTILSDPK	934	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18840	91.536	2	1404.7137	1404.7137	K	K	374	387
PSM	FAMEPEEFDSDTLR	935	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35	ms_run[2]:scan=15363	73.298	2	1701.7192	1701.7192	K	E	486	500
PSM	FNADEFEDMVAEK	936	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35	ms_run[2]:scan=15681	74.763	2	1559.645	1559.6450	K	R	176	189
PSM	FQDSEFSSSQGEDEK	937	sp|Q9Y6X4|F169A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7789	38.875	2	1718.6908	1718.6908	R	T	342	357
PSM	FVCSPDEVMDTIDEGK	938	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=14889	70.988	2	1856.7808	1856.7808	R	S	172	188
PSM	FVCSPDEVMDTIDEGK	939	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15140	72.2	2	1856.7808	1856.7808	R	S	172	188
PSM	GAEEMETVIPVDVMR	940	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14112	67.4	2	1706.7855	1706.7855	K	R	13	28
PSM	GDDTGVLLPTPGEAQDADLK	941	sp|P55899|FCGRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17375	83.95	2	2010.9746	2010.9746	R	D	337	357
PSM	GDEGIFEESFIEER	942	sp|Q9UMY4-3|SNX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20887	103.47	2	1655.7315	1655.7315	R	R	102	116
PSM	GGSTGGGGGFDPPPAYHEVVDAEK	943	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=16438	79.028	3	2380.0009	2380.0009	R	N	86	110
PSM	GQTPLTEGSEDLDGHSDPEESFAR	944	sp|Q86VR2-2|RETR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=16331	78.473	2	2653.0817	2653.0817	R	D	110	134
PSM	GSFKDDPQLYQEIQER	945	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=16386	78.77	2	2031.8939	2031.8939	K	G	207	223
PSM	GSLGSQGAKDEPEEELQK	946	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=8984	44.134	2	1980.8677	1980.8677	K	G	1368	1386
PSM	GTEDELDKYSEALK	947	sp|P09493-3|TPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=13768	65.852	2	1676.7182	1676.7182	K	D	52	66
PSM	GTEDELDKYSEDLK	948	sp|P67936-2|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=12720	61.002	2	1720.7081	1720.7081	K	D	52	66
PSM	GVGDDQLGEESEER	949	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=6789	34.22	2	1518.6434	1518.6434	R	D	257	271
PSM	GVVDSDDLPLNVSR	950	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14414	68.779	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	951	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=24725	130.98	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	952	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=25093	134.01	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	953	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=25936	141.06	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	954	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=27425	153.24	2	1484.7471	1484.7471	K	E	435	449
PSM	IEDVGSDEEDDSGKDK	955	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=3024	17.326	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	956	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=5787	29.784	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	957	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=6053	30.974	2	1816.6888	1816.6888	K	K	250	266
PSM	IGDELDSNMELQR	958	sp|Q07812-5|BAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35	ms_run[2]:scan=10064	48.924	2	1534.6933	1534.6933	R	M	66	79
PSM	ILDSVGIEADDDR	959	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11983	57.443	2	1416.6733	1416.6733	K	L	26	39
PSM	IMVDMLDSDGSGK	960	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8842	43.508	2	1398.6007	1398.6007	K	L	501	514
PSM	IQVLQQQADDAEER	961	sp|P06753-5|TPM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8645	42.625	2	1641.7958	1641.7958	K	A	14	28
PSM	KEESEESDDDMGFGLFD	962	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=20238	99.521	2	2044.7133	2044.7133	K	-	99	116
PSM	KGSISSTQDTPVAVEEDCSLASSK	963	sp|Q9BZ71-3|PITM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13355	63.941	3	2575.1361	2575.1361	R	R	257	281
PSM	KGSSSSVCSVASSSDISLGSTK	964	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=12767	61.223	3	2209.9774	2209.9774	R	T	1382	1404
PSM	KLSSSSEPYEEDEFNDDQSIK	965	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=13819	66.066	3	2526.0323	2526.0323	R	K	209	230
PSM	KSTAALEEDAQILK	966	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=14372	68.591	2	1595.7808	1595.7808	R	V	524	538
PSM	LAGIENQSLDQTPQSHSSEQIQAIK	967	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:21	ms_run[2]:scan=15018	71.607	3	2801.3233	2801.3233	R	E	1096	1121
PSM	LDSSEMDHSENEDYTMSSPLPGK	968	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=9917	48.251	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	969	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10430	50.568	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LEAELGNMQGLVEDFK	970	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:35	ms_run[2]:scan=18756	91.121	2	1807.8662	1807.8662	K	N	161	177
PSM	LEEMFPDEVDTPR	971	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35	ms_run[2]:scan=14016	66.969	2	1592.7028	1592.7028	R	D	480	493
PSM	LFEDDDSNEKLFDEEEDSSEK	972	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=16990	81.871	3	2599.0011	2599.0011	K	L	696	717
