MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr16.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	332-UNIMOD:21,328-UNIMOD:21	0.05	48.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	48.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	48.0	19	1	0
PRT	sp|Q86UX7-2|URP2_HUMAN	Isoform 2 of Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	478-UNIMOD:21	0.05	46.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	719-UNIMOD:21	0.02	45.0	3	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	109-UNIMOD:21,108-UNIMOD:21	0.02	45.0	3	1	0
PRT	sp|Q96NW4|ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1023-UNIMOD:21	0.03	44.0	2	1	0
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	224-UNIMOD:21,222-UNIMOD:21	0.06	44.0	2	1	0
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	604-UNIMOD:21	0.04	43.0	2	1	0
PRT	sp|Q9Y6C2|EMIL1_HUMAN	EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|P16157-10|ANK1_HUMAN	Isoform Er9 of Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1666-UNIMOD:21	0.01	43.0	1	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	832-UNIMOD:21,830-UNIMOD:21	0.03	43.0	4	2	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	417-UNIMOD:21	0.06	42.0	2	1	0
PRT	sp|Q6PJ61|FBX46_HUMAN	F-box only protein 46 OS=Homo sapiens OX=9606 GN=FBXO46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	338-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	23-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	695-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	2	1	0
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	485-UNIMOD:35,501-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	155-UNIMOD:21,165-UNIMOD:21	0.07	42.0	3	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	2718-UNIMOD:21,2716-UNIMOD:28	0.02	42.0	3	2	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2048-UNIMOD:21	0.01	42.0	4	1	0
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	184-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	1405-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	41.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	41.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	805-UNIMOD:21	0.01	41.0	2	1	0
PRT	sp|Q00013|EM55_HUMAN	55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	47-UNIMOD:35,57-UNIMOD:21	0.07	41.0	2	1	0
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	373-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q5TAQ9-2|DCAF8_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 8 OS=Homo sapiens OX=9606 GN=DCAF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	99-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q0ZGT2|NEXN_HUMAN	Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	564-UNIMOD:21,566-UNIMOD:35	0.04	40.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	246-UNIMOD:35	0.05	39.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	382-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q86V15-2|CASZ1_HUMAN	Isoform 2 of Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	57-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	317-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1122-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q92766-5|RREB1_HUMAN	Isoform 5 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1415-UNIMOD:21,1420-UNIMOD:35	0.01	39.0	1	1	1
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1244-UNIMOD:21,1247-UNIMOD:35,1255-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|P16157|ANK1_HUMAN	Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1666-UNIMOD:21	0.01	39.0	1	1	0
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	462-UNIMOD:21	0.05	39.0	1	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	127-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	237-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	951-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q6N043-3|Z280D_HUMAN	Isoform 3 of Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	104-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	296-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	10-UNIMOD:21,11-UNIMOD:4,17-UNIMOD:35	0.07	38.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.15	37.0	3	3	3
PRT	sp|Q5HYK7|SH319_HUMAN	SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	268-UNIMOD:4,275-UNIMOD:21,148-UNIMOD:21	0.07	37.0	2	2	2
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	930-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	8-UNIMOD:21,26-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|Q9Y2J4-3|AMOL2_HUMAN	Isoform 3 of Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	600-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	255-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1505-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	58-UNIMOD:21	0.10	37.0	2	2	2
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	458-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P53814-2|SMTN_HUMAN	Isoform A of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	67-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9H832-2|UBE2Z_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	227-UNIMOD:35,229-UNIMOD:21	0.11	37.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	436-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q07617|SPAG1_HUMAN	Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	423-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	677-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21	0.07	37.0	2	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	266-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q16825|PTN21_HUMAN	Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	637-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q6PI98|IN80C_HUMAN	INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	26-UNIMOD:21	0.10	37.0	1	1	1
