MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	242-UNIMOD:4,250-UNIMOD:21,249-UNIMOD:21	0.03	51.0	4	1	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	50.0	2	1	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	49.0	null	145-UNIMOD:28,160-UNIMOD:21,164-UNIMOD:21,155-UNIMOD:21	0.07	49.0	9	1	0
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	594-UNIMOD:21,598-UNIMOD:21	0.03	48.0	2	1	0
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	1016-UNIMOD:21,1023-UNIMOD:35,1032-UNIMOD:35,1019-UNIMOD:21,1017-UNIMOD:21	0.02	48.0	4	1	0
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	34-UNIMOD:21	0.09	47.0	4	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	830-UNIMOD:21	0.03	47.0	16	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1171-UNIMOD:21,1173-UNIMOD:21	0.02	46.0	3	1	0
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.11	45.0	1	1	1
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.10	45.0	1	1	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null		0.05	45.0	1	1	0
PRT	sp|Q86UU1-3|PHLB1_HUMAN	Isoform 3 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	578-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	90-UNIMOD:21,208-UNIMOD:21	0.18	44.0	2	2	2
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	207-UNIMOD:21	0.07	44.0	2	1	0
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	329-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.09	43.0	13	1	0
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.06	43.0	2	1	0
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	767-UNIMOD:21,773-UNIMOD:21,775-UNIMOD:21,461-UNIMOD:21	0.05	43.0	3	2	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	2	1	0
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	268-UNIMOD:21,114-UNIMOD:35,123-UNIMOD:21,120-UNIMOD:21	0.12	43.0	3	2	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	2	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	43.0	1	1	1
PRT	sp|Q96PE2|ARHGH_HUMAN	Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	527-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|O15379|HDAC3_HUMAN	Histone deacetylase 3 OS=Homo sapiens OX=9606 GN=HDAC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	424-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	375-UNIMOD:35,390-UNIMOD:21,71-UNIMOD:21,388-UNIMOD:21	0.08	42.0	6	2	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	109-UNIMOD:35,102-UNIMOD:21	0.30	42.0	3	2	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	28-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2804-UNIMOD:21,2813-UNIMOD:35	0.01	42.0	2	2	2
PRT	sp|Q9UMS6-5|SYNP2_HUMAN	Isoform 5 of Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	209-UNIMOD:21,537-UNIMOD:21	0.06	42.0	4	2	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	532-UNIMOD:21	0.02	41.0	3	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	184-UNIMOD:21	0.02	41.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	255-UNIMOD:21,226-UNIMOD:21	0.05	41.0	8	4	3
PRT	sp|Q6PJT7-5|ZC3HE_HUMAN	Isoform 5 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	409-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	126-UNIMOD:21,125-UNIMOD:21	0.09	41.0	3	1	0
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21,1144-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9UMN6|KMT2B_HUMAN	Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1095-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q9C0H5|RHG39_HUMAN	Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	286-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	448-UNIMOD:21	0.03	41.0	5	1	0
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	281-UNIMOD:4	0.02	41.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	665-UNIMOD:21	0.04	41.0	4	1	0
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	367-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	16-UNIMOD:21	0.03	40.0	6	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q14699|RFTN1_HUMAN	Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	199-UNIMOD:21,211-UNIMOD:4	0.04	40.0	1	1	1
PRT	sp|P02751|FINC_HUMAN	Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	87-UNIMOD:4,97-UNIMOD:4,2445-UNIMOD:21	0.02	40.0	2	2	2
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	118-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1119-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	112-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	733-UNIMOD:4,749-UNIMOD:21,216-UNIMOD:21	0.04	40.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	4	2	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	28-UNIMOD:21,27-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	874-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	145-UNIMOD:21,102-UNIMOD:21	0.03	40.0	2	2	2
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	928-UNIMOD:21,939-UNIMOD:21	0.04	40.0	3	2	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	457-UNIMOD:4	0.02	39.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1223-UNIMOD:21,1234-UNIMOD:35,1243-UNIMOD:35	0.02	39.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.12	39.0	2	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	1314-UNIMOD:21,1316-UNIMOD:4,858-UNIMOD:21,852-UNIMOD:27,860-UNIMOD:21	0.02	39.0	5	2	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	715-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	451-UNIMOD:21,453-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	72-UNIMOD:21,62-UNIMOD:21	0.35	39.0	2	2	2
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1277-UNIMOD:21	0.02	39.0	2	2	2
PRT	sp|O43310|CTIF_HUMAN	CBP80/20-dependent translation initiation factor OS=Homo sapiens OX=9606 GN=CTIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	299-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	64-UNIMOD:21,121-UNIMOD:21,272-UNIMOD:21	0.12	39.0	6	3	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	266-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	66-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|O15231-9|ZN185_HUMAN	Isoform 9 of Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	103-UNIMOD:21,104-UNIMOD:4	0.06	39.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2873-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9UKC9-2|FBXL2_HUMAN	Isoform 2 of F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	336-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	246-UNIMOD:35	0.05	38.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	366-UNIMOD:21	0.05	38.0	7	1	0
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1543-UNIMOD:21,1547-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	88-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|O95684-2|FR1OP_HUMAN	Isoform 2 of FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	156-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1943-UNIMOD:21,1373-UNIMOD:35,1379-UNIMOD:4	0.02	38.0	5	3	2
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:21	0.13	38.0	2	1	0
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.10	38.0	1	1	0
PRT	sp|Q9Y4F5-3|C170B_HUMAN	Isoform 3 of Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	759-UNIMOD:21,585-UNIMOD:21	0.03	38.0	2	2	2
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	185-UNIMOD:21,193-UNIMOD:21	0.10	38.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	22-UNIMOD:21,36-UNIMOD:4	0.02	38.0	3	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	151-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q68DK7|MSL1_HUMAN	Male-specific lethal 1 homolog OS=Homo sapiens OX=9606 GN=MSL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	66-UNIMOD:21,74-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	240-UNIMOD:35	0.02	38.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1257-UNIMOD:21	0.01	38.0	3	1	0
PRT	sp|Q9H334-6|FOXP1_HUMAN	Isoform 6 of Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	364-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	345-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q8WYA6-4|CTBL1_HUMAN	Isoform 4 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	19-UNIMOD:35	0.03	38.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	524-UNIMOD:21,527-UNIMOD:35,521-UNIMOD:21	0.02	37.0	3	1	0
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	74-UNIMOD:21	0.08	37.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	398-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21	0.02	37.0	2	2	2
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	277-UNIMOD:4,295-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	461-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9P206-3|K1522_HUMAN	Isoform 3 of Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	982-UNIMOD:21,990-UNIMOD:21	0.02	37.0	4	1	0
PRT	sp|Q04323-2|UBXN1_HUMAN	Isoform 2 of UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	199-UNIMOD:21,202-UNIMOD:21	0.11	37.0	4	2	1
PRT	sp|O15297-2|PPM1D_HUMAN	Isoform 2 of Protein phosphatase 1D OS=Homo sapiens OX=9606 GN=PPM1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:35,40-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	458-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|P02671|FIBA_HUMAN	Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	603-UNIMOD:35,609-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	587-UNIMOD:35,590-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	221-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|O15265-3|ATX7_HUMAN	Isoform 3 of Ataxin-7 OS=Homo sapiens OX=9606 GN=ATXN7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	565-UNIMOD:21,586-UNIMOD:35	0.04	37.0	1	1	1
PRT	sp|Q8IY26|PLPP6_HUMAN	Phospholipid phosphatase 6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	70-UNIMOD:21	0.08	37.0	2	1	0
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	936-UNIMOD:21,949-UNIMOD:4	0.02	37.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1411-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	817-UNIMOD:21	0.01	37.0	2	1	0
PRT	sp|Q9Y2H2-4|SAC2_HUMAN	Isoform 4 of Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens OX=9606 GN=INPP5F	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	297-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	287-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	135-UNIMOD:21,5832-UNIMOD:21	0.01	37.0	4	4	4
PRT	sp|Q8N5H7-3|SH2D3_HUMAN	Isoform 3 of SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	86-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	525-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P49759-3|CLK1_HUMAN	Isoform 3 of Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	383-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q4KMQ1-2|TPRN_HUMAN	Isoform 2 of Taperin OS=Homo sapiens OX=9606 GN=TPRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	111-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q06330|SUH_HUMAN	Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	270-UNIMOD:28	0.03	37.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	971-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|Q7Z412|PEX26_HUMAN	Peroxisome assembly protein 26 OS=Homo sapiens OX=9606 GN=PEX26 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	208-UNIMOD:28,211-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2430-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9NSI8|SAMN1_HUMAN	SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	90-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q9Y5P4-2|CERT_HUMAN	Isoform 2 of Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|Q8IYB7-3|DI3L2_HUMAN	Isoform 3 of DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	396-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	420-UNIMOD:35,423-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|P23511-2|NFYA_HUMAN	Isoform Short of Nuclear transcription factor Y subunit alpha OS=Homo sapiens OX=9606 GN=NFYA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	297-UNIMOD:21,300-UNIMOD:35,311-UNIMOD:35	0.08	36.0	1	1	1
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	450-UNIMOD:21,462-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1954-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	623-UNIMOD:21,634-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	225-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q96M89-2|CC138_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1898-UNIMOD:21,405-UNIMOD:21,419-UNIMOD:35	0.02	36.0	2	2	2
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	2181-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9NWW5|CLN6_HUMAN	Ceroid-lipofuscinosis neuronal protein 6 OS=Homo sapiens OX=9606 GN=CLN6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	23-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q2M3V2|SWAHA_HUMAN	Ankyrin repeat domain-containing protein SOWAHA OS=Homo sapiens OX=9606 GN=SOWAHA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	260-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|O43312-2|MTSS1_HUMAN	Isoform 2 of Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	287-UNIMOD:21,299-UNIMOD:35	0.05	36.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	799-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q70CQ2-3|UBP34_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	3124-UNIMOD:21,3134-UNIMOD:4,3138-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	97-UNIMOD:35,108-UNIMOD:21,112-UNIMOD:21,123-UNIMOD:35	0.10	36.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.11	36.0	1	1	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	804-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	225-UNIMOD:21,227-UNIMOD:21	0.05	36.0	4	1	0
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	470-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O94880|PHF14_HUMAN	PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	84-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	859-UNIMOD:21,869-UNIMOD:21	0.03	36.0	4	1	0
PRT	sp|Q5JUR7|TEX30_HUMAN	Testis-expressed protein 30 OS=Homo sapiens OX=9606 GN=TEX30 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	112-UNIMOD:35,113-UNIMOD:4	0.09	35.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	6	3	2
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	527-UNIMOD:21,518-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q9Y4E6-2|WDR7_HUMAN	Isoform 2 of WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=WDR7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	769-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	92-UNIMOD:35,93-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9NQT8-2|KI13B_HUMAN	Isoform 2 of Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	163-UNIMOD:21	0.05	35.0	2	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	565-UNIMOD:4	0.02	35.0	2	1	0
PRT	sp|Q8NFA2-4|NOXO1_HUMAN	Isoform 4 of NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	330-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|P02775|CXCL7_HUMAN	Platelet basic protein OS=Homo sapiens OX=9606 GN=PPBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.13	35.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	420-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	304-UNIMOD:4,306-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	647-UNIMOD:21,651-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	314-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9BV36-3|MELPH_HUMAN	Isoform 3 of Melanophilin OS=Homo sapiens OX=9606 GN=MLPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	335-UNIMOD:21,214-UNIMOD:4,226-UNIMOD:21	0.12	35.0	2	2	2