PSM	LGAGEGGEASVSPEKTSTTSK	973	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=5068	26.606	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LGMSADPDNEDATDK	974	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35	ms_run[2]:scan=2428	14.468	2	1593.6464	1593.6464	R	V	335	350
PSM	LIAPVAEEEATVPNNK	975	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13092	62.69	2	1693.8887	1693.8887	K	I	8	24
PSM	LPNLSSPSAEGPPGPPSGPAPR	976	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=14814	70.642	3	2161.0205	2161.0205	R	K	412	434
PSM	LPPNTNDEVDEDPTGNK	977	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7175	36.022	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQLDSPEDAEFIVAK	978	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19823	97.087	2	1673.8512	1673.8512	K	A	426	441
PSM	LSKSNIDISSGLEDEEPK	979	sp|Q9BZ71-3|PITM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=15094	71.974	3	2039.93	2039.9300	R	R	282	300
PSM	LTSCTPGLEDEKEASENETDMEDPR	980	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=12487	59.846	3	2932.1627	2932.1627	R	E	6347	6372
PSM	LYGSAGPPPTGEEDTAEKDEL	981	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13671	65.429	3	2174.9855	2174.9855	K	-	634	655
PSM	MEAENLEQLIDQK	982	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35	ms_run[2]:scan=18443	89.425	2	1575.745	1575.7450	K	L	1291	1304
PSM	MLVLDEADEMLNK	983	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=14422	68.818	2	1551.716	1551.7160	K	G	183	196
PSM	MPTKEDEEEDEPVVIK	984	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=9245	45.28	3	1982.8432	1982.8432	R	A	497	513
PSM	NFDDEDSVDGNRPSSASSTSSK	985	sp|Q7Z460-2|CLAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=6119	31.262	3	2380.9292	2380.9292	K	A	240	262
PSM	NSLQDQLDEEMEAK	986	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17109	82.511	2	1648.725	1648.7250	R	Q	1346	1360
PSM	NSQEDSEDSEDKDVK	987	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=786	6.6466	2	1803.6684	1803.6684	K	T	53	68
PSM	NTVSQSISGDPEIDKK	988	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=9694	47.259	2	1796.8193	1796.8193	R	I	307	323
PSM	PASVSENHDAGPDGDK	989	sp|Q9H4G0|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=1163	8.3124	2	1674.6523	1674.6523	R	R	439	455
PSM	PGSPEPETEPVSSVQENHENER	990	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=7523	37.714	3	2527.05	2527.0500	K	I	548	570
PSM	PSWADQVEEEGEDDK	991	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13933	66.568	2	1732.7064	1732.7064	K	C	10	25
PSM	QDENDDDDDWNPCK	992	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=8701	42.883	2	1764.6169	1764.6169	K	A	188	202
PSM	RQGLAETASPVAVSLR	993	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13504	64.651	2	1813.8489	1813.8489	R	S	854	870
PSM	RVSVCAETYNPDEEEEDTDPR	994	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10653	51.511	3	2590.0167	2590.0167	R	V	97	118
PSM	SELSQSQHEVNEDSR	995	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=6352	32.25	2	1823.7323	1823.7323	R	S	115	130
PSM	SETAPAETATPAPVEKSPAKK	996	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=4249	22.899	2	2189.0617	2189.0617	M	K	2	23
PSM	SGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGK	997	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=8353	41.395	3	3091.1966	3091.1966	R	Q	816	850
PSM	SGTPTQDEMMDKPTSSSVDTMSLLSK	998	sp|Q5VT52-5|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,9-UNIMOD:35,10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=12200	58.438	3	2900.2014	2900.2014	R	I	704	730
PSM	SILEEDEEDEEPPR	999	sp|Q2TAK8-2|PWP3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11074	53.43	2	1685.7268	1685.7268	R	V	318	332
PSM	SISVPPSPSDIPPPGPPR	1000	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=17049	82.187	2	1875.9132	1875.9132	R	V	137	155
PSM	SLDGASVNENHEIYMK	1001	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=12479	59.803	2	1885.7917	1885.7917	R	D	443	459
PSM	SLGDDISSETSGDFR	1002	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15693	74.815	2	1584.6904	1584.6904	K	K	139	154
PSM	SMSVDETDKSPCEAGR	1003	sp|Q53SF7|COBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=5646	29.186	2	1847.7067	1847.7067	K	V	324	340
PSM	SNQQLENDLNLMDIK	1004	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:35	ms_run[2]:scan=17496	84.549	2	1789.8516	1789.8516	R	I	902	917
PSM	SPMSTNSSVHTGSDVEQDAEK	1005	sp|Q9ULU4-4|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=5433	28.221	2	2300.9104	2300.9104	R	K	56	77
PSM	SSGHSSSELSPDAVEK	1006	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=6531	33.053	2	1695.6989	1695.6989	R	A	1378	1394
PSM	SSSKGSVEEIMSQPK	1007	sp|Q8IWB9|TEX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=11026	53.216	2	1672.7379	1672.7379	R	Q	746	761
PSM	STVEEDNDSGGFDALDLDDDSHER	1008	sp|Q9BXL7|CAR11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=17242	83.208	3	2717.025	2717.0250	R	Y	585	609
PSM	SYQNSPSSDDGIRPLPEYSTEK	1009	sp|Q15648|MED1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=13759	65.816	3	2549.0959	2549.0959	K	H	1475	1497