PRT	sp|Q9NWK9-2|BCD1_HUMAN	Isoform 2 of Box C/D snoRNA protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	25-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1033-UNIMOD:21,1038-UNIMOD:35	0.01	37.0	1	1	1
PRT	sp|Q7LFL8|CXXC5_HUMAN	CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	83-UNIMOD:21,96-UNIMOD:35,97-UNIMOD:35	0.09	37.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	928-UNIMOD:21	0.03	37.0	2	1	0
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	199-UNIMOD:4,217-UNIMOD:21,215-UNIMOD:21,216-UNIMOD:21,214-UNIMOD:21	0.05	37.0	5	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	877-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase 2B1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	332-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	363-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q5T1V6-2|DDX59_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	60-UNIMOD:4,76-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	337-UNIMOD:21,347-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	112-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	2	1	0
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	2	1	0
PRT	sp|Q6ZU35|CRACD_HUMAN	Capping protein inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1042-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	66-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	211-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	214-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	893-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	43-UNIMOD:21	0.05	36.0	3	1	0
PRT	sp|Q06787-2|FMR1_HUMAN	Isoform 1 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	479-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q9Y5P4-2|CERT_HUMAN	Isoform 2 of Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	132-UNIMOD:21,133-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|Q8TF61|FBX41_HUMAN	F-box only protein 41 OS=Homo sapiens OX=9606 GN=FBXO41 PE=2 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	478-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P55201-4|BRPF1_HUMAN	Isoform 4 of Peregrin OS=Homo sapiens OX=9606 GN=BRPF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	462-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q6PIF6-2|MYO7B_HUMAN	Isoform 2 of Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	904-UNIMOD:21,914-UNIMOD:35	0.01	36.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	362-UNIMOD:21,604-UNIMOD:21	0.05	36.0	3	2	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	11-UNIMOD:21,26-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1222-UNIMOD:21	0.01	36.0	4	1	0
PRT	sp|Q5VWN6-2|TASO2_HUMAN	Isoform 2 of Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1232-UNIMOD:21,1230-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	218-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	1852-UNIMOD:21,1848-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	299-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9Y217|MTMR6_HUMAN	Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	561-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q9NV58-2|RN19A_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens OX=9606 GN=RNF19A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	518-UNIMOD:21,522-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1308-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|P40692-2|MLH1_HUMAN	Isoform 2 of DNA mismatch repair protein Mlh1 OS=Homo sapiens OX=9606 GN=MLH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	236-UNIMOD:21,240-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1861-UNIMOD:4,1863-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	85-UNIMOD:21	0.17	35.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	83-UNIMOD:35	0.20	35.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	290-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q7KZ85-3|SPT6H_HUMAN	Isoform 3 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	124-UNIMOD:35,125-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	769-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	247-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q9NTI5-5|PDS5B_HUMAN	Isoform 5 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	53-UNIMOD:21	0.15	35.0	1	1	1
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	265-UNIMOD:35,267-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	596-UNIMOD:21,599-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	322-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	456-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	344-UNIMOD:21,240-UNIMOD:21	0.06	35.0	2	2	2
PRT	sp|Q9HC62|SENP2_HUMAN	Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	32-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	50-UNIMOD:21	0.23	35.0	2	2	2
PRT	sp|Q8IXQ4|GPAM1_HUMAN	GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	102-UNIMOD:28,105-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	34.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	597-UNIMOD:35,608-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q8TCZ2-6|C99L2_HUMAN	Isoform 6 of CD99 antigen-like protein 2 OS=Homo sapiens OX=9606 GN=CD99L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	626-UNIMOD:21	0.03	34.0	4	1	0