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1215-UNIMOD:35,1218-UNIMOD:35	0.01	35.0	2	2	2
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	152-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	131-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9H3Y8-2|PPDPF_HUMAN	Isoform 2 of Pancreatic progenitor cell differentiation and proliferation factor OS=Homo sapiens OX=9606 GN=PPDPF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	23-UNIMOD:21,30-UNIMOD:4,35-UNIMOD:4	0.41	35.0	1	1	1
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	406-UNIMOD:35,411-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	129-UNIMOD:21	0.17	35.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	83-UNIMOD:21,88-UNIMOD:21,94-UNIMOD:21	0.09	35.0	3	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	3	1	0
PRT	sp|Q93073-2|SBP2L_HUMAN	Isoform 2 of Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	251-UNIMOD:21,275-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	125-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q86UZ6|ZBT46_HUMAN	Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	176-UNIMOD:21,189-UNIMOD:4	0.04	35.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	245-UNIMOD:21	0.04	35.0	2	2	2
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	230-UNIMOD:35,231-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	324-UNIMOD:21,319-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	591-UNIMOD:21,604-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P85298-4|RHG08_HUMAN	Isoform 4 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	424-UNIMOD:21,427-UNIMOD:35	0.05	35.0	6	1	0
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	169-UNIMOD:21,177-UNIMOD:21	0.07	35.0	3	1	0
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	736-UNIMOD:28,755-UNIMOD:21,765-UNIMOD:35	0.03	35.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	206-UNIMOD:28,224-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	1538-UNIMOD:28,1539-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9UDW1|QCR9_HUMAN	Cytochrome b-c1 complex subunit 9 OS=Homo sapiens OX=9606 GN=UQCR10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.29	34.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	888-UNIMOD:35,895-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	181-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q9BUB5-3|MKNK1_HUMAN	Isoform 3 of MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	178-UNIMOD:4,185-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|A6NEL2|SWAHB_HUMAN	Ankyrin repeat domain-containing protein SOWAHB OS=Homo sapiens OX=9606 GN=SOWAHB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	742-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q5JTV8-3|TOIP1_HUMAN	Isoform 3 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	154-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q9H9J4-2|UBP42_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1166-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P51003-2|PAPOA_HUMAN	Isoform 2 of Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	24-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	83-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q5VWG9|TAF3_HUMAN	Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	755-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	218-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P49750-1|YLPM1_HUMAN	Isoform 1 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	1	1	1
PRT	sp|Q9C004|SPY4_HUMAN	Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	115-UNIMOD:35,125-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	566-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1153-UNIMOD:21,1152-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	309-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	78-UNIMOD:21	0.16	34.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1441-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9ULI0-2|ATD2B_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	16-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	120-UNIMOD:21	0.08	34.0	1	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	373-UNIMOD:4,377-UNIMOD:21,385-UNIMOD:21,386-UNIMOD:21	0.04	34.0	3	1	0
PRT	sp|Q96IG2|FXL20_HUMAN	F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	417-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q8N108|MIER1_HUMAN	Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	488-UNIMOD:21,483-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q6UXY1-2|BI2L2_HUMAN	Isoform 2 of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	231-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P02749|APOH_HUMAN	Beta-2-glycoprotein 1 OS=Homo sapiens OX=9606 GN=APOH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	234-UNIMOD:4,248-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	212-UNIMOD:21,221-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	263-UNIMOD:21	0.03	33.0	2	2	2
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	300-UNIMOD:21,309-UNIMOD:35	0.05	33.0	1	1	1
PRT	sp|Q14526-2|HIC1_HUMAN	Isoform 2 of Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	292-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1497-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P41212|ETV6_HUMAN	Transcription factor ETV6 OS=Homo sapiens OX=9606 GN=ETV6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	18-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.18	33.0	1	1	1
PRT	sp|Q9C0K0-2|BC11B_HUMAN	Isoform 2 of B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	607-UNIMOD:21	0.02	33.0	3	1	0
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	488-UNIMOD:35,492-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	163-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	464-UNIMOD:21,472-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|E7EW31|PROB1_HUMAN	Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	820-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|O14558|HSPB6_HUMAN	Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	16-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|Q9UK76-2|JUPI1_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	87-UNIMOD:21,31-UNIMOD:21	0.23	33.0	2	2	2
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	10-UNIMOD:21	0.11	33.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	244-UNIMOD:21,249-UNIMOD:4,263-UNIMOD:4	0.08	33.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	426-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	384-UNIMOD:385,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4	0.05	33.0	2	2	2
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	202-UNIMOD:21	0.11	33.0	1	1	0
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	992-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P16144-2|ITB4_HUMAN	Isoform Beta-4A of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1364-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	155-UNIMOD:21	0.07	33.0	1	1	0
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	219-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	292-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q68DK2-5|ZFY26_HUMAN	Isoform 5 of Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	297-UNIMOD:21,1762-UNIMOD:21	0.02	32.0	2	2	2
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	93-UNIMOD:4,106-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	136-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	628-UNIMOD:4,632-UNIMOD:21,630-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q96EI5|TCAL4_HUMAN	Transcription elongation factor A protein-like 4 OS=Homo sapiens OX=9606 GN=TCEAL4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	102-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q5T6J7|GNTK_HUMAN	Probable gluconokinase OS=Homo sapiens OX=9606 GN=IDNK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9NQZ2|SAS10_HUMAN	Something about silencing protein 10 OS=Homo sapiens OX=9606 GN=UTP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	150-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	623-UNIMOD:4,626-UNIMOD:21,630-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9NYU1|UGGG2_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	499-UNIMOD:21,502-UNIMOD:35,516-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	131-UNIMOD:21,144-UNIMOD:35,147-UNIMOD:35	0.11	32.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1882-UNIMOD:35,1884-UNIMOD:21,1889-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	79-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	7-UNIMOD:21	0.15	32.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	132-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P55287|CAD11_HUMAN	Cadherin-11 OS=Homo sapiens OX=9606 GN=CDH11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	714-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1333-UNIMOD:35,1342-UNIMOD:4,1343-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P43405-2|KSYK_HUMAN	Isoform Short of Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	284-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P08913|ADA2A_HUMAN	Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	261-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9BUH6|PAXX_HUMAN	Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	148-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|P61266-2|STX1B_HUMAN	Isoform 2 of Syntaxin-1B OS=Homo sapiens OX=9606 GN=STX1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	14-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|P52756-4|RBM5_HUMAN	Isoform 4 of RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	78-UNIMOD:21	0.13	32.0	2	1	0
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1160-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	219-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	243-UNIMOD:21,246-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2362-UNIMOD:21,2370-UNIMOD:4,2120-UNIMOD:21,1726-UNIMOD:21	0.03	32.0	3	3	3
PRT	sp|P24821-6|TENA_HUMAN	Isoform 6 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	283-UNIMOD:21,288-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	107-UNIMOD:28,109-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	496-UNIMOD:28,498-UNIMOD:21,500-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	413-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	167-UNIMOD:28,186-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	333-UNIMOD:21,345-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	685-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	943-UNIMOD:21,946-UNIMOD:21,952-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1456-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	678-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:35	0.15	31.0	1	1	1
PRT	sp|O14827|RGRF2_HUMAN	Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q6PJG6|BRAT1_HUMAN	BRCA1-associated ATM activator 1 OS=Homo sapiens OX=9606 GN=BRAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	581-UNIMOD:21,569-UNIMOD:35,582-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q8IY92-2|SLX4_HUMAN	Isoform 2 of Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1003-UNIMOD:21,1012-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	572-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q15027|ACAP1_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	389-UNIMOD:21,395-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	589-UNIMOD:35,592-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	327-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|O75128-5|COBL_HUMAN	Isoform 5 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	235-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	247-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	129-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	207-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q49MG5-2|MAP9_HUMAN	Isoform 2 of Microtubule-associated protein 9 OS=Homo sapiens OX=9606 GN=MAP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:35,79-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	181-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	48-UNIMOD:21	0.15	31.0	1	1	1
PRT	sp|Q8N8E2-2|ZN513_HUMAN	Isoform 2 of Zinc finger protein 513 OS=Homo sapiens OX=9606 GN=ZNF513	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	131-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q15583-4|TGIF1_HUMAN	Isoform 4 of Homeobox protein TGIF1 OS=Homo sapiens OX=9606 GN=TGIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	137-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|Q7Z7G8-3|VP13B_HUMAN	Isoform 3 of Vacuolar protein sorting-associated protein 13B OS=Homo sapiens OX=9606 GN=VPS13B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1256-UNIMOD:35,1263-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	153-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P57682|KLF3_HUMAN	Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:21,92-UNIMOD:21,96-UNIMOD:21,97-UNIMOD:35	0.09	31.0	3	2	1
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	50-UNIMOD:21,49-UNIMOD:21	0.04	31.0	4	1	0
PRT	sp|Q9NRX5|SERC1_HUMAN	Serine incorporator 1 OS=Homo sapiens OX=9606 GN=SERINC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q9H4G0-4|E41L1_HUMAN	Isoform 4 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	399-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	49-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|Q8WY36-2|BBX_HUMAN	Isoform 2 of HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	814-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q6ZS30-1|NBEL1_HUMAN	Isoform 1 of Neurobeachin-like protein 1 OS=Homo sapiens OX=9606 GN=NBEAL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	719-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	2147-UNIMOD:21,2153-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|P06702|S10A9_HUMAN	Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	63-UNIMOD:35	0.14	31.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	641-UNIMOD:35,645-UNIMOD:4,658-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	262-UNIMOD:21,263-UNIMOD:35,269-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	604-UNIMOD:21	0.02	31.0	1	1	0