PSM	SYSCQVTHEGSTVEK	1010	sp|P0DOY3|IGLC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=6289	31.994	2	1790.7182	1790.7182	K	T	84	99
PSM	SYTITGLQPGTDYK	1011	sp|P02751-4|FINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14714	70.141	2	1542.7566	1542.7566	R	I	1867	1881
PSM	TCGFDFTGAVEDISK	1012	sp|P00505-2|AATM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4	ms_run[2]:scan=21271	105.92	2	1645.7294	1645.7294	K	I	143	158
PSM	TEVALAKDMESPTK	1013	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=4989	26.267	2	1614.7212	1614.7212	K	L	270	284
PSM	TGAIVDVPVGEELLGR	1014	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21534	107.71	2	1623.8832	1623.8832	R	V	134	150
PSM	THSDASDDEAFTTSK	1015	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=4383	23.599	2	1690.636	1690.6360	R	T	1171	1186
PSM	TPSSDVLVFDYTK	1016	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18425	89.31	2	1470.7242	1470.7242	K	H	143	156
PSM	TQSSASLAASYAAQQHPQAAASYR	1017	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=12819	61.448	3	2544.1394	2544.1394	R	G	518	542
PSM	TVAPVVTQAAPPTPTPPVPPAK	1018	sp|Q70E73|RAPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=14338	68.426	2	2215.1654	2215.1654	K	K	793	815
PSM	TVEEPSNPEASSSTSVTPDVSDNEPDHYR	1019	sp|P60484|PTEN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:21	ms_run[2]:scan=12489	59.853	3	3225.3259	3225.3259	K	Y	350	379
PSM	TVLEGSTASTSPADHSALPNQSLTVR	1020	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=14977	71.401	3	2718.2862	2718.2862	R	E	1308	1334
PSM	VAAIEALNDGELQK	1021	sp|Q8IZP2|ST134_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14936	71.203	2	1469.7726	1469.7726	K	A	115	129
PSM	VADAKGDSESEEDEDLEVPVPSR	1022	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=13637	65.267	3	2552.0803	2552.0803	R	F	71	94
PSM	VGDAIPAVEVFEGEPGNK	1023	sp|P30044-2|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19937	97.772	2	1826.905	1826.9050	K	V	6	24
PSM	VISDSESDIGGSDVEFKPDTK	1024	sp|P52701-2|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=13891	66.381	3	2304.0046	2304.0046	R	E	250	271
PSM	VLAVNQENEQLMEDYEK	1025	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:35	ms_run[2]:scan=13682	65.476	3	2066.9467	2066.9467	K	L	265	282
PSM	VNSNSLDLPSSSDTTHASK	1026	sp|Q8NEY1-5|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=9057	44.438	2	2038.8845	2038.8845	K	V	413	432
PSM	VQEHEDSGDSEVENEAK	1027	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=3700	20.408	2	1980.7586	1980.7586	R	G	115	132
PSM	VSTHSQEMDSGTEYGMGSSTK	1028	sp|Q9UKE5-8|TNIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21,8-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=2332	14	3	2329.8716	2329.8716	R	A	858	879
PSM	VSTHSQEMDSGTEYGMGSSTK	1029	sp|Q9UKE5-8|TNIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=4959	26.15	3	2313.8767	2313.8767	R	A	858	879
PSM	VSTHSQEMDSGTEYGMGSSTK	1030	sp|Q9UKE5-8|TNIK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=8195	40.66	3	2297.8818	2297.8818	R	A	858	879
PSM	VVVDGSGQCHSTDTVK	1031	sp|Q9HAU4|SMUF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3520	19.605	2	1767.7499	1767.7499	K	N	39	55
PSM	WPEVDDDSIEDLGEVK	1032	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21134	105.05	2	1844.8316	1844.8316	K	K	182	198
PSM	YGLQDSDEEEEEHPSK	1033	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=5999	30.744	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	1034	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=7160	35.95	2	1970.7419	1970.7419	K	T	866	882
PSM	YTGEEDGAGGHSPAPPQTEECLR	1035	sp|O94762-4|RECQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=8828	43.438	2	2537.0166	2537.0166	K	E	777	800
PSM	YYSPCEEHPAETNQNEGSESGTIR	1036	sp|Q12774|ARHG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8775	43.201	3	2834.1127	2834.1127	R	Q	182	206
PSM	GELEDTLDSTNAQQELR	1037	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=15524	74.06116999999999	2	1918.890535	1917.891579	R	S	1170	1187
PSM	QKSDAEEDGGTVSQEEEDR	1038	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=6193	31.59655833333333	3	2170.8166	2170.8170	K	K	552	571
PSM	EDALDDSVSSSSVHASPLASSPVR	1039	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:27,21-UNIMOD:21	ms_run[1]:scan=16750	80.63285	3	2474.0927	2474.0957	R	K	2231	2255
PSM	SETAPAETATPAPVEKSPAKK	1040	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6832	34.420375	2	2231.0731	2231.0717	M	K	2	23
PSM	RVSVCAETYNPDEEEEDTDPR	1041	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=12171	58.29728666666667	3	2591.002536	2590.016672	R	V	97	118
PSM	DVPNPNQDDDDDEGFSFNPLK	1042	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=20564	101.45829833333333	2	2377.986286	2376.998229	K	I	523	544
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	1043	sp|Q96TA1|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=20302	99.88983	3	3176.530670	3175.546831	R	A	655	686
PSM	QFEQNDLSFVGQDVDGDR	1044	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=21584	108.03718666666667	2	2050.8868	2050.8863	K	M	491	509
PSM	QQIAEDPELTHSSSNK	1045	sp|Q9ULC3|RAB23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=10250	49.76452666666667	2	1845.7776	1845.7777	K	I	175	191