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	286-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1384-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	294-UNIMOD:21	0.03	34.0	1	1	0
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	139-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P49023-4|PAXI_HUMAN	Isoform 4 of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	366-UNIMOD:21,368-UNIMOD:4,371-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	37-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|Q7Z5Q1-7|CPEB2_HUMAN	Isoform 6 of Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	67-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	613-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	232-UNIMOD:21	0.10	34.0	1	1	1
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	197-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	385-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	205-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	331-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	785-UNIMOD:21,780-UNIMOD:21,778-UNIMOD:21	0.04	34.0	3	1	0
PRT	sp|Q7Z5P9|MUC19_HUMAN	Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	5836-UNIMOD:21,5852-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	33.0	2	1	0
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	77-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	163-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q5H9R7-6|PP6R3_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	404-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1511-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	445-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	261-UNIMOD:21,264-UNIMOD:35	0.07	33.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	987-UNIMOD:21,992-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q8IXQ4-4|GPAM1_HUMAN	Isoform 4 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.14	33.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	527-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	266-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	313-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	510-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	522-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|A6NDB9|PALM3_HUMAN	Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	124-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q7LDG7|GRP2_HUMAN	RAS guanyl-releasing protein 2 OS=Homo sapiens OX=9606 GN=RASGRP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	116-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	702-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|O15541|R113A_HUMAN	E3 ubiquitin-protein ligase RNF113A OS=Homo sapiens OX=9606 GN=RNF113A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	36-UNIMOD:4,47-UNIMOD:21,51-UNIMOD:4	0.08	33.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1097-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1422-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	89-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	448-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q8N4C8-5|MINK1_HUMAN	Isoform 5 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	706-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q14802|FXYD3_HUMAN	FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	81-UNIMOD:21	0.23	33.0	1	1	1
PRT	sp|O75581|LRP6_HUMAN	Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1500-UNIMOD:35,1508-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	419-UNIMOD:35,425-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	587-UNIMOD:21,596-UNIMOD:35	0.02	33.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	641-UNIMOD:35,645-UNIMOD:4,647-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1267-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P32241|VIPR1_HUMAN	Vasoactive intestinal polypeptide receptor 1 OS=Homo sapiens OX=9606 GN=VIPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	425-UNIMOD:21,430-UNIMOD:4,436-UNIMOD:35	0.05	33.0	1	1	1
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	118-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	263-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	970-UNIMOD:4,971-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	459-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	97-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9NZC9|SMAL1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	104-UNIMOD:35,108-UNIMOD:4,112-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q5M775-4|CYTSB_HUMAN	Isoform 4 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	831-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|Q9C0G0-3|ZN407_HUMAN	Isoform 3 of Zinc finger protein 407 OS=Homo sapiens OX=9606 GN=ZNF407	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	941-UNIMOD:35,952-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q96S59-2|RANB9_HUMAN	Isoform 2 of Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	145-UNIMOD:35,146-UNIMOD:21,151-UNIMOD:35	0.06	32.0	1	1	1