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	673-UNIMOD:27,680-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1083-UNIMOD:28,1086-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q8IZW8|TENS4_HUMAN	Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	160-UNIMOD:385,160-UNIMOD:4,167-UNIMOD:4,169-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	360-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q6W2J9|BCOR_HUMAN	BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	879-UNIMOD:21,882-UNIMOD:21,887-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1423-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q6IA17-2|SIGIR_HUMAN	Isoform 2 of Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	358-UNIMOD:35,364-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	525-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	154-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	307-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	16-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	963-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	449-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	117-UNIMOD:35,119-UNIMOD:21,123-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	89-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	98-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q96JQ0|PCD16_HUMAN	Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	3035-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q71F23-3|CENPU_HUMAN	Isoform 3 of Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	91-UNIMOD:4,98-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	624-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q6WKZ4-2|RFIP1_HUMAN	Isoform 4 of Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	209-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1191-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P78364|PHC1_HUMAN	Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	645-UNIMOD:21,658-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q8N9B5-2|JMY_HUMAN	Isoform 2 of Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	713-UNIMOD:21,721-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9H165-2|BC11A_HUMAN	Isoform 2 of B-cell lymphoma/leukemia 11A OS=Homo sapiens OX=9606 GN=BCL11A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	630-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	819-UNIMOD:35,823-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1671-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	18-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q96AP7|ESAM_HUMAN	Endothelial cell-selective adhesion molecule OS=Homo sapiens OX=9606 GN=ESAM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	366-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	259-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y6J0-2|CABIN_HUMAN	Isoform 2 of Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1607-UNIMOD:35,1612-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q96QF0-8|RAB3I_HUMAN	Isoform 8 of Rab-3A-interacting protein OS=Homo sapiens OX=9606 GN=RAB3IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	66-UNIMOD:21,71-UNIMOD:35	0.09	30.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	186-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	134-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P46695|IEX1_HUMAN	Radiation-inducible immediate-early gene IEX-1 OS=Homo sapiens OX=9606 GN=IER3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	31-UNIMOD:21	0.15	30.0	1	1	1
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	40-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	820-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	357-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q96KM6|Z512B_HUMAN	Zinc finger protein 512B OS=Homo sapiens OX=9606 GN=ZNF512B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	665-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q96RV3-2|PCX1_HUMAN	Isoform 2 of Pecanex-like protein 1 OS=Homo sapiens OX=9606 GN=PCNX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	420-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	131-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q96NY7-2|CLIC6_HUMAN	Isoform A of Chloride intracellular channel protein 6 OS=Homo sapiens OX=9606 GN=CLIC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	377-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P63098|CANB1_HUMAN	Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	125-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	21-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q14112-2|NID2_HUMAN	Isoform 2 of Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	307-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	5-UNIMOD:28	0.02	30.0	1	1	1
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	799-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	66-UNIMOD:21	0.05	30.0	1	1	0
PRT	sp|O75665|OFD1_HUMAN	Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	720-UNIMOD:21,730-UNIMOD:21,731-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q02410|APBA1_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	78-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	670-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q8WXI7|MUC16_HUMAN	Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1902-UNIMOD:21,1925-UNIMOD:21	0.00	30.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HGGVCAPAAVATSPPGAIPK	1	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11361	59.377	2	1936.923	1936.9230	R	E	238	258
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	2	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13838	72.51960166666667	3	3072.3878	3072.3933	R	T	553	583
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	3	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6576	35.110775	3	3007.3257	3007.3290	K	S	145	174
PSM	GNFGGSFAGSFGGAGGHAPGVAR	4	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21	ms_run[2]:scan=15468	81.554	2	2113.912	2113.9120	R	K	589	612
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	5	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	2-UNIMOD:21,9-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=7005	37.377	3	3165.2289	3165.2289	K	D	1015	1044
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	6	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5106	27.78507833333333	3	3008.3232	3007.3292	K	S	145	174
PSM	KTDTVVESSVSGDHSGTLR	7	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	2-UNIMOD:21	ms_run[2]:scan=7175	38.164	2	2053.9317	2053.9317	R	R	33	52
PSM	STAQQELDGKPASPTPVIVASHTANK	8	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	13-UNIMOD:21	ms_run[2]:scan=10633	55.631	3	2726.3276	2726.3276	R	E	818	844
PSM	LKPGGVGAPSSSSPSPSPSAR	9	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:21	ms_run[2]:scan=5929	31.79	2	2001.9521	2001.9521	K	P	1159	1180
PSM	DHDDAAESLIEQTTALNK	10	sp|Q9NVK5-3|FGOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=17038	90.935	2	1969.9229	1969.9229	R	R	21	39
PSM	GNFGGSFAGSFGGAGGHAPGVAR	11	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=14800	77.83	2	2113.912	2113.9120	R	K	589	612
PSM	HGGVCAPAAVATSPPGAIPK	12	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=11173	58.365	2	1936.923	1936.9230	R	E	238	258
PSM	KVEEVLEEEEEEYVVEK	13	sp|P83916|CBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=15890	84.084	2	2108.0049	2108.0049	K	V	9	26
PSM	KPEDVLDDDDAGSAPLK	14	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=10528	55.12424333333333	2	1783.847218	1783.847589	R	S	350	367
PSM	KNSITEISDNEDDLLEYHR	15	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=15763	83.322	3	2370.0377	2370.0377	R	R	576	595
PSM	RGLGAGAGAGEESPATSLPR	16	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=9560	50.21	2	1932.9055	1932.9055	R	M	78	98
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	17	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=9638	50.6	3	2686.2501	2686.2501	R	R	207	233
PSM	STAQQELDGKPASPTPVIVASHTANK	18	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=10034	52.6	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	19	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=11803	61.657	3	2726.3276	2726.3276	R	E	818	844
PSM	AHLTVGQAAAGGSGNLLTER	20	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=13089	68.403	2	2001.9633	2001.9633	R	S	317	337
PSM	APEPHVEEDDDDELDSK	21	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6458	34.499	2	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	22	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6854	36.572	2	1938.7967	1938.7967	K	L	5	22
PSM	HSLDSDEEEDDDDGGSSK	23	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=1716	10.874	2	1935.709	1935.7090	K	Y	45	63
PSM	KEEEEEEEEYDEGSNLK	24	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6714	35.831	2	2084.8546	2084.8546	K	K	230	247
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	25	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=14720	77.372	3	2742.2819	2742.2819	K	K	761	786
PSM	KWSLEDDDDDEDDPAEAEK	26	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11273	58.902	3	2220.8819	2220.8819	K	E	197	216
PSM	RSSEEVDGQHPAQEEVPESPQTSGPEAENR	27	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=8072	42.685	3	3355.4226	3355.4226	R	C	266	296
PSM	STAQQELDGKPASPTPVIVASHTANK	28	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=10439	54.619	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	29	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=11578	60.513	3	2726.3276	2726.3276	R	E	818	844
PSM	YKLDEDEDEDDADLSK	30	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8760	46.215	2	1898.7905	1898.7905	K	Y	167	183
PSM	SETAPAAPAAPAPAEKTPVK	31	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8192	43.278715000000005	2	2024.9771	2024.9815	M	K	2	22
PSM	APEPHVEEDDDDELDSK	32	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7055	37.586	2	1938.7967	1938.7967	K	L	5	22
PSM	DSPSAGGPVGQLEPIPIPAPASPGTRPTLK	33	sp|Q96PE2|ARHGH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:21	ms_run[2]:scan=18860	102.69	3	2986.5165	2986.5165	R	D	506	536
PSM	GPEENYSRPEAPNEFYDGDHDNDKESDVEI	34	sp|O15379|HDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	26-UNIMOD:21	ms_run[2]:scan=14924	78.492	3	3546.4009	3546.4009	R	-	399	429
PSM	IPMTPTSSFVSPPPPTASPHSNR	35	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12621	65.922	2	2500.1458	2500.1458	K	T	373	396
PSM	IYVASVHQDLSDDDIK	36	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12614	65.885	2	1816.8843	1816.8843	R	S	168	184
PSM	KEESEESDDDMGFGLFD	37	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:35	ms_run[2]:scan=17109	91.369	2	1964.7469	1964.7469	K	-	99	116
PSM	KSAEIDSDDTGGSAAQK	38	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=1465	9.6294	2	1678.7646	1678.7646	K	Q	813	830
PSM	KYSEVDDSLPSGGEKPSK	39	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=8017	42.406	2	2001.8932	2001.8932	R	N	26	44
PSM	NRPDYVSEEEEDDEDFETAVK	40	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14096	73.966	3	2515.0511	2515.0511	K	K	2662	2683
PSM	TAKPFPGSVNQPATPFSPTR	41	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=13957	73.199	2	2179.0463	2179.0463	R	N	193	213
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	42	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=5184	28.187328333333333	3	3007.3289	3007.3290	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	43	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=6133	32.82373833333334	3	3007.3248	3007.3290	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	44	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=6333	33.86752333333333	3	3007.3256	3007.3290	K	S	145	174
PSM	AQGEPVAGHESPKIPYEK	45	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=8626	45.37	2	2015.9354	2015.9354	R	Q	522	540
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	46	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11870	61.975	3	3242.2655	3242.2655	K	D	929	958
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	47	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=14653	77.004	3	2842.2698	2842.2698	R	E	181	208
PSM	IEDVGSDEEDDSGKDKK	48	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=2258	13.612	2	1944.7837	1944.7837	K	K	250	267
PSM	ISPPIKEEETKGDSVEK	49	sp|Q6PJT7-5|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21	ms_run[2]:scan=8297	43.821	2	1964.9344	1964.9344	R	N	408	425
PSM	KGNAEGSSDEEGKLVIDEPAK	50	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=8971	47.291	3	2252.021	2252.0210	K	E	119	140
PSM	MPGMSPANPSLHSPVPDASHSPR	51	sp|O60244|MED14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=8093	42.803	3	2560.0277	2560.0277	R	A	1124	1147
PSM	QRPSYDIFEDSDDSEPGGPPAPR	52	sp|Q9UMN6|KMT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=15905	84.16	3	2611.0864	2611.0864	K	R	1082	1105
PSM	RAELPGSSSPLLAQPR	53	sp|Q9C0H5|RHG39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=12178	63.682	2	1757.8825	1757.8825	K	K	278	294
PSM	RVSEVEEEKEPVPQPLPSDDTR	54	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10927	57.131	3	2615.2116	2615.2116	R	V	446	468
PSM	SPPGAAASAAAKPPPLSAK	55	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=8799	46.398	2	1767.892	1767.8921	R	D	71	90
PSM	VPVCQPLKEEDDDEGPVDK	56	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4	ms_run[2]:scan=9129	48.066	2	2167.9943	2167.9943	K	S	278	297
PSM	SLLEGQEDHYNNLSASK	57	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=10537	55.16473166666667	2	1903.891832	1903.891185	R	V	382	399
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	58	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6841	36.50207	3	3007.3257	3007.3290	K	S	145	174
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	59	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:21	ms_run[1]:scan=17943	96.66383833333333	3	3096.559011	3095.580500	R	A	655	686
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	60	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=8445	44.55880666666666	2	2456.055837	2455.076510	R	S	364	389
PSM	AMVSPFHSPPSTPSSPGVR	61	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11211	58.561	2	2032.9078	2032.9078	K	S	113	132
PSM	APEPHVEEDDDDELDSK	62	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7264	38.604	2	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	63	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7470	39.62	2	1938.7967	1938.7967	K	L	5	22
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	64	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=3896	21.73	3	2540.1908	2540.1908	R	E	7	32
PSM	ERDEDDEDGDGDGDGATGK	65	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=707	6.1977	2	1951.7151	1951.7151	K	K	80	99
PSM	GDHASLENEKPGTGDVCSAPAGR	66	sp|Q14699|RFTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=6799	36.299	3	2404.0115	2404.0115	R	N	195	218
PSM	GFNCESKPEAEETCFDK	67	sp|P02751|FINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=9045	47.646	2	2046.8299	2046.8299	R	Y	84	101
PSM	HAASYSSDSENQGSYSGVIPPPPGR	68	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=11877	62.018	3	2639.1289	2639.1289	R	G	112	137
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	69	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=16400	87.051	3	2771.2175	2771.2175	R	N	1116	1140
PSM	IEDVGSDEEDDSGKDKK	70	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=2460	14.631	2	1944.7837	1944.7837	K	K	250	267
PSM	IHIDPEIQDGSPTTSR	71	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=10592	55.434	2	1844.8306	1844.8306	R	R	102	118
PSM	KCEAEEAEPPAATQPQTSETQTSHLPESER	72	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=8856	46.676	3	3417.4668	3417.4668	K	I	732	762
PSM	KDASDDLDDLNFFNQK	73	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18800	102.27	2	1883.8537	1883.8537	K	K	64	80
PSM	REEGPPPPSPDGASSDAEPEPPSGR	74	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=7403	39.289	3	2594.0922	2594.0922	R	T	14	39
PSM	SLSEEKEDHSDGLAGLK	75	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=9263	48.684	2	1893.8357	1893.8357	R	G	874	891
PSM	SRDESASETSTPSEHSAAPSPQVEVR	76	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=7273	38.648	3	2820.2199	2820.2199	R	T	145	171