PSM	GVGDDQLGEESEER	1046	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=6562	33.195265	2	1518.643462	1518.643410	R	D	257	271
PSM	EREESEDELEEANGNNPIDIEVDQNK	1047	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=17302	83.53227	3	3095.272546	3094.288807	R	E	256	282
PSM	QDDSPPRPIIGPALPPGFIK	1048	sp|Q8IXQ4|GPAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=23387	120.84031666666668	2	2177.0921	2177.0917	K	S	102	122
PSM	QTALLDADDPVSQLHK	1049	sp|Q06330|SUH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:28	ms_run[1]:scan=18959	92.19001833333334	2	1732.8629	1732.8627	K	C	270	286
PSM	VWLDPNETNEIANANSR	1050	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=16540	79.56359	2	1942.902946	1941.918068	K	Q	22	39
PSM	EIQNGNLHESDSESVPR	1051	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=8143	40.422133333333335	2	1990.827502	1989.842928	K	D	66	83
PSM	TIGGGDDSFNTFFSETGAGK	1052	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=19581	95.677655	2	2007.870291	2006.885765	K	H	41	61
PSM	TGRDTPENGETAIGAENSEK	1053	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=5945	30.500041666666668	3	2155.890863	2154.906651	K	I	475	495
PSM	VLENGEDHGVAGSPASPASIEEER	1054	sp|Q9ULD4|BRPF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	19-UNIMOD:21	ms_run[1]:scan=12358	59.218288333333334	3	2530.081232	2529.102056	R	H	947	971
PSM	SPVIGSEVFLPNSNHVASGAGEAEER	1055	sp|P29590|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=18953	92.159145	3	2733.226735	2732.244304	R	V	530	556
PSM	AAESVSKPDVSEEAPGPSK	1056	sp|Q9BY42|RTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=6806	34.301	3	1963.8776	1963.8776	K	V	204	223
PSM	AAPEASSPPASPLQHLLPGK	1057	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19431	94.827	2	2126.9803	2126.9803	K	A	673	693
PSM	AELVLIDEDDEKSLR	1058	sp|Q8IXS6|PALM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=16958	81.726	2	1823.8554	1823.8554	K	E	306	321
PSM	AESPAEKVPEESVLPLVQK	1059	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=17933	86.707	2	2129.0657	2129.0657	K	S	488	507
PSM	AGSSASSPPSASSSPHPSAAVPAADPADSASGSSNK	1060	sp|Q8NDF8-4|PAPD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8949	43.978	3	3273.4059	3273.4059	R	R	43	79
PSM	AIISSSDDSSDEDKLK	1061	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=8687	42.824	2	1788.7666	1788.7666	K	I	1012	1028
PSM	APGAEEDDSELQR	1062	sp|Q53F19-2|NCBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4446	23.905	2	1415.6165	1415.6165	R	A	287	300
PSM	APPGLTPAPASPPVLPR	1063	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=16747	80.618	2	1716.8964	1716.8964	R	R	99	116
PSM	APVAGTCYQAEWDDYVPK	1064	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=19623	95.937	2	2068.92	2068.9200	R	L	162	180
PSM	ASPEAASTPRDPIDVDLPEEAER	1065	sp|P29590-4|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=17104	82.49	2	2544.1381	2544.1381	K	V	402	425
PSM	ATEDEGSEQKIPEATNR	1066	sp|P01008|ANT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=4720	25.104	2	1953.8317	1953.8317	K	R	62	79
PSM	ATSEEDVSIKSPICEK	1067	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=9601	46.866	2	1871.8224	1871.8224	K	Q	1606	1622
PSM	ATTPASTANSDVATIPTDTPLKEENEGFVK	1068	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=18229	88.241	3	3183.486	3183.4860	K	V	260	290
PSM	AVSPPHLDGPPSPR	1069	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11651	55.939	2	1585.6691	1585.6691	K	S	516	530
PSM	AVSPPHLDGPPSPR	1070	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11873	56.955	2	1585.6691	1585.6691	K	S	516	530
PSM	CMVEVPQELETSTGHSLEK	1071	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,2-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=14827	70.698	3	2268.9644	2268.9644	K	E	400	419
PSM	DEVDGGPPCAPGGTAK	1072	sp|Q9NV96-2|CC50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:4	ms_run[2]:scan=4918	25.974	2	1526.6671	1526.6671	K	T	9	25
PSM	DLDDIEDENEQLK	1073	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13547	64.848	2	1574.6948	1574.6948	R	Q	313	326
PSM	DMESPTKLDVTLAK	1074	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=16286	78.245	2	1642.7525	1642.7525	K	D	277	291
PSM	DNLAEELEGVAGR	1075	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20546	101.35	2	1371.663	1371.6630	R	C	82	95
PSM	DNVESAQASEVKPLRS	1076	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=8005	39.799	2	1808.8306	1808.8306	K	-	817	833
PSM	DQFGFINYEVGDSK	1077	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20134	98.898	2	1617.7311	1617.7311	K	K	652	666
PSM	DQFGFINYEVGDSK	1078	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20136	98.91	2	1617.7311	1617.7311	K	K	652	666
PSM	DSGPAGQPEKPASQEVSTPSQAR	1079	sp|Q5T0Z8|CF132_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=5781	29.763	3	2403.0704	2403.0704	K	G	710	733
PSM	DSHSSEEDEASSQTDLSQTISK	1080	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=10540	51.024	3	2459.9813	2459.9813	R	K	153	175
PSM	DSLGTVERTQDSEGSFK	1081	sp|O95239|KIF4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=9356	45.75	2	1934.8259	1934.8259	K	L	1125	1142
PSM	DSLLQDGEFSMDLR	1082	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=18517	89.847	2	1640.7352	1640.7352	R	T	76	90