PRT	sp|Q96JM2|ZN462_HUMAN	Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	350-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q86VP3-4|PACS2_HUMAN	Isoform 4 of Phosphofurin acidic cluster sorting protein 2 OS=Homo sapiens OX=9606 GN=PACS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	254-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	374-UNIMOD:35,382-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	85-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9NZN8-4|CNOT2_HUMAN	Isoform 4 of CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	119-UNIMOD:35,126-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1043-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P08559-4|ODPA_HUMAN	Isoform 4 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	331-UNIMOD:21,332-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q9BQI5|SGIP1_HUMAN	SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	493-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	859-UNIMOD:21	0.03	32.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SLNSTPPPPPAPAPAPPPALAR	1	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	5-UNIMOD:21	ms_run[2]:scan=12705	70.151	2	2195.114	2195.1140	R	P	328	350
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15394	87.22483833333332	3	3442.4024	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	3	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16164	92.29077	3	3442.4012	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	4	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15240	86.20973333333333	3	3442.4024	3442.4027	K	L	104	135
PSM	TGSGGPGNHPHGPDASAEGLNPYGLVAPR	5	sp|Q86UX7-2|URP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=14436	80.938	3	2861.2882	2861.2882	R	F	478	507
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	6	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14926	84.15407666666667	3	3442.4008	3442.4027	K	L	104	135
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	7	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=8492	46.1	3	2671.2239	2671.2239	K	Q	710	737
PSM	KLSVPTSDEEDEVPAPKPR	8	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21	ms_run[2]:scan=10109	55.069	2	2173.0304	2173.0304	K	G	103	122
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	9	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=12587	69.436	3	3054.4408	3054.4408	R	S	1021	1050
PSM	RVEHNQSYSQAGITETEWTSGSSK	10	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=10677	58.216	3	2761.1981	2761.1981	R	G	216	240
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	11	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16316	93.35595333333333	3	3442.4002	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	12	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15086	85.18715999999999	3	3442.4017	3442.4027	K	L	104	135
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	13	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	28-UNIMOD:21	ms_run[2]:scan=10381	56.601	3	3407.6452	3407.6452	R	N	577	608
PSM	PARPNLSGSSAGSPLSGLGGEGPGESEK	14	sp|Q9Y6C2|EMIL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12349	67.99	3	2594.2572	2594.2572	R	V	150	178
PSM	RQDDATGAGQDSENEVSLVSGHQR	15	sp|P16157-10|ANK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:21	ms_run[2]:scan=7912	42.788	3	2635.126	2635.1260	K	G	1655	1679
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	16	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:21	ms_run[2]:scan=9032	49.092	3	3112.5078	3112.5078	R	S	818	847
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	17	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=12781	70.578	3	2574.2228	2574.2228	K	K	408	434
PSM	ADEASEGDSPAPARPEDTPPAPPPPPAR	18	sp|Q6PJ61|FBX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=8467	45.96	3	2871.2712	2871.2712	R	D	330	358
PSM	DLHQPSLSPASPHSQGFER	19	sp|Q9BZF1-3|OSBL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=10420	56.814	2	2168.964	2168.9640	K	G	16	35
PSM	GVPHPEDDHSQVEGPESLR	20	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=8293	44.985	2	2163.9222	2163.9222	K	-	679	698
PSM	KEEEEEEEEYDEGSNLKK	21	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5179	27.814	3	2212.9495	2212.9495	K	Q	230	248
PSM	KMPQLTASAIVSPHGDESPR	22	sp|Q9Y6J9|TAF6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9947	54.175	2	2216.0297	2216.0297	R	G	484	504
PSM	KPLTSSSAAPQRPISTQR	23	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=5086	27.34	2	2004.0154	2004.0154	K	T	151	169
PSM	RQVSASELHTSGILGPETLR	24	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=14192	79.446	2	2230.1107	2230.1107	R	D	2715	2735
PSM	SHVSSEPYEPISPPQVPVVHEK	25	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=13823	77.084	3	2521.189	2521.1890	R	Q	2037	2059
PSM	TPPGPPPPDDDEDDPVPLPVSGDKEEDAPHR	26	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=12844	70.943	3	3366.4565	3366.4565	R	E	184	215
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	27	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15553	88.22904833333332	3	3442.4014	3442.4027	K	L	104	135
PSM	KKPGDASSLPDAGLSPGSQVDSK	28	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	15-UNIMOD:21	ms_run[1]:scan=9283	50.483536666666666	3	2320.097435	2320.094786	K	S	1391	1414
PSM	HIKEEPLSEEEPCTSTAIASPEK	29	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10442	56.939	2	2661.1881	2661.1881	K	K	495	518
PSM	RAPSVANVGSHCDLSLK	30	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9922	54.042	2	1889.8819	1889.8819	R	I	2141	2158
PSM	SAPTAPTPPPPPPPATPR	31	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=8551	46.46	2	1827.892	1827.8921	R	K	799	817
PSM	SHVSSEPYEPISPPQVPVVHEK	32	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=14121	78.984	2	2521.189	2521.1890	R	Q	2037	2059
PSM	STAQQELDGKPASPTPVIVASHTANK	33	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=9397	51.083	3	2726.3276	2726.3276	R	E	818	844
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	34	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15706	89.23844166666666	3	3442.4014	3442.4027	K	L	104	135
PSM	QVSASELHTSGILGPETLR	35	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18113	105.84997166666666	2	2056.9818	2056.9825	R	D	2716	2735