PSM	STAQQELDGKPASPTPVIVASHTANK	77	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=10230	53.611	3	2726.3276	2726.3276	R	E	818	844
PSM	WAHDKFSGEEGEIEDDESGTENR	78	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=11434	59.767	3	2796.0226	2796.0226	K	E	922	945
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	79	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13648	71.49451666666667	3	3072.3878	3072.3933	R	T	553	583
PSM	AGDKDDITEPAVCALR	80	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4	ms_run[2]:scan=11473	59.985	2	1729.8305	1729.8305	R	H	445	461
PSM	AKSPISSGSGGSHMSGTSSSSGMK	81	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,14-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=731	6.3141	2	2322.9458	2322.9458	K	S	1221	1245
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	82	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=4091	22.747	3	2540.1908	2540.1908	R	E	7	32
PSM	EAFSLFDKDGDGTITTK	83	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15892	84.095	2	1843.884	1843.8840	K	E	15	32
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	84	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=14450	75.879	3	2842.2698	2842.2698	R	E	181	208
PSM	GSVILDSGHLSTASSSDDLKGEEGSFR	85	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=14794	77.796	3	2830.2658	2830.2658	R	G	88	115
PSM	HLGGSGSVVPGSPCLDR	86	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11123	58.104	2	1773.7869	1773.7869	R	H	1303	1320
PSM	IEDVGSDEEDDSGKDK	87	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=3255	18.558	2	1816.6888	1816.6888	K	K	250	266
PSM	KDASDDLDDLNFFNQK	88	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18454	99.927	2	1883.8537	1883.8537	K	K	64	80
PSM	KDSNELSDSAGEEDSADLKR	89	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=6711	35.815	3	2244.9383	2244.9383	K	A	709	729
PSM	KRESESESDETPPAAPQLIK	90	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=11019	57.563	2	2371.0346	2371.0346	R	K	448	468
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIK	91	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=14615	76.806	3	2857.4627	2857.4627	K	K	69	99
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	92	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:21	ms_run[2]:scan=9481	49.802	3	2868.339	2868.3390	R	S	1254	1282
PSM	LEDTAGDTGHSSLEAPRSPDTLAPVASER	93	sp|O43310|CTIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:21	ms_run[2]:scan=12425	64.938	3	3058.3881	3058.3881	K	L	282	311
PSM	LPSVEEAEVPKPLPPASK	94	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=14076	73.874	2	1967.0017	1967.0017	R	D	62	80
PSM	PSQLQAHTPASQQTPPLPPYASPR	95	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=13017	68.026	3	2648.2748	2648.2748	K	S	253	277
PSM	RDSSESQLASTESDKPTTGR	96	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=4712	25.832	2	2230.9703	2230.9703	R	V	64	84
PSM	RESCGSSVLTDFEGKDVATK	97	sp|O15231-9|ZN185_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=14110	74.037	3	2264.9984	2264.9984	R	V	101	121
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	98	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=9559	50.206	3	3149.234	3149.2340	K	D	1015	1044
PSM	STAQQELDGKPASPTPVIVASHTANK	99	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=9836	51.592	3	2726.3276	2726.3276	R	E	818	844
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	100	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=8737	46.091	3	2919.2268	2919.2268	R	S	2860	2891
PSM	VHAYFAPVTPPTAVAGSGQR	101	sp|Q9UKC9-2|FBXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=14989	78.855	3	2105.0095	2105.0095	K	L	328	348
PSM	SETAPAETATPAPVEKSPAK	102	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7589	40.25702166666667	2	2102.9740	2102.9768	M	K	2	22
PSM	QVSASELHTSGILGPETLR	103	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=19283	105.58335833333332	2	2057.9812	2056.9822	R	D	2716	2735
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	104	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=18417	99.69966666666666	3	3096.557622	3095.580500	R	A	655	686
PSM	DPDAQPGGELMLGGTDSK	105	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:35	ms_run[2]:scan=10376	54.324	2	1802.7993	1802.7993	R	Y	236	254
PSM	EAFSLFDKDGDGTITTK	106	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16076	85.121	2	1843.884	1843.8840	K	E	15	32
PSM	FASDDEHDEHDENGATGPVK	107	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=4800	26.286	2	2248.8546	2248.8546	K	R	364	384
PSM	FHALSSPQSPFPSTPTSR	108	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=14272	74.911	2	2022.9201	2022.9201	K	R	1539	1557
PSM	FTDKDQQPSGSEGEDDDAEAALKK	109	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=7830	41.467	3	2660.1127	2660.1127	K	E	78	102
PSM	GPTTGEGALDLSDVHSPPKSPEGK	110	sp|O95684-2|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=11817	61.724	3	2455.1268	2455.1268	K	T	141	165
PSM	KGAGDGSDEEVDGKADGAEAK	111	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=1351	9.0933	2	2084.8536	2084.8536	R	P	1937	1958
PSM	KGNAEGSSDEEGKLVIDEPAK	112	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=8869	46.739	2	2252.021	2252.0210	K	E	119	140
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	113	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=16941	90.332	3	3656.5163	3656.5163	K	E	120	152
PSM	KPEDVLDDDDAGSAPLK	114	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9640	50.606	2	1783.8476	1783.8476	R	S	141	158
PSM	KPLAAPGDGEGLGQTAQPSPPAR	115	sp|Q9Y4F5-3|C170B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=9738	51.09	2	2294.1056	2294.1056	R	D	741	764
PSM	KSPSGPVKSPPLSPVGTTPVK	116	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=10394	54.405	3	2219.1004	2219.1004	R	L	177	198
PSM	KTSDANETEDHLESLICK	117	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11838	61.824	2	2168.9297	2168.9297	R	V	20	38
PSM	KVVDYSQFQESDDADEDYGR	118	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11551	60.374	3	2364.9982	2364.9982	R	D	9	29
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	119	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=14186	74.449	3	2676.2333	2676.2333	K	E	139	164
PSM	LKEPGPPLASSQGGSPAPSPAGCGGK	120	sp|Q68DK7|MSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=9290	48.818	3	2483.1516	2483.1516	K	G	52	78
PSM	MLDAEDIVNTARPDEK	121	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:35	ms_run[2]:scan=13521	70.786	2	1831.8622	1831.8622	K	A	240	256
PSM	PLGAAPQAEHQGLPVPGSPGGQK	122	sp|Q9Y4F5-3|C170B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=11620	60.735	2	2272.1001	2272.1001	R	W	568	591
PSM	RPSVNGEPGSVPPPR	123	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6056	32.463	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RVSEVEEEKEPVPQPLPSDDTR	124	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=10721	56.092	3	2615.2116	2615.2116	R	V	446	468
PSM	RYSDKYNVPISSADIAQNQEFYK	125	sp|Q9H334-6|FOXP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=16325	86.609	3	2815.2854	2815.2854	R	N	362	385
PSM	STAQQELDGKPASPTPVIVASHTANK	126	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=9737	51.087	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	127	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=10196	53.441	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	128	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=11382	59.485	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	129	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=12003	62.706	3	2726.3276	2726.3276	R	E	818	844
PSM	THTDSSEKELEPEAAEEALENGPK	130	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=14764	77.623	3	2690.1596	2690.1596	K	E	340	364
PSM	YREEEMTVVEEADDDK	131	sp|Q8WYA6-4|CTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:35	ms_run[2]:scan=8085	42.76	2	1972.8208	1972.8208	R	K	14	30
PSM	KPEEEEEEELEETAQEK	132	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=10080	52.84001166666667	2	2075.891850	2074.906620	R	K	62	79
PSM	ATAGDTHLGGEDFDNR	133	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6914	36.898	2	1674.7234	1674.7234	K	L	223	239
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	134	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=3959	22.058	2	2540.1908	2540.1908	R	E	7	32
PSM	DLTHSDSESSLHMSDR	135	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3777	21.104	2	1911.7306	1911.7306	R	Q	515	531
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	136	sp|P42167-2|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=13203	69.032	3	2649.1708	2649.1708	K	S	61	87
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	137	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	25-UNIMOD:21	ms_run[2]:scan=13685	71.682	3	2931.3764	2931.3764	R	D	374	402
PSM	KECEEEAINIQSTAPEEEHESPR	138	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=9629	50.552	3	2791.1644	2791.1644	K	A	275	298
PSM	KESKEEETSIDVAGK	139	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=4522	24.923	2	1728.7819	1728.7819	K	P	459	474
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	140	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=16562	88.049	3	3656.5163	3656.5163	K	E	120	152
PSM	KPSVGVPPPASPSYPR	141	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=9995	52.404	2	1714.8444	1714.8444	R	A	980	996
PSM	KWSLEDDDDDEDDPAEAEK	142	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11312	59.101	2	2220.8819	2220.8819	K	E	197	216
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	143	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:21	ms_run[2]:scan=11180	58.406	3	3134.4962	3134.4962	K	R	178	209
PSM	KYMEDVTQIVVEPEPTAEEKPSPR	144	sp|O15297-2|PPM1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=13076	68.342	3	2867.33	2867.3300	R	R	19	43
PSM	LKDEDDEDDCFILEK	145	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=12827	67.014	2	1882.8142	1882.8142	K	A	449	464
PSM	LKPGGVGAPSSSSPSPSPSAR	146	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=5717	30.785	2	2001.9521	2001.9521	K	P	1159	1180
PSM	MADEAGSEADHEGTHSTK	147	sp|P02671|FIBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=822	6.7385	2	1967.7204	1967.7204	K	R	603	621
PSM	MDRTPPPPTLSPAAITVGR	148	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14436	75.799	2	2072.0126	2072.0126	R	G	587	606
PSM	MLDAEDIVGTARPDEK	149	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35	ms_run[2]:scan=12817	66.964	2	1774.8407	1774.8407	K	A	221	237
PSM	NSSPLLVHSSSSSSSSSSSSHSMESFR	150	sp|O15265-3|ATX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,23-UNIMOD:35	ms_run[2]:scan=8353	44.104	3	2880.1869	2880.1869	K	K	564	591
PSM	RGSFPLAAAGPSQSPAPPLPEEDR	151	sp|Q8IY26|PLPP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=15935	84.321	3	2526.1904	2526.1904	R	M	68	92
PSM	RGSFPLAAAGPSQSPAPPLPEEDR	152	sp|Q8IY26|PLPP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=15992	84.651	2	2526.1904	2526.1904	R	M	68	92
PSM	RPSPPEPWDEEDGASCSTFFGSEER	153	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=18166	98.099	3	2948.1596	2948.1596	R	T	934	959
PSM	RPTPQDSPIFLPVDDTSFR	154	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=18828	102.48	2	2267.0624	2267.0624	R	W	1405	1424
PSM	SAPTAPTPPPPPPPATPR	155	sp|Q14202|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=8766	46.244	2	1827.892	1827.8921	R	K	811	829
PSM	SAPTAPTPPPPPPPATPR	156	sp|Q14202|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=8964	47.254	2	1827.892	1827.8921	R	K	811	829
PSM	SQSLSSTDSSVHAPSEITVAHGSGLGK	157	sp|Q9Y2H2-4|SAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=12186	63.716	3	2718.2498	2718.2498	R	G	295	322
PSM	TITSAHTSSTSTSLESDSASPGVSDHGR	158	sp|Q5TH69|BIG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=7655	40.569	3	2854.2254	2854.2254	K	G	276	304
PSM	VDIDTPDIDIHGPEGK	159	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14277	74.941	2	1719.8315	1719.8315	K	L	4096	4112
PSM	VHAAPAAPSATALPASPVAR	160	sp|Q8N5H7-3|SH2D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=9946	52.149	2	1933.9775	1933.9775	R	R	71	91
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	161	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:21	ms_run[2]:scan=7099	37.786	3	2664.2293	2664.2293	R	R	503	531
PSM	VSYGIGDEEHDQEGR	162	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6436	34.397	2	1689.7231	1689.7231	K	V	142	157
PSM	VVDFGSATYDDEHHSTLVSTR	163	sp|P49759-3|CLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=12914	67.476	2	2415.038	2415.0380	K	H	365	386
PSM	WQRPSSPPPFLPAASEEAEPAEGLR	164	sp|Q4KMQ1-2|TPRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=18520	100.35	3	2798.3065	2798.3065	R	V	107	132
PSM	QTALLDADDPVSQLHK	165	sp|Q06330|SUH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=17219	92.04944	2	1732.8610	1732.8627	K	C	270	286
PSM	KPSVGVPPPASPSYPR	166	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=10191	53.414101666666674	2	1715.845589	1714.844372	R	A	969	985
PSM	QEHSGSEEAQKPNLEGSVSHK	167	sp|Q7Z412|PEX26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5583	30.143021666666666	3	2340.0000	2340.0014	K	F	208	229
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	168	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=18255	98.682875	3	3096.557211	3095.580500	R	A	655	686
PSM	AFGSGIDIKPGTPPIAGR	169	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=15193	80.007	2	1832.9186	1832.9186	K	S	2419	2437
PSM	ALSEEKDEEDGENAHPYR	170	sp|Q9NSI8|SAMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5965	31.991	2	2167.8695	2167.8695	K	N	88	106
PSM	APPPVAYNPIHSPSYPLAALK	171	sp|Q9UMS6-5|SYNP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=19058	104.07	2	2282.1501	2282.1501	R	S	524	545
PSM	DKVVEDDEDDFPTTR	172	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9034	47.596	2	1779.7799	1779.7799	R	S	197	212
PSM	DLDDALSCKPLADGNFK	173	sp|Q8IYB7-3|DI3L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=15864	83.942	2	1877.8829	1877.8829	R	V	389	406
PSM	DPDDDKFFQSAMSICSSLR	174	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=19040	103.95	3	2233.962	2233.9620	K	D	409	428
PSM	EKDSPHMQDPNQADEEAMTQIIR	175	sp|P23511-2|NFYA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,7-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=8999	47.428	3	2794.1575	2794.1575	K	V	294	317
PSM	EKPGTPPGPPPPDTNSMELGGR	176	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=8347	44.077	3	2326.0301	2326.0301	K	P	446	468
PSM	ELEGHISDLQEDLDSER	177	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15225	80.186	2	1983.9021	1983.9021	R	A	1115	1132
PSM	FASDDEHDEHDENGATGPVK	178	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5032	27.411	2	2248.8546	2248.8546	K	R	364	384
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	179	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13269	69.404	3	2762.2735	2762.2735	K	Q	609	638
PSM	HDYDDSSEEQSAEIR	180	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5217	28.358	2	1779.7184	1779.7184	K	G	55	70
PSM	HIISATSLSTSPTELGSR	181	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=13171	68.842	2	1935.9303	1935.9303	R	N	216	234
PSM	KGNAEGSSDEEGKLVIDEPAK	182	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=8771	46.267	3	2252.021	2252.0210	K	E	119	140
PSM	KPSVGVPPPASPSYPR	183	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=9799	51.39	2	1714.8444	1714.8444	R	A	980	996
PSM	KQETEEELIENDYR	184	sp|Q96M89-2|CC138_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11178	58.394	2	1794.8272	1794.8272	K	V	102	116