PSM	DSLLQDGEFSMDLR	1083	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21330	106.31	2	1624.7403	1624.7403	R	T	76	90
PSM	DSSDSADGRATPSENLVPSSAR	1084	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=9545	46.592	2	2297.9761	2297.9761	R	V	184	206
PSM	DSSDSADGRATPSENLVPSSAR	1085	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=9758	47.537	3	2297.9761	2297.9761	R	V	184	206
PSM	DSSDSADGRATPSENLVPSSAR	1086	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=9778	47.615	2	2297.9761	2297.9761	R	V	184	206
PSM	DTCYSPKPSVYLSTPSSASK	1087	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=13528	64.757	2	2253.9865	2253.9865	K	A	538	558
PSM	DTDDVPMILVGNK	1088	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=15819	75.317	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1089	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18534	89.929	2	1415.6966	1415.6966	K	C	86	99
PSM	EAEKDSPLTTEIPNK	1090	sp|Q5T0Z8|CF132_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=9174	44.963	2	1750.8026	1750.8026	K	W	901	916
PSM	EAGLSQSHDDLSNATATPSVR	1091	sp|O14523|C2C2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=11104	53.554	3	2234.9805	2234.9805	K	K	656	677
PSM	EDALDDSVSSSSVHASPLASSPVR	1092	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:21	ms_run[2]:scan=14526	69.258	3	2492.1068	2492.1068	R	K	2231	2255
PSM	EDKSPETGTAGGSSTASYSAGR	1093	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=3447	19.265	3	2194.9016	2194.9016	K	G	2472	2494
PSM	EEETSIDVAGKPNEVTK	1094	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=8627	42.541	2	1924.8667	1924.8667	K	A	463	480
PSM	EEGAAPSPTHVAELATMEVESAR	1095	sp|Q9NRS6|SNX15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=21952	110.54	3	2477.0781	2477.0781	K	L	221	244
PSM	EGPYSISVLYGDEEVPR	1096	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20282	99.777	2	1908.9105	1908.9105	R	S	1516	1533
PSM	EIAEAYDVLSDPR	1097	sp|P25685|DNJB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16578	79.758	2	1476.7096	1476.7096	K	K	47	60
PSM	EKEISDDEAEEEK	1098	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=2033	12.5	2	1629.6295	1629.6295	R	G	222	235
PSM	EKEISDDEAEEEK	1099	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=2249	13.574	2	1629.6295	1629.6295	R	G	222	235
PSM	EKEISDDEAEEEK	1100	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=2456	14.588	2	1629.6295	1629.6295	R	G	222	235
PSM	EKEISDDEAEEEK	1101	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=2887	16.629	2	1629.6295	1629.6295	R	G	222	235
PSM	ELGPLPDDDDMASPK	1102	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=11249	54.138	2	1614.7083	1614.7083	K	L	624	639
PSM	ESEDKPEIEDVGSDEEEEK	1103	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=7751	38.702	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEKSDGDPIVDPEK	1104	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6678	33.701	2	1723.719	1723.7190	K	E	840	855
PSM	ETNLDSLPLVDTHSK	1105	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=16007	76.51	2	1747.803	1747.8030	R	R	425	440
PSM	EYQNEEDSLGGSR	1106	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5524	28.622	2	1482.6223	1482.6223	K	V	154	167
PSM	FDETEQALANER	1107	sp|Q7L014|DDX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10023	48.746	2	1421.6423	1421.6423	K	K	780	792
PSM	FGESEEVEMEVESDEEDDKQEK	1108	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=12778	61.268	3	2712.0157	2712.0157	K	A	252	274
PSM	FNADEFEDMVAEK	1109	sp|P27635|RL10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:35	ms_run[2]:scan=16092	77.129	2	1559.645	1559.6450	K	R	176	189
PSM	GADSGEEKEEGINR	1110	sp|Q9BVG4|PBDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=2052	12.589	2	1569.6308	1569.6308	K	E	194	208
PSM	GASTFKEEPQTVPEAR	1111	sp|P17275|JUNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9749	47.499	2	1825.8248	1825.8248	R	S	235	251
PSM	GDDGIFDDNFIEER	1112	sp|O60493-2|SNX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20791	102.86	2	1640.6954	1640.6954	R	K	73	87
PSM	GKLSAEENPDDSEVPSSSGINSTK	1113	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=9731	47.415	3	2527.0963	2527.0963	K	S	40	64
PSM	GPGAPGLAHLQESQAGSDTDVEEGK	1114	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=12856	61.618	3	2609.0684	2609.0684	R	A	360	385
PSM	GSISPDAEPNDKVPETAPVQPK	1115	sp|Q2V2M9-2|FHOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=10866	52.466	3	2355.0995	2355.0995	R	T	739	761
PSM	GTSPRPPEGGLGYSQLGDDDLK	1116	sp|Q9UQ88-8|CD11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=15415	73.541	3	2338.0478	2338.0478	R	E	122	144
PSM	GVGDDQLGEESEER	1117	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6292	32.005	2	1518.6434	1518.6434	R	D	257	271
PSM	GVVDSDDLPLNVSR	1118	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15227	72.622	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	1119	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=26297	144.08	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	1120	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=26648	147.1	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	1121	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=27698	155.26	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	1122	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=27834	156.27	2	1484.7471	1484.7471	K	E	435	449