PSM	LASEAKPAAVAAENEEIGSHIK	185	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=13585	71.14	3	2314.1206	2314.1206	R	H	1896	1918
PSM	LEAEEGRNSLSPVQATQKPLVSK	186	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=10719	56.082	3	2560.2898	2560.2898	R	K	113	136
PSM	LEDELKDDAQSVETLGKPK	187	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=12478	65.206	3	2194.0406	2194.0406	K	A	2171	2190
PSM	QHLGATGGPGAQLGASFLQAR	188	sp|Q9NWW5|CLN6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=16397	87.036	2	2116.0215	2116.0215	R	H	8	29
PSM	REEGPPPPSPDGASSDAEPEPPSGR	189	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=7192	38.258	3	2594.0922	2594.0922	R	T	14	39
PSM	RLSVEESGLGLGLGPGR	190	sp|Q2M3V2|SWAHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=16651	88.567	2	1775.8931	1775.8931	R	S	258	275
PSM	RPASTAGLPTTLGPAMVTPGVATIR	191	sp|O43312-2|MTSS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=17254	92.262	3	2530.2979	2530.2979	K	R	284	309
PSM	RPSPPEPWDEEDGASCSTFFGSEER	192	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=18358	99.308	3	2948.1596	2948.1596	R	T	934	959
PSM	RTEQEEDEELLTESSK	193	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9573	50.266	2	1921.8753	1921.8753	R	A	145	161
PSM	RTGSTPSIASTHSELSTYSNNSGNAAVIK	194	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=13001	67.941	3	3029.4091	3029.4091	R	Y	796	825
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	195	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,9-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=6601	35.236	3	3165.2289	3165.2289	K	D	1015	1044
PSM	RVSSDEEHTVDSCISDMK	196	sp|Q70CQ2-3|UBP34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7323	38.904	2	2189.8606	2189.8606	R	T	3122	3140
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	197	sp|A0FGR8-5|ESYT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:21,29-UNIMOD:35	ms_run[2]:scan=7189	38.24	3	3244.3091	3244.3091	K	A	95	127
PSM	SIQEIQELDKDDESLR	198	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14091	73.943	2	1916.9327	1916.9327	K	K	34	50
PSM	SPQPARPGSAAVPGAAFAPIPR	199	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=15335	80.805	3	2194.1048	2194.1048	R	S	804	826
PSM	STAQQELDGKPASPTPVIVASHTANK	200	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=12235	63.985	3	2726.3276	2726.3276	R	E	818	844
PSM	STTPPPAEPVSLPQEPPKPR	201	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=11527	60.258	2	2204.0878	2204.0878	K	V	225	245
PSM	TAKPFPGSVNQPATPFSPTR	202	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=13590	71.169	2	2179.0463	2179.0463	R	N	193	213
PSM	THSAASSSQGASVNPEPLHSSLDK	203	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=8377	44.211	3	2486.1075	2486.1075	K	L	468	492
PSM	VHAYFAPVTPPTAVAGSGQR	204	sp|Q9UKC9-2|FBXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=14963	78.702	2	2105.0095	2105.0095	K	L	328	348
PSM	VKEEQLKNSAEEEVLSSEK	205	sp|O94880|PHF14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=10717	56.072	3	2255.057	2255.0570	K	Q	76	95
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	206	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16572	88.09847333333333	3	3442.3952	3442.4027	K	L	104	135
PSM	STAQQELDGKPASPTPVIVASHTANK	207	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=11076	57.85876333333333	3	2727.310880	2726.327640	R	E	847	873
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	208	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7029	37.482011666666665	3	3007.3243	3007.3290	K	S	145	174
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	209	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=18096	97.67140166666667	3	3096.558466	3095.580500	R	A	655	686
PSM	STAQQELDGKPASPTPVIVASHTANK	210	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	23-UNIMOD:21	ms_run[1]:scan=8859	46.69099	3	2726.324590	2726.327640	R	E	847	873
PSM	AAASVMCHIEPDDGDDFVR	211	sp|Q5JUR7|TEX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=11667	60.963	2	2119.8939	2119.8939	R	G	107	126
PSM	AAEDDEDDDVDTKK	212	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1147	8.1662	2	1564.6377	1564.6377	R	Q	90	104
PSM	APEPHVEEDDDDELDSK	213	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=6663	35.558	2	1938.7967	1938.7967	K	L	5	22
PSM	AVSPPHLDGPPSPR	214	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=9462	49.717	2	1505.7028	1505.7028	K	S	516	530
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	215	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=3680	20.637	3	2540.1908	2540.1908	R	E	7	32
PSM	DLHQGIEAASDEEDLR	216	sp|Q9UKS6|PACN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11951	62.416	3	1796.8177	1796.8177	R	W	267	283
PSM	EHLLDDEEEDEEIMR	217	sp|Q9Y4E6-2|WDR7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:35	ms_run[2]:scan=10399	54.428	2	1916.7946	1916.7946	K	Q	756	771
PSM	EIIDASDKEGMSPAKR	218	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4028	22.403	2	1841.823	1841.8230	K	T	82	98
PSM	ERPDLEAPAPGSPFR	219	sp|Q9NQT8-2|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=12529	65.471	2	1717.7825	1717.7825	R	V	152	167
PSM	FEEAAFTCEYKYDGQR	220	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=13248	69.282	2	2012.8574	2012.8574	R	A	558	574
PSM	FHALSSPQSPFPSTPTSR	221	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=13278	69.446	2	2022.9201	2022.9201	K	R	1539	1557
PSM	GFPEPSQATAPPPTVPTRPSPGAIQSR	222	sp|Q8NFA2-4|NOXO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21	ms_run[2]:scan=14533	76.342	3	2822.3753	2822.3753	R	C	311	338
PSM	GKEESLDSDLYAELR	223	sp|P02775|CXCL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16000	84.689	2	1723.8265	1723.8265	K	C	48	63
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	224	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:35	ms_run[2]:scan=8426	44.461	3	2678.0926	2678.0926	R	E	418	442
PSM	GSRPPLILQSQSLPCSSPR	225	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=14434	75.788	2	2159.0558	2159.0558	K	D	290	309
PSM	GWLRDPSASPGDAGEQAIR	226	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=13698	71.74	3	2061.9269	2061.9269	K	Q	282	301
PSM	HGGVCAPAAVATSPPGAIPK	227	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11303	59.058	3	1936.923	1936.9230	R	E	238	258
PSM	IEEVLSPEGSPSKSPSKK	228	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=6653	35.512	2	1977.966	1977.9660	K	K	636	654
PSM	KAALSASEGEEVPQDK	229	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5251	28.498	2	1657.8159	1657.8159	K	A	25	41
PSM	KDPEDTGAEKSPTTSADLK	230	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=3949	21.999	2	2068.9202	2068.9202	K	S	304	323
PSM	KLEELTSNVSDQETSSEEEEAKDEK	231	sp|Q9BV36-3|MELPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=9176	48.269	3	2933.255	2933.2550	R	A	320	345
PSM	KQEDFMTTMDANEEK	232	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3311	18.817	2	1847.7553	1847.7553	K	I	1210	1225
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	233	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:21	ms_run[2]:scan=11565	60.451	3	3134.4962	3134.4962	K	R	178	209
PSM	LEPVSPPSPPHTDPELELVPPR	234	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=17974	96.875	3	2482.2145	2482.2145	K	L	145	167
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	235	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=16476	87.526	3	2948.4532	2948.4532	R	R	129	157
PSM	LGSTSSNSSCSSTECPGEAIPHPPGLPK	236	sp|Q9H3Y8-2|PPDPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=14865	78.165	3	2933.2573	2933.2573	R	A	21	49
PSM	LKPFFEGMSQSSSQTEIGSLNSK	237	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=16343	86.713	3	2597.172	2597.1721	K	G	399	422
PSM	LLKEGEEPTVYSDEEEPKDESAR	238	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=9485	49.821	3	2729.1957	2729.1957	K	K	118	141
PSM	LPSVEEAEVPKPLPPASK	239	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=13895	72.823	2	1967.0017	1967.0017	R	D	62	80
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	240	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=4633	25.468	3	3024.3561	3024.3561	K	S	73	102
PSM	RAEDGSVIDYELIDQDAR	241	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15770	83.357	3	2063.976	2063.9760	R	D	197	215
PSM	RAEDGSVIDYELIDQDAR	242	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15775	83.392	2	2063.976	2063.9760	R	D	197	215
PSM	RASHPTAESSSEQGASEADIDSDSGYCSPK	243	sp|Q93073-2|SBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=8002	42.334	3	3205.2779	3205.2779	R	H	249	279
PSM	RDSSESQLASTESDKPTTGR	244	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=4694	25.747	3	2230.9703	2230.9703	R	V	64	84
PSM	REFITGDVEPTDAESEWHSENEEEEK	245	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	19-UNIMOD:21	ms_run[2]:scan=14379	75.47	3	3171.283	3171.2830	R	L	107	133
PSM	RTSPANSSGDSAIASCHDGGSSYGK	246	sp|Q86UZ6|ZBT46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4590	25.241	3	2548.0286	2548.0286	R	E	174	199
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	247	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21,9-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=6807	36.333	3	3165.2289	3165.2289	K	D	1015	1044
PSM	SHTSLKDELSDVSQGGSK	248	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=10154	53.222	2	1953.8681	1953.8681	R	A	242	260
PSM	SLGDDISSETSGDFR	249	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13888	72.789	2	1584.6904	1584.6904	K	K	139	154
PSM	STAQQELDGKPASPTPVIVASHTANK	250	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=10459	54.721	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	251	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=12865	67.229	3	2726.3276	2726.3276	R	E	818	844
PSM	STQIENQHQGAQDTSDLMSPSKR	252	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=4827	26.42	3	2653.1439	2653.1439	R	S	213	236
PSM	STTPPPAEPVSLPQEPPKPR	253	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=12330	64.468	2	2204.0878	2204.0878	K	V	225	245
PSM	SVAPASPPPPDGPLAHR	254	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=8911	46.967	2	1744.8298	1744.8298	R	L	319	336
PSM	TAKPFPGSVNQPATPFSPTR	255	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=13779	72.181	2	2179.0463	2179.0463	R	N	193	213
PSM	TKGDDTDTRDDISILATGCK	256	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=12949	67.666	3	2260.9883	2260.9883	K	G	586	606
PSM	TQATGLTKPTLPPSPLMAAR	257	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13678	71.645	3	2146.0857	2146.0857	R	R	411	431
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	258	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=11067	57.811	3	3272.5351	3272.5351	R	G	153	185
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	259	sp|Q04323-2|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	24-UNIMOD:21	ms_run[2]:scan=11458	59.904	3	3162.5023	3162.5023	K	E	179	210
PSM	KGAGDGSDEEVDGKADGAEAK	260	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=2150	13.078935000000001	3	2085.855580	2084.853553	R	P	1937	1958
PSM	QFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPR	261	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,20-UNIMOD:21,30-UNIMOD:35	ms_run[1]:scan=17659	94.86010833333334	3	3497.5840	3497.5917	K	Q	736	771
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	262	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13281	69.46122833333334	3	2971.4174	2971.4211	K	H	206	232
PSM	QSPLTYEDHGAPFAGHLPR	263	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=16704	88.85955333333334	2	2154.9479	2154.9519	R	G	1538	1557
PSM	AFDQGADAIYDHINEGK	264	sp|Q9UDW1|QCR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14777	77.696	2	1862.8435	1862.8435	R	L	35	52
PSM	AHFNAMFQPSSPTR	265	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=9256	48.655	2	1685.7021	1685.7021	R	R	883	897
PSM	AKDDDDSDIPTAQR	266	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3373	19.084	2	1545.6907	1545.6907	K	K	473	487
PSM	AVSILPLLGHGVPR	267	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=20493	113.98	2	1507.8276	1507.8276	R	L	179	193
PSM	DASDDLDDLNFFNQK	268	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20439	113.6	2	1755.7588	1755.7588	K	K	65	80
PSM	DLKPENILCESPEKVSPVK	269	sp|Q9BUB5-3|MKNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=15331	80.782	3	2261.1015	2261.1015	R	I	170	189
PSM	DLTHSDSESSLHMSDR	270	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=4246	23.558	2	1911.7306	1911.7306	R	Q	515	531
PSM	DLTHSDSESSLHMSDR	271	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=7606	40.341	2	1895.7357	1895.7357	R	Q	515	531
PSM	EATSDPSRTPEEEPLNLEGLVAHR	272	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=17637	94.725	3	2726.2549	2726.2549	K	V	852	876
PSM	EATSDPSRTPEEEPLNLEGLVAHR	273	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=17801	95.74	3	2726.2549	2726.2549	K	V	852	876
PSM	EHVEEISELFYDAK	274	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18015	97.141	2	1707.7992	1707.7992	K	S	428	442
PSM	ELNSNHDGADETSEK	275	sp|Q01105-2|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1059	7.7801	2	1644.6863	1644.6863	K	E	12	27
PSM	FASDDEHDEHDENGATGPVK	276	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=5018	27.348	2	2248.8546	2248.8546	K	R	364	384
PSM	FEEAAFTCEYKYDGQR	277	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4	ms_run[2]:scan=13020	68.041	2	2012.8574	2012.8574	R	A	558	574
PSM	GKPIFPVYPLVGSSSPTR	278	sp|A6NEL2|SWAHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	15-UNIMOD:21	ms_run[2]:scan=19051	104.02	2	1981.0074	1981.0074	R	K	728	746
PSM	GLRDSHSSEEDEASSQTDLSQTISK	279	sp|Q5JTV8-3|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=9686	50.839	3	2786.188	2786.1880	R	K	150	175
PSM	GVVDSDDLPLNVSR	280	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14715	77.348	2	1484.7471	1484.7471	K	E	435	449
PSM	HDSVENSDSHVEK	281	sp|Q9H9J4-2|UBP42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=914	7.1466	2	1561.6046	1561.6046	R	K	1164	1177
PSM	HYGITSPISLAAPK	282	sp|P51003-2|PAPOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=15235	80.239	2	1533.7592	1533.7592	K	E	19	33
PSM	IDASKNEEDEGHSNSSPR	283	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=953	7.3092	2	2050.8229	2050.8229	K	H	68	86
PSM	IKVEPVALAPSPVIPR	284	sp|Q5VWG9|TAF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=16692	88.793	2	1764.9903	1764.9903	K	L	745	761
PSM	ILDSVGIEADDDRLNK	285	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12493	65.277	2	1771.8952	1771.8952	K	V	26	42
PSM	IYHLPDAESDEDEDFK	286	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=14483	76.07	2	2001.7881	2001.7881	K	E	210	226
PSM	KDAEEEESELGYIPK	287	sp|P49750-1|YLPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11835	61.808	2	1735.8152	1735.8152	K	S	1833	1848
PSM	KPSVGVPPPASPSYPR	288	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=10403	54.447	2	1714.8444	1714.8444	R	A	980	996
PSM	KVYEDSGIPLPAESPK	289	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=12781	66.759	2	1808.8597	1808.8597	R	K	49	65
PSM	LLDHMAPPPVADQASPR	290	sp|Q9C004|SPY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8802	46.412	2	1909.8757	1909.8757	R	A	111	128
PSM	NSSTETDQQPHSPDSSSSVHSIR	291	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=4251	23.583	2	2562.062	2562.0620	R	N	555	578
PSM	PDERPSSPIPLLPPPK	292	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=14214	74.593	2	1818.9281	1818.9281	R	K	1147	1163
PSM	PFSAPKPQTSPSPK	293	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=6365	34.049	2	1547.7385	1547.7385	K	R	298	312
PSM	RAPSTSPSFEGTQETYTVAHEENVR	294	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=12232	63.968	3	2872.2665	2872.2665	R	F	75	100
PSM	RPSVNGEPGSVPPPR	295	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=6142	32.868	2	1624.7723	1624.7723	R	A	1255	1270
PSM	SKSVKEDSNLTLQEK	296	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=5405	29.25	2	1784.8557	1784.8557	K	K	1441	1456
PSM	SPGPGPGPGAGAEPGATGGSSHFISSR	297	sp|Q9ULI0-2|ATD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=10060	52.732	3	2471.0867	2471.0867	K	T	16	43
PSM	STTPPPAEPVSLPQEPPKPR	298	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=12080	63.113	3	2204.0878	2204.0878	K	V	225	245
PSM	TAHNSEADLEESFNEHELEPSSPK	299	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	21-UNIMOD:21	ms_run[2]:scan=14367	75.409	3	2776.1501	2776.1501	K	S	100	124
PSM	TQATGLTKPTLPPSPLMAAR	300	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13925	73.005	3	2146.0857	2146.0857	R	R	411	431
PSM	VPPAPVPCPPPSPGPSAVPSSPK	301	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=12229	63.953	2	2298.112	2298.1120	K	S	366	389
PSM	VPVCQPLKEEDDDEGPVDK	302	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:4	ms_run[2]:scan=9104	47.931	3	2167.9943	2167.9943	K	S	278	297
PSM	EATSDPSRTPEEEPLNLEGLVAHR	303	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:27,9-UNIMOD:21	ms_run[1]:scan=19048	104.00501166666668	3	2708.2408	2708.2438	K	V	852	876
PSM	STAQQELDGKPASPTPVIVASHTANK	304	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=10871	56.847044999999994	3	2727.309777	2726.327640	R	E	847	873
PSM	VHAYFAPVTPPPSVGGSR	305	sp|Q96IG2|FXL20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=14191	74.47454	2	1918.914910	1917.913849	K	Q	409	427
PSM	FASDDEHDEHDENGATGPVK	306	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=5349	28.965768333333333	2	2249.836013	2248.854615	K	R	364	384
PSM	VNSNGKESPGSSEFFQEAVSHGK	307	sp|Q8N108|MIER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=13668	71.59011333333333	3	2502.067464	2501.086012	R	F	481	504
PSM	AAEDDEDDDVDTK	308	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1677	10.656	2	1436.5427	1436.5427	R	K	90	103
PSM	AHSPGLLGPALGPPYPSGR	309	sp|Q6UXY1-2|BI2L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=16074	85.109	2	1922.9404	1922.9404	R	L	229	248
PSM	ATFGCHDGYSLDGPEEIECTK	310	sp|P02749|APOH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=14101	73.988	3	2384.9889	2384.9889	K	L	230	251
PSM	DKKSPLIESTANMDNNQSQK	311	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3965	22.084	3	2343.0414	2343.0414	R	T	209	229
PSM	DLDEVLQTHSVFVNVSK	312	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19326	105.86	2	1928.9844	1928.9844	K	G	46	63
PSM	ESEDKPEIEDVGSDEEEEKK	313	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=7205	38.322	2	2399.9741	2399.9741	K	D	251	271
PSM	FASDDEHDEHDENGATGPVK	314	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=5235	28.439	3	2248.8546	2248.8546	K	R	364	384
PSM	GEQEHSQQKEEEEEMAVVPQGLFR	315	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15750	83.243	3	2909.2539	2909.2539	K	G	295	319
PSM	GGSGSPGPEPPGRPDGPSLLYR	316	sp|Q14526-2|HIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=13230	69.184	2	2229.0216	2229.0216	R	W	290	312
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	317	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=14265	74.873	3	2842.2698	2842.2698	R	E	181	208
PSM	GVVDSDDLPLNVSR	318	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14910	78.412	2	1484.7471	1484.7471	K	E	435	449
PSM	HGGVCAPAAVATSPPGAIPK	319	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11490	60.072	3	1936.923	1936.9230	R	E	238	258
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	320	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=16230	86.045	3	2771.2175	2771.2175	R	N	1116	1140
PSM	ISESVLRDSPPPHEDYEDEVFVR	321	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=16410	87.114	3	2794.2487	2794.2487	R	D	1489	1512
PSM	ISYTPPESPVPSYASSTPLHVPVPR	322	sp|P41212|ETV6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=18927	103.16	3	2757.3415	2757.3415	R	A	15	40
PSM	KDDEEEDPLDQLISR	323	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17531	94.062	2	1800.8378	1800.8378	K	S	17	32
PSM	KPAPLPSPGLNSAAK	324	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=9196	48.367	2	1526.7858	1526.7858	R	R	601	616
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	325	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=14515	76.239	3	2742.2819	2742.2819	K	K	761	786
PSM	KTEELEEESFPER	326	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9134	48.088	2	1621.7471	1621.7471	R	S	486	499
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	327	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:21	ms_run[2]:scan=10984	57.396	3	3134.4962	3134.4962	K	R	178	209
PSM	LKPGGVGAPSSSSPSPSPSAR	328	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=5746	30.922	3	2001.9521	2001.9521	K	P	1159	1180
PSM	LKSEDGVEGDLGETQSR	329	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=8383	44.245	2	1898.8259	1898.8259	R	T	133	150
PSM	NDMAVPTPPPPPVPPTK	330	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=11521	60.237	2	1849.8685	1849.8685	K	Q	486	503
PSM	NLSDSEKELYIQHAK	331	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=9274	48.734	2	1853.8561	1853.8561	K	E	159	174
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	332	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9962	52.242	3	2979.3277	2979.3277	K	S	458	487
PSM	PKTPPTAPEPAAAVQAPLPR	333	sp|E7EW31|PROB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=12583	65.728	3	2088.0769	2088.0769	K	E	818	838
PSM	RAAEDDEDDDVDTK	334	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=984	7.4468	2	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	335	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1254	8.6569	2	1592.6438	1592.6438	K	K	89	103
PSM	RASAPLPGLSAPGR	336	sp|O14558|HSPB6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10856	56.774	2	1428.7239	1428.7239	R	L	14	28
PSM	RNSSEASSGDFLDLK	337	sp|Q9UK76-2|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=14284	74.974	2	1704.7356	1704.7356	R	K	85	100
PSM	RPSVNGEPGSVPPPR	338	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=5853	31.439	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RTSMGGTQQQFVEGVR	339	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=8413	44.392	2	1875.8299	1875.8299	R	M	550	566
PSM	RVSEVEEEKEPVPQPLPSDDTR	340	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10795	56.449	2	2615.2116	2615.2116	R	V	446	468
PSM	SKGHYEVTGSDDETGK	341	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=2433	14.497	2	1788.7204	1788.7204	K	L	5832	5848
PSM	SLSTSGESLYHVLGLDK	342	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=21595	122.1	2	1884.887	1884.8870	R	N	8	25
PSM	STAGDTHLGGEDFDNR	343	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7038	37.517	2	1690.7183	1690.7183	K	M	221	237
PSM	STAGDTHLGGEDFDNR	344	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7245	38.518	2	1690.7183	1690.7183	K	M	221	237
PSM	TYSDTDSCSDIPLEDPDRPVHCSK	345	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,8-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=11555	60.393	3	2873.1521	2873.1521	R	N	242	266
PSM	VKVEPADSVESSPPSITHSPQNELK	346	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=11949	62.403	3	2754.3113	2754.3113	K	G	408	433
PSM	VLRPPGGGSNFSLGFDEPTEQPVR	347	sp|Q9UK76-2|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=18272	98.805	3	2635.2432	2635.2432	R	K	20	44
PSM	VPPAPVPCPPPSPGPSAVPSSPK	348	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=12742	66.553	3	2298.112	2298.1120	K	S	366	389
PSM	CCAAADPHECYAK	349	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=6367	34.056556666666665	2	1534.5627	1534.5634	K	V	384	397
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	350	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	25-UNIMOD:21	ms_run[1]:scan=11372	59.433175	3	3134.487916	3134.496162	K	R	178	209
PSM	STAQQELDGKPASPTPVIVASHTANK	351	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21	ms_run[1]:scan=11182	58.418553333333335	3	2727.310880	2726.327640	R	E	847	873
PSM	KTDPLSLEGYVSSAPLTKPPEK	352	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:21	ms_run[1]:scan=17638	94.72836333333333	3	2438.225803	2436.218924	R	G	991	1013
PSM	SPSGSQRPSVSDDTEHLVNGR	353	sp|P16144-2|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=8107	42.868383333333334	2	2304.993578	2304.013182	R	M	1356	1377
PSM	EATSDPSRTPEEEPLNLEGLVAHR	354	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=17524	94.0316	3	2727.235974	2726.254869	K	V	852	876
PSM	TAHNSEADLEESFNEHELEPSSPK	355	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	22-UNIMOD:21	ms_run[1]:scan=14185	74.44589	3	2777.129517	2776.150129	K	S	134	158
PSM	AAPAQVRPPSPGNIR	356	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=9364	49.201	2	1609.809	1609.8090	K	P	210	225
PSM	AEEQQLPPPLSPPSPSTPNHR	357	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=12862	67.215	3	2358.1005	2358.1005	K	R	279	300
PSM	AGDKDDITEPAVCALR	358	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=11288	58.984	2	1729.8305	1729.8305	R	H	445	461
PSM	AMVSPFHSPPSTPSSPGVR	359	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=11020	57.567	2	2032.9078	2032.9078	K	S	113	132
PSM	APEPHVEEDDDDELDSK	360	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8037	42.516	3	1938.7967	1938.7967	K	L	5	22
PSM	ATASGKVSPDHLDPER	361	sp|Q68DK2-5|ZFY26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=6006	32.214	2	1758.7938	1758.7938	R	A	290	306
PSM	CVPAPGAGASGGTSPSATQPNPAVFIFEHK	362	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=19782	109	3	3031.3899	3031.3899	R	A	93	123
PSM	DKSPVREPIDNLTPEER	363	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=10774	56.357	2	2073.9732	2073.9732	K	D	134	151
PSM	DLEADIIGDTSGHFQK	364	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18226	98.495	2	1744.8268	1744.8268	R	M	109	125
PSM	EDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIK	365	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	22-UNIMOD:4,26-UNIMOD:21	ms_run[2]:scan=15290	80.542	3	3597.7062	3597.7062	K	G	607	642
PSM	EGKPEIEGKPESEGEPGSETR	366	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=4820	26.39	3	2321.006	2321.0060	R	A	91	112
PSM	EKEISDDEAEEEKGEK	367	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=2910	16.92	2	1943.7885	1943.7885	R	E	222	238
PSM	FNLTYVSHDGDDK	368	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10882	56.901	2	1509.6736	1509.6736	R	K	571	584
PSM	FYDADDYHPEENR	369	sp|Q5T6J7|GNTK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8075	42.702	2	1669.6645	1669.6645	K	R	32	45
PSM	GRQSQQEAEEEEREEEEEAQIIQR	370	sp|Q9NQZ2|SAS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=13061	68.265	3	3009.2949	3009.2949	R	R	147	171
PSM	HCAPSPDRSPELSSSR	371	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3974	22.125	2	1941.7442	1941.7442	R	D	622	638
PSM	IDVDAPDIDIHGPDAK	372	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14094	73.954	2	1689.821	1689.8210	K	L	3260	3276
PSM	IEDVGSDEEDDSGKDKK	373	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=900	7.0897	2	1944.7837	1944.7837	K	K	250	267
PSM	IKEDILTDEDEK	374	sp|Q9NYU1|UGGG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8448	44.575	2	1446.709	1446.7090	K	T	1194	1206
PSM	IPMTPTSSFVSPPPPTASPHSNR	375	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12356	64.605	3	2500.1458	2500.1458	K	T	373	396
PSM	KASSDMSASAGYEEISDPDMEEKPSLPPR	376	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,6-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=12268	64.159	3	3235.3574	3235.3574	R	K	497	526
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAPR	377	sp|P09012|SNRPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=12006	62.719	3	2966.4507	2966.4507	K	I	123	153
PSM	KDDDDEEIGGPK	378	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=2106	12.844	2	1316.5732	1316.5732	K	E	628	640
PSM	KPAPLPSPGLNSAAK	379	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8981	47.34	2	1526.7858	1526.7858	R	R	601	616
PSM	KQSFDDNDSEELEDK	380	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6527	34.86	2	1797.7541	1797.7541	K	D	105	120
PSM	KTDTVVESSVSGDHSGTLR	381	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=7145	38.004	3	2053.9317	2053.9317	R	R	33	52
PSM	KTEELEEESFPER	382	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9343	49.108	2	1621.7471	1621.7471	R	S	486	499
PSM	KVAEPELMGTPDGTCYPPPPVPR	383	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=13859	72.633	3	2603.1801	2603.1801	R	Q	1875	1898
PSM	KVEEDLKADEPSSEESDLEIDK	384	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=11711	61.187	3	2584.1317	2584.1317	K	E	64	86
PSM	KVSSAEGAAKEEPK	385	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=1658	10.571	2	1509.7076	1509.7076	R	R	5	19
PSM	KYEEIDNAPEER	386	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=4940	26.971	2	1491.6842	1491.6842	K	A	91	103
PSM	LKDQDQDEDEEEK	387	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=891	7.0578	2	1619.6799	1619.6799	R	E	182	195
PSM	LPSVEEAEVPKPLPPASK	388	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=13997	73.421	3	1967.0017	1967.0017	R	D	62	80
PSM	LRSPPEALVQGR	389	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=9011	47.485	2	1401.713	1401.7130	R	Y	130	142
PSM	PDERPSSPIPLLPPPK	390	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=14171	74.382	3	1818.9281	1818.9281	R	K	1147	1163
PSM	PGLRPAPNSVDVDDFINTR	391	sp|P55287|CAD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=17783	95.624	3	2162.0157	2162.0157	R	I	706	725
PSM	PMNRPSAANPCSPVQFSSTPLAGLAPK	392	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:35,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=18142	97.951	3	2890.3507	2890.3507	K	R	1332	1359
PSM	PQLPGSHPASSPAQGNR	393	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=4479	24.727	2	1779.8054	1779.8054	R	Q	274	291
PSM	RAAEDDEDDDVDTK	394	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1478	9.6873	2	1592.6438	1592.6438	K	K	89	103
PSM	RGPDAVAAPPGGTER	395	sp|P08913|ADA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=4345	24.08	2	1529.6988	1529.6988	R	R	249	264
PSM	RLAAAEETAVSPR	396	sp|Q9BUH6|PAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=5562	30.047	2	1449.6977	1449.6977	R	K	138	151
PSM	RPGGEPSPEGTTGQSYNQYSQR	397	sp|P02751|FINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	20-UNIMOD:21	ms_run[2]:scan=6391	34.179	3	2475.0452	2475.0452	R	Y	2426	2448
PSM	SAKDSDDEEEVVHVDR	398	sp|P61266-2|STX1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=6484	34.625	2	1908.7738	1908.7738	R	D	10	26
PSM	SEDGYHSDGDYGEHDYR	399	sp|P52756-4|RBM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=5318	28.832	3	2080.7072	2080.7072	R	H	72	89
PSM	SISSPSVSSETMDKPVDLSTRK	400	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=9860	51.716	3	2446.1298	2446.1299	K	E	2802	2824
PSM	SLSVPAASTAKPPPLPR	401	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=13624	71.37	2	1767.9284	1767.9284	K	S	1160	1177
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	402	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=7375	39.156	3	3200.3895	3200.3895	K	E	204	236