PSM	GYTSDDDTWEPEIHLEDCK	1123	sp|Q99549|MPP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=19174	93.373	2	2388.9094	2388.9094	K	E	82	101
PSM	IECVSAETTEDCIAK	1124	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10589	51.227	2	1724.7597	1724.7597	K	I	385	400
PSM	IEDGNDFGVAIQEK	1125	sp|Q9UL46|PSME2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14061	67.18	2	1533.7311	1533.7311	K	V	132	146
PSM	IEDVGSDEEDDSGKDK	1126	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=1780	11.228	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEVLSPEGSPSKSPSK	1127	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=8655	42.67	2	1849.871	1849.8710	K	K	636	653
PSM	IENLELVPVDSK	1128	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16098	77.17	2	1354.7344	1354.7344	R	W	405	417
PSM	IGEETGVIETSDR	1129	sp|Q14517|FAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8498	41.985	2	1404.6733	1404.6733	K	L	1084	1097
PSM	ILDSVGIEADDDR	1130	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12377	59.313	2	1416.6733	1416.6733	K	L	26	39
PSM	ILDSVGIEADDDR	1131	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12895	61.794	2	1416.6733	1416.6733	K	L	26	39
PSM	ISMPSCQDQDDMAEK	1132	sp|Q8IWI9-3|MGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,6-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=2367	14.176	2	1785.6856	1785.6856	K	S	1397	1412
PSM	KEESEESDDDMGFGLFD	1133	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=20064	98.515	2	2044.7133	2044.7133	K	-	99	116
PSM	KGGSYTQAASSDSAQGSDVSLTACK	1134	sp|P04439|HLAA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=9393	45.912	3	2555.0847	2555.0847	R	V	340	365
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	1135	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=17117	82.55	3	2988.1557	2988.1557	K	E	120	146
PSM	LACLSEEGNEIESGK	1136	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=11828	56.746	2	1634.7458	1634.7458	R	I	181	196
PSM	LDDDDEGVPSSALR	1137	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10679	51.623	2	1487.674	1487.6740	R	E	37	51
PSM	LDSYVNADHDLYCNTR	1138	sp|Q9NWZ8|GEMI8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=13651	65.332	2	2034.8143	2034.8143	R	R	168	184
PSM	LEEDGGCVIGGDR	1139	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=7674	38.374	2	1375.6038	1375.6038	K	S	391	404
PSM	LFEESDDKEDEDADGK	1140	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=7301	36.652	3	1920.715	1920.7150	K	E	672	688
PSM	LLDEEEATDNDLR	1141	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11216	54.011	2	1531.7002	1531.7002	R	A	457	470
PSM	LNDMASTDDGTLQSR	1142	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:35	ms_run[2]:scan=5009	26.347	2	1638.7155	1638.7155	R	L	360	375
PSM	LQSIGTENTEENR	1143	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4963	26.169	2	1489.7009	1489.7009	R	R	44	57
PSM	LVAGEMGQNEPDQGGQR	1144	sp|Q99714-2|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=2930	16.858	2	1800.8061	1800.8061	R	G	131	148
PSM	MDDDSYSHHSGLEYADPEK	1145	sp|P51636-2|CAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9760	47.542	3	2370.8025	2370.8025	-	F	1	20
PSM	MIEQDDFDINTR	1146	sp|Q9Y223-5|GLCNE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35	ms_run[2]:scan=12953	62.032	2	1511.6562	1511.6562	-	L	1	13
PSM	MQESPKLPQQSYNFDPDTCDESVDPFK	1147	sp|O95359-6|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:35,4-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=20492	101.03	3	3297.3519	3297.3519	K	T	434	461
PSM	NEEPSEEEIDAPKPK	1148	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6491	32.893	2	1790.7612	1790.7612	K	K	49	64
PSM	NEEPSEEEIDAPKPK	1149	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6912	34.775	2	1790.7612	1790.7612	K	K	49	64
PSM	NGSYQGALHNASEEATEQNIR	1150	sp|Q6GYQ0-4|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=14092	67.31	3	2368.0081	2368.0081	K	A	501	522
PSM	NQVALNPQNTVFDAK	1151	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15238	72.683	2	1657.8424	1657.8424	K	R	57	72
PSM	NQVAMNPTNTVFDAK	1152	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35	ms_run[2]:scan=11308	54.39	2	1664.7828	1664.7828	K	R	57	72
PSM	NSLQDQLDEEMEAK	1153	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=11138	53.687	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	1154	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=5429	28.208	3	3336.3553	3336.3553	R	R	157	186
PSM	QKSDAEEDGGTVSQEEEDR	1155	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=3617	20.056	2	2187.8441	2187.8441	K	K	444	463
PSM	RASVCAEAYNPDEEEDDAESR	1156	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9614	46.923	3	2491.9435	2491.9435	R	I	112	133
PSM	SAESPTSPVTSETGSTFKK	1157	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=8507	42.021	2	2019.9038	2019.9038	K	F	175	194
PSM	SASDASISSGTHGQYSILQTAR	1158	sp|O15056-3|SYNJ2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=14638	69.786	3	2316.0383	2316.0383	K	L	1122	1144