PSM	STAQQELDGKPASPTPVIVASHTANK	403	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=8594	45.254	3	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	404	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=9115	47.991	2	1744.8298	1744.8298	R	L	319	336
PSM	TQATGLTKPTLPPSPLMAAR	405	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13261	69.366	3	2146.0857	2146.0857	R	R	411	431
PSM	VDSTTCLFPVEEK	406	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=15981	84.592	2	1603.6841	1603.6841	R	A	241	254
PSM	VHSPSGALEECYVTEIDQDKYAVR	407	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=17354	92.917	3	2845.263	2845.2630	K	F	2360	2384
PSM	VPPAPVPCPPPSPGPSAVPSSPK	408	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12648	66.068	2	2298.112	2298.1120	K	S	366	389
PSM	WQRPSSPPPFLPAASEEAEPAEGLR	409	sp|Q4KMQ1-2|TPRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=18364	99.339	3	2798.3065	2798.3065	R	V	107	132
PSM	YAPISGGDHAEVDVPK	410	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9706	50.937	2	1653.7999	1653.7999	K	S	927	943
PSM	YKDDDDDQLFYTR	411	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11435	59.77	2	1692.7267	1692.7267	K	L	185	198
PSM	YKDDDDDQLFYTR	412	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11630	60.783	2	1692.7267	1692.7267	K	L	185	198
PSM	YSPSQNSPIHHIPSR	413	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8144	43.037	2	1878.7815	1878.7815	R	R	282	297
PSM	APEPHVEEDDDDELDSK	414	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=7827	41.45075833333333	2	1939.796737	1938.796675	K	L	5	22
PSM	QASTDAGTAGALTPQHVR	415	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=9851	51.669918333333335	2	1842.8206	1842.8256	R	A	107	125
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	416	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=5603	30.244421666666668	3	3026.354389	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	417	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=5482	29.64065833333333	3	3007.3257	3007.3290	K	S	145	174
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	418	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13071	68.3151	3	2971.4174	2971.4211	K	H	206	232
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	419	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=4517	24.902035	3	2541.174447	2540.190812	R	E	7	32
PSM	QRSPSPAPAPAPAAAAGPPTR	420	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=7727	40.94688	2	2029.9707	2029.9730	R	K	496	517
PSM	ASKPLPPAPAPDEYLVSPITGEK	421	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:21	ms_run[1]:scan=16564	88.05995333333333	3	2457.224686	2456.224009	K	I	397	420
PSM	QHEAPSNRPLNELLTPQGPSPR	422	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=15647	82.62580666666666	3	2500.1856	2500.1855	R	T	167	189
PSM	REPGYTPPGAGNQNPPGMYPVTGPK	423	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=11086	57.92574333333334	3	2679.203448	2677.199603	K	K	328	353
PSM	ELEKSEKEEDEDDDR	424	sp|Q8IX12|CCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=1194	8.386531666666666	2	1944.730142	1944.747356	K	K	681	696
PSM	LAIQEIMSLTSPSAPPTSR	425	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=11920	62.24015333333333	2	2238.967381	2237.944570	R	T	936	955
PSM	RNSVERPAEPVAGAATPSLVEQQK	426	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=11513	60.19836333333333	3	2614.275230	2613.291195	R	M	1454	1478
PSM	AAPEASSPPASPLQHLLPGK	427	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=17698	95.111	2	2047.014	2047.0140	K	A	673	693
PSM	ADRDESSPYAAMLAAQDVAQR	428	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:35	ms_run[2]:scan=12100	63.218	3	2280.0441	2280.0441	K	C	64	85
PSM	AEGLEEADTGASGCHSHPEEQPTSISPSR	429	sp|Q9BV36-3|MELPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4,26-UNIMOD:21	ms_run[2]:scan=8415	44.405	3	3115.2826	3115.2826	K	H	201	230
PSM	ALASEKSPTADAKPAPK	430	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=2891	16.833	3	1760.871	1760.8710	K	R	266	283
PSM	ALSQDDQDDIHLK	431	sp|O14827|RGRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7748	41.056	2	1496.7107	1496.7107	R	L	970	983
PSM	APEPHVEEDDDDELDSK	432	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7433	39.44	3	1938.7967	1938.7967	K	L	5	22
PSM	AQGEPVAGHESPKIPYEK	433	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=8407	44.36	2	2015.9354	2015.9354	R	Q	522	540
PSM	ASAVTAMGQLSSQGLHAPTSPEHAEAR	434	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	19-UNIMOD:21	ms_run[2]:scan=14633	76.892	3	2783.2698	2783.2698	R	Q	563	590
PSM	AVSPPHLDGPPSPR	435	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10339	54.147	2	1505.7028	1505.7028	K	S	516	530
PSM	DADDAVYELDGK	436	sp|Q13243-2|SRSF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9950	52.177	2	1309.5674	1309.5674	R	E	49	61
PSM	DKVVEDDEDDFPTTR	437	sp|Q9Y5P4-2|CERT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9005	47.454	2	1779.7799	1779.7799	R	S	197	212
PSM	DPDAQPGGELMLGGTDSK	438	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:35	ms_run[2]:scan=10447	54.658	3	1802.7993	1802.7993	R	Y	236	254
PSM	EDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIK	439	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=15466	81.544	3	3597.7062	3597.7062	K	G	607	642
PSM	EFLEDYDDDRDDPK	440	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10825	56.597	2	1770.7221	1770.7221	K	Y	498	512
PSM	ELAQIAGRPTEDEDEK	441	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6940	37.032	2	1799.8537	1799.8537	K	E	113	129
PSM	FADQHVPGSPFSVK	442	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=13086	68.393	2	1594.7181	1594.7181	K	V	2112	2126
PSM	FGGEHVPNSPFQVTALAGDQPSVQPPLR	443	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=19502	107.09	3	3024.4495	3024.4495	R	S	1718	1746
PSM	FSVIRPQTPPPQTPSSCLTPVSPGTSDGR	444	sp|Q8IY92-2|SLX4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15299	80.588	3	3145.4904	3145.4904	K	R	996	1025
PSM	GNIQLSYSDGDDCGHGK	445	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:4	ms_run[2]:scan=7510	39.834	2	1821.7588	1821.7588	K	K	560	577
PSM	GPGQGSGHLAIGSAATLGSGGMAR	446	sp|Q15027|ACAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=10775	56.359	3	2204.9998	2204.9998	R	G	374	398
PSM	IEDVGSDEEDDSGKDKK	447	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=1863	11.587	2	1944.7837	1944.7837	K	K	250	267
PSM	IPMTPTSSFVSPPPPTASPHSNR	448	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12756	66.633	3	2500.1458	2500.1458	K	T	373	396
PSM	IPMTPTSSFVSPPPPTASPHSNR	449	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=13200	69.016	3	2500.1458	2500.1458	K	T	373	396
PSM	KEESEESDDDMGFGLFD	450	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=18408	99.648	2	2044.7133	2044.7133	K	-	99	116
PSM	KEETVEDEIDVR	451	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9565	50.231	2	1460.6995	1460.6995	K	N	651	663
PSM	KEVEGDDVPESIMLEMK	452	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=11442	59.807	2	1979.9068	1979.9068	R	A	577	594
PSM	KGAGDGSDEEVDGK	453	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=972	7.3892	2	1442.5562	1442.5562	R	A	1937	1951
PSM	KGAGDGSDEEVDGKADGAEAK	454	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=1338	9.0457	3	2084.8536	2084.8536	R	P	1937	1958
PSM	KMEDSVGCLETAEEVK	455	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=9724	51.027	2	1839.823	1839.8230	K	R	1372	1388
PSM	KPNIFYSGPASPAR	456	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=10730	56.143	2	1583.7497	1583.7497	R	P	317	331
PSM	KPSVGVPPPASPSYPR	457	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=9276	48.747	3	1714.8444	1714.8444	R	A	980	996
PSM	KSSLGNDETDKEK	458	sp|O75128-5|COBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=892	7.0614	2	1529.661	1529.6610	R	K	233	246
PSM	KTDTVVESSVSGDHSGTLR	459	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=7355	39.056	3	2053.9317	2053.9317	R	R	33	52
PSM	KVEEEQEADEEDVSEEEAESK	460	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=6565	35.057	3	2516.9803	2516.9803	K	E	234	255
PSM	KVELSESEEDKGGK	461	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=2616	15.393	2	1613.7186	1613.7186	R	M	457	471
PSM	LASQGDSISSQLGPIHPPPR	462	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=14211	74.578	3	2136.0365	2136.0365	K	T	123	143
PSM	LLDPEDISVDHPDEK	463	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13220	69.118	2	1720.8156	1720.8156	K	S	250	265
PSM	LLKPGEEPSEYTDEEDTK	464	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=9081	47.818	2	2158.9195	2158.9195	R	D	200	218
PSM	LNHVAAGLVSPSLK	465	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=12297	64.299	2	1484.7752	1484.7752	K	S	198	212
PSM	MNDFHISDDEEKNPSK	466	sp|Q49MG5-2|MAP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=7686	40.732	2	2000.7823	2000.7823	K	L	73	89
PSM	NDIHLDADDPNSADK	467	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6226	33.295	2	1638.7122	1638.7122	K	H	686	701
PSM	NHLSPQQGGATPQVPSPCCR	468	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=8597	45.267	3	2269.9722	2269.9722	K	F	166	186
PSM	NKTEDLEATSEHFK	469	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=8502	44.812	2	1727.7404	1727.7404	R	T	46	60
PSM	PARPPSPTEQEGAVPR	470	sp|Q8N8E2-2|ZN513_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=6533	34.891	3	1767.8305	1767.8305	R	R	186	202
PSM	PAVEASTGGEATQETGKEEAGKEEPPPLTPPAR	471	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	29-UNIMOD:21	ms_run[2]:scan=10193	53.426	3	3410.5879	3410.5879	R	C	103	136
PSM	PLSPKPSSPGSVLAR	472	sp|Q15583-4|TGIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10037	52.614	3	1571.8073	1571.8073	R	P	135	150
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	473	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=4995	27.233	3	3024.3561	3024.3561	K	S	73	102
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	474	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:21	ms_run[2]:scan=5246	28.483	3	3024.3561	3024.3561	K	S	73	102
PSM	QRSPSPAPAPAPAAAAGPPTR	475	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=6107	32.714	3	2047	2047.0000	R	K	496	517
PSM	RGNLNLSPTSPETMAGPVPTSPVR	476	sp|Q7Z7G8-3|VP13B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12859	67.199	3	2573.2309	2573.2309	K	S	1243	1267
PSM	RPAAAAAAGSASPR	477	sp|Q96S55-2|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=1348	9.0854	2	1332.63	1332.6300	K	S	142	156
PSM	RPASPSSPEHLPATPAESPAQR	478	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8641	45.44	3	2442.073	2442.0730	K	F	231	253
PSM	RPLPVESPDTQR	479	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=6000	32.184	2	1473.6977	1473.6977	K	K	244	256
PSM	RPLPVESPDTQR	480	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=6203	33.192	2	1473.6977	1473.6977	K	K	244	256
PSM	RVSEVEEEKEPVPQPLPSDDTR	481	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=9630	50.556	3	2615.2116	2615.2116	R	V	446	468
PSM	RYWEEETVPTTAGASPGPPR	482	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:21	ms_run[2]:scan=12530	65.473	3	2280.0212	2280.0212	R	N	27	47
PSM	SDDSKSSSPELVTHLK	483	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=8268	43.663	2	1808.8193	1808.8193	K	W	44	60
PSM	SDDSKSSSPELVTHLK	484	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=8300	43.835	3	1808.8193	1808.8193	K	W	44	60
PSM	SDDSKSSSPELVTHLK	485	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=8508	44.847	3	1808.8193	1808.8193	K	W	44	60
PSM	SDGSLEDGDDVHR	486	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3131	17.993	2	1400.5804	1400.5804	R	A	361	374
PSM	SEDGYHSDGDYGEHDYR	487	sp|P52756-4|RBM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=5329	28.879	2	2080.7072	2080.7072	R	H	72	89
PSM	SLDGAEFSRPASVSENHDAGPDGDK	488	sp|Q9H4G0-4|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=10373	54.313	3	2637.098	2637.0980	R	R	399	424
PSM	SPEKIEEVLSPEGSPSKSPSK	489	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	20-UNIMOD:21	ms_run[2]:scan=11198	58.495	3	2291.0934	2291.0934	K	K	632	653
PSM	SPLLAGGSPPQPVVPAHK	490	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=11874	61.998	2	1830.9393	1830.9393	R	D	49	67
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	491	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=9436	49.584	3	2686.2501	2686.2501	R	R	207	233
PSM	STTPPPAEPVSLPQEPPKPR	492	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=11925	62.271	2	2204.0878	2204.0878	K	V	225	245
PSM	TADGRVSPAGGTLDDKPK	493	sp|Q8WY36-2|BBX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=3859	21.517	3	1863.8728	1863.8728	R	E	808	826
PSM	TDKVDFDSAEDTR	494	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6641	35.451	2	1497.6583	1497.6583	K	L	661	674
PSM	THTTALAGRSPSPASGR	495	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2928	17.002	2	1825.7873	1825.7873	K	R	286	303
PSM	TQATGLTKPTLPPSPLMAAR	496	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13435	70.321	2	2146.0857	2146.0857	R	R	411	431
PSM	TQATGLTKPTLPPSPLMAAR	497	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13444	70.371	3	2146.0857	2146.0857	R	R	411	431
PSM	TTTPPPSQIPDPPFSSPITPHR	498	sp|Q6ZS30-1|NBEL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=16863	89.855	3	2449.1679	2449.1679	R	T	719	741
PSM	VAELSSDDFHLDR	499	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13270	69.408	2	1502.7001	1502.7001	R	H	298	311
PSM	VHSPSGAVEECHVSELEPDK	500	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9850	51.666	2	2284.9671	2284.9671	K	Y	2143	2163
PSM	VIEHIMEDLDTNADK	501	sp|P06702|S10A9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=8834	46.572	2	1757.8142	1757.8142	K	Q	58	73
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	502	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35,11-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=17917	96.501	3	2929.3908	2929.3908	R	A	635	662
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	503	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	25-UNIMOD:21	ms_run[2]:scan=11305	59.064	3	3272.5351	3272.5351	R	G	153	185
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	504	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	25-UNIMOD:21	ms_run[2]:scan=11494	60.091	3	3272.5351	3272.5351	R	G	153	185
PSM	YHGHSMSDPGVSYR	505	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4252	23.587	2	1767.6114	1767.6114	R	T	258	272
PSM	VFDEFKPLVEEPQNLIK	506	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=20510	114.09211	2	2045.086461	2044.088094	K	Q	397	414
PSM	TAKPFPGSVNQPATPFSPTR	507	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	17-UNIMOD:21	ms_run[1]:scan=13906	72.88414333333334	3	2180.047360	2179.046320	R	N	588	608
PSM	ENQEPLRSPEVGDEEALRPLTK	508	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:27,8-UNIMOD:21	ms_run[1]:scan=15336	80.80887833333334	3	2568.2190	2568.2216	K	E	673	695
PSM	QDGSQEAPEAPLSSELEPFHPKPK	509	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=17433	93.41350833333334	3	2680.2021	2680.2053	R	I	1083	1107
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	510	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=4402	24.36925666666667	3	2541.174122	2540.190812	R	E	7	32
PSM	FVNDYDKDNDGR	511	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=3687	20.670933333333334	2	1456.625516	1456.621886	R	L	235	247
PSM	CHDGPQHCSSPSVTPPFGSLR	512	sp|Q8IZW8|TENS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=14622	76.84330166666668	3	2384.9637	2384.9662	R	S	160	181
PSM	KPSPEPEGEVGPPK	513	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=5177	28.152171666666668	2	1526.706133	1526.701790	R	I	358	372
PSM	SSSISEEKGDSDDEKPR	514	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1662	10.584841666666668	2	1944.788926	1944.794975	K	K	206	223
PSM	QPVFTVSKDSVLAGTNK	515	sp|Q6W2J9|BCOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=6709	35.80278166666667	2	2030.874531	2029.856407	K	E	873	890
PSM	SRSTTELDDYSTNKNGNNK	516	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=4708	25.812601666666666	3	2223.929139	2222.944099	K	Y	1421	1440
PSM	FASDDEHDEHDENGATGPVK	517	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=5564	30.059390000000004	3	2249.840269	2248.854615	K	R	364	384
PSM	VNSNGKESPGSSEFFQEAVSHGK	518	sp|Q8N108|MIER1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=14251	74.80216999999999	3	2502.066699	2501.086012	R	F	481	504
PSM	ALASEKSPTADAKPAPK	519	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=2714	15.905	2	1760.871	1760.8710	K	R	266	283
PSM	ALDSEVDPDPEGDLGMPAQPHSPTGEAQHR	520	sp|Q6IA17-2|SIGIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=12286	64.247	3	3248.3718	3248.3718	R	A	343	373
PSM	APEPHVEEDDDDELDSK	521	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6631	35.396	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	522	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6822	36.407	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	523	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7015	37.423	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	524	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7227	38.433	3	1938.7967	1938.7967	K	L	5	22
PSM	AQASGSAHSTPNLGHPEDSGVSAPAPGK	525	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=7949	42.039	3	2706.2035	2706.2035	R	E	520	548
PSM	AQGEPVAGHESPKIPYEK	526	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=9457	49.689	3	2015.9354	2015.9354	R	Q	522	540
PSM	ATAGDTHLGGEDFDNR	527	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7125	37.914	2	1674.7234	1674.7234	K	L	223	239
PSM	ATPTKAPAPVVLGSPVVLGPPVGQAR	528	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=18692	101.54	3	2558.3986	2558.3986	R	V	151	177
PSM	DFTVSALHGDMDQK	529	sp|Q14240|IF4A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35	ms_run[2]:scan=10211	53.508	2	1578.6984	1578.6984	R	E	297	311
PSM	DKNTPSPFIETFTEDDEASR	530	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17130	91.503	3	2298.0288	2298.0288	K	A	210	230
PSM	DKSPVREPIDNLTPEER	531	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=11974	62.544	3	2073.9732	2073.9732	K	D	134	151
PSM	DKYEPAAVSEQGDKK	532	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=3631	20.399	2	1743.7717	1743.7717	R	G	8	23
PSM	DNSPPPAFKPEPPK	533	sp|Q9UDY2-3|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=8922	47.034	2	1599.7334	1599.7334	R	A	961	975
PSM	EETNGPSNQKPVKSPDNSIK	534	sp|Q9UKL0|RCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=3229	18.447	3	2248.0373	2248.0373	K	M	447	467
PSM	EGPGEEHFEDMASDEDMKPK	535	sp|Q99856|ARI3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=5954	31.922	2	2388.8763	2388.8763	R	W	107	127
PSM	ERPDLEAPAPGSPFR	536	sp|Q9NQT8-2|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=12729	66.476	2	1717.7825	1717.7825	R	V	152	167
PSM	ESDKEDGRESPSYDTPSQR	537	sp|Q9Y6M7-11|S4A7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=2892	16.837	2	2261.9074	2261.9074	K	V	80	99
PSM	ESEDKPEIEDVGSDEEEEK	538	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=8488	44.748	2	2271.8792	2271.8792	K	K	251	270
PSM	GAAEEAELEDSDDEEKPVKQDDFPK	539	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=10997	57.459	3	2870.2019	2870.2019	K	D	88	113
PSM	GGSLDPSHSSGRGSAEAAEDDEIR	540	sp|Q96JQ0|PCD16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=7121	37.894	3	2479.0249	2479.0249	R	M	3022	3046
PSM	GKLEAIITPPPAK	541	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=10986	57.404	2	1413.7633	1413.7633	K	K	122	135
PSM	GKLEAIITPPPAK	542	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=11202	58.515	2	1413.7633	1413.7633	K	K	122	135
PSM	HCGLSLSSTPPGK	543	sp|Q71F23-3|CENPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=8200	43.317	2	1419.6218	1419.6218	K	E	90	103
PSM	HGSGPNIILTGDSSPGFSK	544	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=14164	74.339	2	1949.8884	1949.8884	R	E	611	630
PSM	HIKEEPLSEEEPCTSTAIASPEK	545	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11069	57.823	3	2741.1544	2741.1544	K	K	495	518
PSM	HLFSSTENLAAGSWK	546	sp|Q6WKZ4-2|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=16603	88.291	2	1726.7716	1726.7716	K	E	205	220
PSM	IEDVGSDEEDDSGK	547	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=4053	22.534	2	1573.5669	1573.5669	K	D	250	264
PSM	IEDVGSDEEDDSGKDKK	548	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=2060	12.6	2	1944.7837	1944.7837	K	K	250	267
PSM	IPDPEAVKPDDWDEDAPAK	549	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13982	73.342	2	2106.9746	2106.9746	K	I	328	347
PSM	IPMTPTSSFVSPPPPTASPHSNR	550	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12945	67.648	3	2500.1458	2500.1458	K	T	373	396
PSM	IRPLEVPTTAGPASASTPTDGAK	551	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=12353	64.59	3	2316.1363	2316.1363	R	K	1176	1199
PSM	KADSEEERDDVSTLGSMLPAK	552	sp|P78364|PHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=11989	62.623	3	2373.0407	2373.0407	R	A	642	663
PSM	KAEEELGELEAK	553	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8105	42.861	2	1344.6773	1344.6773	R	L	684	696
PSM	KDASDDLDDLNFFNQK	554	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18796	102.25	3	1883.8537	1883.8537	K	K	64	80
PSM	KDVIELTDDSFDK	555	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13832	72.482	2	1523.7355	1523.7355	K	N	157	170
PSM	KEEEEEEEEYDEGSNLK	556	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6693	35.728	3	2084.8546	2084.8546	K	K	230	247
PSM	KGAASPVLQEDHCDSLPSVLQVEEK	557	sp|Q8N9B5-2|JMY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=16578	88.131	3	2815.3099	2815.3099	R	T	709	734
PSM	KGDEVDGVDEVAK	558	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5210	28.326	2	1359.6518	1359.6518	R	K	209	222
PSM	KLLLGSPSSLSPFSK	559	sp|Q9H165-2|BC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=17562	94.249	2	1639.8586	1639.8586	K	R	620	635
PSM	KPAPLPSPGLNSAAK	560	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=9400	49.38	2	1526.7858	1526.7858	R	R	601	616
PSM	KQQMAEEMVEAAGEDER	561	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5178	28.156	3	1981.8357	1981.8357	R	E	816	833
PSM	KTDTVVESSVSGDHSGTLR	562	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=6832	36.459	3	2053.9317	2053.9317	R	R	33	52
PSM	KTSDANETEDHLESLICK	563	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11805	61.669	3	2168.9297	2168.9297	R	V	20	38
PSM	KVEEEEDESALK	564	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3507	19.768	2	1404.662	1404.6620	R	R	733	745
PSM	KVIEEQLEPAVEK	565	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8931	47.075	2	1510.8243	1510.8243	R	I	1224	1237
PSM	LDETDDPDDYGDR	566	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6357	34.002	2	1524.5852	1524.5852	R	E	401	414
PSM	LEGPVSPDVEPGKEETEESKK	567	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=8474	44.692	3	2363.0781	2363.0781	K	R	1666	1687
PSM	LGGLRPESPESLTSVSR	568	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=13660	71.552	2	1863.9092	1863.9092	R	T	11	28
PSM	LIQSHPESAEDLQEK	569	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6343	33.921	2	1722.8424	1722.8424	R	C	1279	1294
PSM	LPTTDGAHPQPISPIPGGVSSSGLSR	570	sp|Q96AP7|ESAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	20-UNIMOD:21	ms_run[2]:scan=15149	79.777	3	2607.2694	2607.2694	R	M	347	373
PSM	LRSPPEALVQGR	571	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=8815	46.476	2	1401.713	1401.7130	R	Y	130	142
PSM	LTASEQAHPQEPAESAHEPR	572	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:21	ms_run[2]:scan=4848	26.521	3	2263.9859	2263.9859	K	L	245	265
PSM	MTTDVSHKASPEDGQEGLPQPK	573	sp|Q9Y6J0-2|CABIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=6394	34.19	3	2447.0676	2447.0676	R	K	1607	1629
PSM	NDMAVPTPPPPPVPPTK	574	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=11727	61.263	2	1849.8685	1849.8685	K	Q	486	503
PSM	NKSTSSAMSGSHQDLSVIQPIVK	575	sp|Q96QF0-8|RAB3I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=12644	66.05	3	2509.1884	2509.1884	R	D	64	87
PSM	PIPNQPPTAAHTANFLLNASGSTSTPAPSR	576	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	25-UNIMOD:21	ms_run[2]:scan=16903	90.087	3	3094.4873	3094.4873	R	T	162	192
PSM	RAAEDDEDDDVDTK	577	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1685	10.696	2	1592.6438	1592.6438	K	K	89	103
PSM	RAEDGSVIDYELIDQDAR	578	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15384	81.09	3	2063.976	2063.9760	R	D	197	215
PSM	RASEEEENKASEEYIQR	579	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=6241	33.366	3	2146.9168	2146.9168	R	L	132	149
PSM	RASPGLSMPSSSPPIKK	580	sp|P57682|KLF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,7-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=6618	35.329	2	1914.8676	1914.8676	R	Y	90	107
PSM	REEEEEEEASEK	581	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=883	7.0219	2	1492.6165	1492.6165	K	G	132	144
PSM	RGSGPEIFTFDPLPEPAAAPAGR	582	sp|P46695|IEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=21215	119.3	3	2432.1526	2432.1526	R	P	29	52
PSM	RSSPPPPPSGSSSR	583	sp|Q5VUA4|ZN318_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=1090	7.9176	2	1474.6566	1474.6566	R	T	38	52
PSM	RSSSPAELDLKDDLQQTQGK	584	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=13005	67.964	3	2295.0744	2295.0744	R	C	818	838
PSM	RVIENADGSEEETDTR	585	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=3623	20.359	2	1899.7847	1899.7847	R	D	1946	1962
PSM	SAKSEESLTSLHAVDGDSK	586	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=9425	49.525	2	2039.9049	2039.9049	R	L	354	373
PSM	SDDSKSSSPELVTHLK	587	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=8477	44.703	2	1808.8193	1808.8193	K	W	44	60
PSM	SDGSLEDGDDVHR	588	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3357	19.017	2	1400.5804	1400.5804	R	A	361	374
PSM	SEHTAPPPEEPTDKSPEAEDPLGVER	589	sp|Q96KM6|Z512B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:21	ms_run[2]:scan=10862	56.799	3	2893.2655	2893.2655	R	T	651	677
PSM	SEQTSSTHIESILSEHEESPK	590	sp|Q96RV3-2|PCX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:21	ms_run[2]:scan=12642	66.039	3	2434.0537	2434.0537	K	A	402	423
PSM	SHSQASLAGPGPVDPSNR	591	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7455	39.54	2	1855.8214	1855.8214	R	S	129	147
PSM	SKDHFGLEGDEESTMLEDSVSPK	592	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=14699	77.269	3	2632.0888	2632.0888	K	K	405	428
PSM	SNEEGSEEKGPEVR	593	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1770	11.137	2	1545.6907	1545.6907	K	E	69	83
PSM	SPEGPREEEAAGGEEESPDSSPHGEASR	594	sp|Q96NY7-2|CLIC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=4852	26.541	3	2959.1741	2959.1741	R	G	377	405
PSM	SPSAEFSPAAPPGISSIHSPSLR	595	sp|Q68DK2-5|ZFY26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=17058	91.047	3	2371.1209	2371.1209	R	E	1762	1785
PSM	STAQQELDGKPASPTPVIVASHTANK	596	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=9636	50.588	3	2726.3276	2726.3276	R	E	818	844
PSM	TIINADKDGDGR	597	sp|P63098|CANB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2645	15.541	2	1273.6262	1273.6262	K	I	136	148
PSM	TPHVQAVQGPLGSPPK	598	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=10385	54.367	2	1691.8396	1691.8396	R	R	113	129
PSM	TQATGLTKPTLPPSPLMAAR	599	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13172	68.846	2	2146.0857	2146.0857	R	R	411	431
PSM	VAHEPVAPPEDKESESEAK	600	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=4447	24.575	3	2127.9362	2127.9362	R	V	8	27
PSM	VDNDENEHQLSLR	601	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6248	33.407	2	1567.7227	1567.7227	K	T	33	46
PSM	VDTKPLEESSTLDPHTK	602	sp|Q14112-2|NID2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=7926	41.923	3	1975.914	1975.9140	K	E	297	314
PSM	VSISEGDDKIEYR	603	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9558	50.203	2	1509.7311	1509.7311	R	A	123	136
PSM	WDKDDFESEEEDVK	604	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11655	60.901	2	1769.7268	1769.7268	K	S	1321	1335
PSM	YKLDEDEDEDDADLSK	605	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8753	46.177	3	1898.7905	1898.7905	K	Y	167	183
PSM	YSPSQNSPIHHIPSR	606	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8341	44.045	2	1878.7815	1878.7815	R	R	282	297
PSM	YVLEDGPEEDRK	607	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6629	35.384	2	1448.6783	1448.6783	R	E	89	101
PSM	QRDEDDEAYGKPVK	608	sp|Q53GD3|CTL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=3691	20.694205	2	1631.7403	1631.7422	K	Y	5	19
PSM	ASAVTAMGQLSSQGLHAPTSPEHAEAR	609	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=10591	55.430685	3	2800.261220	2799.264722	R	Q	563	590
PSM	AQGEPVAGHESPKIPYEK	610	sp|O94979|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=8806	46.430545	2	2016.929622	2015.935372	R	Q	789	807
PSM	KTSDANETEDHLESLICK	611	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=15649	82.63724666666667	3	2169.914454	2168.929695	R	V	20	38
PSM	RDSSESQLASTESDKPTTGR	612	sp|Q96B23|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=5518	29.81944166666667	3	2231.954035	2230.970314	R	V	64	84
PSM	FASDDEHDEHDENGATGPVK	613	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=5712	30.761654999999998	3	2249.840269	2248.854615	K	R	364	384
PSM	NDVVEALTGSAASRLRGGTSSR	614	sp|O75665|OFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,20-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=9407	49.41961833333333	3	2445.041793	2443.029514	R	R	711	733
PSM	SASTESGFHNHTDTAEGDVIAAAR	615	sp|Q02410|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=12085	63.143105000000006	3	2524.046935	2523.066340	R	D	78	102
PSM	RVSEVEEEKEPVPQPLPSDDTR	616	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=11399	59.575381666666665	3	2616.192862	2615.211607	R	V	446	468
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	617	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=15921	84.24368666666668	3	2776.220519	2775.240222	R	D	662	687
PSM	SEVSSSIHPRPETSAPGAETTLTSTPGNR	618	sp|Q8WXI7|MUC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=18697	101.57418166666666	3	3126.394833	3125.370383	K	A	1902	1931
TGSAASRLRGGTSSR	614	sp|O75665|OFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,20-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=9407	49.41961833333333	3	2445.041793	2443.029514	R	R	711	733
PSM	SASTESGFHNHTDTAEGDVIAAAR	615	sp|Q02410|APBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=12085	63.143105000000006	3	2524.046935	2523.066340	R	D	78	102
PSM	RVSEVEEEKEPVPQPLPSDDTR	616	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=11399	59.575381666666665	3	2616.192862	2615.211607	R	V	446	468
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	617	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=15921	84.24368666666668	3	2776.220519	2775.240222	R	D	662	687
PSM	SEVSSSIHPRPETSAPGAETTLTSTPGNR	618	sp|Q8WXI7|MUC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=18697	101.57418166666666	3	3126.394833	3125.370383	K	A	1902	1931