PSM	SASPTIEAQGTSPAHDNIAFQDSTSK	1159	sp|Q12912-2|LRMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=13003	62.272	2	2739.2025	2739.2025	R	D	73	99
PSM	SCYSSLHPTSSSIDLELDKPIAATSN	1160	sp|Q13615-3|MTMR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=19647	96.058	3	2872.2838	2872.2838	K	-	1136	1162
PSM	SEEDESELELSHNR	1161	sp|Q9ULL1|PKHG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=7564	37.896	2	1752.684	1752.6840	K	R	1285	1299
PSM	SEEETSPLVTHQNPAGPVASAPELESK	1162	sp|P43007-2|SATT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:21	ms_run[2]:scan=14991	71.475	3	2883.3175	2883.3175	K	E	204	231
PSM	SELSQSQHEVNEDSR	1163	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=3654	20.211	2	1823.7323	1823.7323	R	S	115	130
PSM	SGCIVNNLAEFTVDPK	1164	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=20865	103.33	2	1762.856	1762.8560	K	D	658	674
PSM	SGSSQELDVKPSASPQER	1165	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=7381	37.046	2	1980.879	1980.8790	R	S	1539	1557
PSM	SIFDDDMDDIFSSGIQAK	1166	sp|Q641Q2-2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35	ms_run[2]:scan=21503	107.47	2	2018.8779	2018.8779	K	T	1268	1286
PSM	SISVPPSPSDIPPPGPPR	1167	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=16458	79.121	2	1875.9132	1875.9132	R	V	137	155
PSM	SKSISSSNPDLAVAPGSVDDEVSR	1168	sp|Q96HP0|DOCK6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=14067	67.207	3	2496.1381	2496.1381	R	I	878	902
PSM	SPSTTYLHTPTPSEDAAIPSK	1169	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=14183	67.73	2	2279.0359	2279.0359	R	S	775	796
PSM	SSGSFCYCHPDSETDEDEEEGDEQQR	1170	sp|Q96IK5|GMCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=9481	46.301	3	3172.0819	3172.0819	R	L	55	81
PSM	SSSMSSIDLVSASDDVHR	1171	sp|Q9Y5P4|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=15532	74.094	2	1971.8245	1971.8245	R	F	375	393
PSM	SSSPAELDLKDDLQQTQGK	1172	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=15162	72.301	3	2138.9733	2138.9733	R	C	819	838
PSM	SVTEQGAELSNEER	1173	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6350	32.243	2	1547.7063	1547.7063	K	N	28	42
PSM	SYELPDGQVITIGNER	1174	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18183	88.019	2	1789.8846	1789.8846	K	F	239	255
PSM	SYNPFDDDGEDEGAR	1175	sp|O95721|SNP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12888	61.761	2	1685.6441	1685.6441	K	P	7	22
PSM	TDEEAEGPYSDNEMLTHK	1176	sp|Q6NUK4|REEP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7474	37.499	2	2160.8195	2160.8195	K	G	201	219
PSM	TGGADQSLQQGEGSKK	1177	sp|P09132|SRP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=1246	8.6832	2	1669.7309	1669.7309	K	G	122	138
PSM	TGTAEMSSILEER	1178	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=9205	45.109	2	1438.661	1438.6610	K	I	46	59
PSM	TIDDLEETLASAK	1179	sp|P07951-3|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18607	90.35	2	1404.6984	1404.6984	K	E	216	229
PSM	TIQEVLEEQSEDEDR	1180	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15617	74.474	3	1818.8119	1818.8119	R	E	132	147
PSM	TLSDPPSPLPHGPPNK	1181	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12800	61.361	2	1812.7849	1812.7849	R	G	837	853
PSM	TNSPDLDTQSLSHSSGTDR	1182	sp|Q6H8Q1-8|ABLM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=8494	41.966	2	2096.8648	2096.8648	R	D	423	442
PSM	TPVDESDDEIQHDEIPTGK	1183	sp|Q86TC9-2|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=11404	54.813	3	2203.9158	2203.9158	R	C	648	667
PSM	VALSDDETKETENMR	1184	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=5641	29.17	2	1832.7499	1832.7499	R	K	198	213
PSM	VFEEDALSWEDK	1185	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17661	85.369	2	1466.6565	1466.6565	K	L	1515	1527
PSM	VIPEDASESEEKLDQK	1186	sp|Q9H2P0|ADNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=7886	39.302	2	1895.8401	1895.8401	K	E	915	931
PSM	VKEEPPSPPQSPR	1187	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4625	24.67	2	1606.6794	1606.6794	R	V	297	310
PSM	VLNDSLTPEIEADR	1188	sp|Q9UI36-4|DACH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14899	71.039	2	1570.7839	1570.7839	R	S	467	481
PSM	VSNAESSTPKEEPSSIEDR	1189	sp|Q8WU20|FRS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=5650	29.207	3	2140.9162	2140.9162	R	D	220	239
PSM	VSNAESSTPKEEPSSIEDR	1190	sp|Q8WU20|FRS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=5662	29.253	2	2140.9162	2140.9162	R	D	220	239
PSM	VVDALGNAIDGK	1191	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12211	58.486	2	1170.6245	1170.6245	R	G	150	162
PSM	VVESPDFSKDEDYLGK	1192	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=14865	70.87	2	1906.8238	1906.8238	K	V	923	939
PSM	YAAVTQFEATDAR	1193	sp|A6NEC2|PSAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12145	58.17	2	1441.6838	1441.6838	R	R	173	186
PSM	YEDEECTLPIAGR	1194	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4	ms_run[2]:scan=12374	59.298	2	1551.6875	1551.6875	R	H	962	975
PSM	YESGPDGGEEGVSGR	1195	sp|Q07866-3|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3469	19.366	2	1494.6223	1494.6223	K	A	532	547
PSM	YGLQDSDEEEEEHPSK	1196	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=5757	29.663	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	1197	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=7039	35.365	2	1970.7419	1970.7419	K	T	866	882
PSM	QRGSETGSETHESDLAPSDK	1198	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5124	26.84446666666667	3	2192.8854	2192.8854	R	E	1103	1123
PSM	SEGDSVGESVHGK	1199	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=3324	18.71578166666667	2	1328.5836	1328.5839	M	P	2	15
PSM	TCEERPAEDGSDEEDPDSMEAPTR	1200	sp|Q9H6Y2|WDR55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=8077	40.109004999999996	3	2802.026161	2802.026979	R	I	4	28
PSM	GVVDSDDLPLNVSR	1201	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=15350	73.24284166666666	2	1484.746306	1484.747087	K	E	435	449
PSM	YNLDASEEEDSNKK	1202	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=5913	30.34395333333333	2	1720.672628	1720.682906	K	K	183	197
PSM	THSVNGITEEADPTIYSGK	1203	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=13208	63.253975	2	2098.908692	2097.925596	K	V	582	601
PSM	VTQHESDNENEIQIQNK	1204	sp|Q5VZL5|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=6798	34.262240000000006	2	2105.893699	2104.906257	R	L	117	134
PSM	TAAPASTVPGPTLAPQPSSVK	1205	sp|Q9UQV4|LAMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=14772	70.42987333333333	3	2216.959131	2215.956849	R	T	204	225
PSM	VQAYEEPSVASSPNGKESDLR	1206	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=11034	53.24867333333333	2	2343.026962	2342.042751	R	R	719	740
PSM	LSSERPSSDGEGVVENGITTCNGK	1207	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=9995	48.614645	3	2573.093733	2572.111241	K	E	276	300
PSM	SPSASSLSSMSSVASSVSSRPSR	1208	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,10-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=11753	56.39897833333333	2	2575.919372	2575.930527	R	T	310	333
PSM	NEEPSEEEIDAPKPK	1209	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=7188	36.089620000000004	2	1791.750313	1790.761156	K	K	117	132
PSM	MRESSPTSPVAETEGTIMEESSR	1210	sp|Q8IWV8|UBR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=5249	27.406021666666668	3	2833.015669	2829.991807	K	D	1002	1025
SM	YNLDASEEEDSNKK	1200	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=5913	30.34395333333333	2	1720.672628	1720.682906	K	K	183	197
PSM	SEEDESELELSHNR	1201	sp|Q9ULL1|PKHG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=7564	37.89606166666666	2	1752.684755	1752.683968	K	R	1285	1299
PSM	SSFDGASLASDKNDCK	1202	sp|Q96HH9|GRM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=7942	39.540751666666665	2	1780.697001	1780.697510	K	T	71	87
PSM	SELSQSQHEVNEDSR	1203	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=6352	32.24995666666666	2	1823.732477	1823.732315	R	S	115	130
PSM	SELSQSQHEVNEDSR	1204	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=3654	20.21107	2	1823.733170	1823.732315	R	S	115	130
PSM	AELVLIDEDDEKSLR	1205	sp|Q8IXS6|PALM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=16958	81.7264	2	1823.855255	1823.855391	K	E	306	321
PSM	VALSDDETKETENMR	1206	sp|Q15054|DPOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=5641	29.169671666666666	2	1832.750466	1832.749940	R	K	304	319
PSM	THSVNGITEEADPTIYSGK	1207	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=13208	63.253975	2	2098.908692	2097.925596	K	V	582	601
PSM	VTQHESDNENEIQIQNK	1208	sp|Q5VZL5|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=6798	34.262240000000006	2	2105.893699	2104.906257	R	L	117	134
PSM	DDKEEEEDGTGSPQLNNR	1209	sp|P49407|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=2859	16.498085	2	2111.830514	2111.828066	K	-	401	419
PSM	VSNAESSTPKEEPSSIEDR	1210	sp|Q8WU20|FRS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=5662	29.25295	2	2140.917854	2140.916153	R	D	220	239
PSM	TDEEAEGPYSDNEMLTHK	1211	sp|Q6NUK4|REEP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=7474	37.498596666666664	2	2160.819911	2160.819476	K	G	201	219
PSM	TAAPASTVPGPTLAPQPSSVK	1212	sp|Q9UQV4|LAMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=14772	70.42987333333333	3	2216.959131	2215.956849	R	T	204	225
PSM	VQAYEEPSVASSPNGKESDLR	1213	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=11034	53.24867333333333	2	2343.026962	2342.042751	R	R	719	740
PSM	MDDDSYSHHSGLEYADPEK	1214	sp|P51636-2|CAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:35,5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=9760	47.541776666666664	3	2370.800943	2370.802520	-	F	1	20
PSM	LSSERPSSDGEGVVENGITTCNGK	1215	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=9995	48.614645	3	2573.093733	2572.111241	K	E	276	300
PSM	SPSASSLSSMSSVASSVSSRPSR	1216	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,10-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=11753	56.39897833333333	2	2575.919372	2575.930527	R	T	310	333
PSM	NEEPSEEEIDAPKPK	1217	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=7188	36.089620000000004	2	1791.750313	1790.761156	K	K	117	132
PSM	MRESSPTSPVAETEGTIMEESSR	1218	sp|Q8IWV8|UBR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=5249	27.406021666666668	3	2833.015669	2829.991807	K	D	1002	1025