PSM	SRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVK	36	sp|Q00013|EM55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:35,27-UNIMOD:21	ms_run[1]:scan=11098	60.608628333333336	3	3433.549380	3432.565715	R	G	31	63
PSM	KKEDDDGEIDDGEIDDDDLEEGEVK	37	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11427	62.481	3	2821.1785	2821.1785	K	D	187	212
PSM	KSNLDEEVNVIPPHTPVR	38	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=11388	62.267	2	2123.0412	2123.0412	R	T	359	377
PSM	RVEHNQSYSQAGITETEWTSGSSK	39	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=10489	57.203	3	2761.1981	2761.1981	R	G	216	240
PSM	VHDRSEEEEEEEEEEEEEQPR	40	sp|Q5TAQ9-2|DCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=6057	32.385	3	2751.0305	2751.0305	R	R	95	116
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	41	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16468	94.40236833333333	3	3442.4011	3442.4027	K	L	104	135
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	42	sp|Q0ZGT2|NEXN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5975	31.982745	3	3008.170819	3007.187379	K	S	554	579
PSM	DPDAQPGGELMLGGTDSK	43	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:35	ms_run[2]:scan=9909	53.974	2	1802.7993	1802.7993	R	Y	236	254
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	44	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=8660	47.107	3	2671.2239	2671.2239	K	Q	710	737
PSM	KPLTSSSAAPQRPISTQR	45	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=4501	24.143	2	2004.0154	2004.0154	K	T	151	169
PSM	LEQPEEDKYSKPTAPAPSAPPSPSAPEPPK	46	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	22-UNIMOD:21	ms_run[2]:scan=9540	51.883	3	3221.517	3221.5170	K	A	361	391
PSM	RADAGSHTEGSPSQPR	47	sp|Q86V15-2|CASZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=696	5.8362	2	1731.7326	1731.7326	K	D	47	63
PSM	RDSITPDIATKPGQPLFLDSISPK	48	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=17840	103.94	3	2675.3571	2675.3571	R	K	315	339
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTK	49	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=13192	73.083	3	3379.6158	3379.6158	R	V	1112	1146
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	50	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=12770	70.514	3	3054.4408	3054.4408	R	S	1021	1050
PSM	RPAHPILATADGASQLVGME	51	sp|Q92766-5|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=13785	76.832	2	2128.9977	2128.9977	K	-	1402	1422
PSM	RTPTMPQEEAAACPPHILPPEK	52	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10880	59.36	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SHVSSEPYEPISPPQVPVVHEK	53	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=13981	78.092	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SSSISEEKGDSDDEKPR	54	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1254	8.0891	2	1864.8286	1864.8286	K	K	206	223
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	55	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=24093	151.0751833333333	3	3442.4008	3442.4027	K	L	104	135
PSM	RQDDATGAGQDSENEVSLVSGHQR	56	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=8195	44.44307833333333	3	2636.111600	2635.125980	K	G	1655	1679
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	57	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	10-UNIMOD:21	ms_run[1]:scan=12753	70.43093666666667	2	2575.223690	2574.222781	K	K	453	479
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	58	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=16961	97.807	3	3613.8254	3613.8254	R	Q	125	162
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	59	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	28-UNIMOD:21	ms_run[2]:scan=10199	55.584	3	3407.6452	3407.6452	R	N	577	608
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	60	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=8314	45.093	3	2671.2239	2671.2239	K	Q	710	737
PSM	HQASDSENEELPKPR	61	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4162	22.354	2	1815.7789	1815.7789	R	I	232	247
PSM	PRPTEATVSLSSLVDYPHQAR	62	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=16955	97.761	3	2403.1584	2403.1584	R	V	941	962
PSM	PTSQHYTNPTSNPVPASPINFHPESR	63	sp|Q6N043-3|Z280D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=12509	68.967	3	2954.3348	2954.3348	K	S	88	114
PSM	RLSGGSHSYGGESPR	64	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=2786	15.475	2	1625.6947	1625.6947	R	L	294	309
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	65	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16002	91.265095	3	3442.3937	3442.4027	K	L	104	135
PSM	RRTCETGEPMEAESGDTSSEGPAQVYLPGR	66	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,4-UNIMOD:4,10-UNIMOD:35	ms_run[1]:scan=11262	61.52002333333333	3	3363.418705	3362.418065	R	G	8	38
PSM	SETAPAETATPAPVEKSPAK	67	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7381	39.862321666666666	2	2102.9765	2102.9768	M	K	2	22
PSM	AAEDDEDDDVDTKK	68	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=1186	7.7956	2	1564.6377	1564.6377	R	Q	90	104
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	69	sp|Q5HYK7|SH319_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=14624	82.144	3	3082.4471	3082.4471	K	L	268	296
PSM	GPGAPASPSASHPQGLDTTPKPH	70	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=6187	33.115	2	2286.043	2286.0430	R	-	924	947
PSM	HFIDVGAGVIDEDYR	71	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15155	85.643	2	1704.8107	1704.8107	K	G	92	107
PSM	HRPVSSSDSSDESPSTSFTSGSMYR	72	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,23-UNIMOD:35	ms_run[2]:scan=8794	47.808	3	2786.1127	2786.1127	R	I	4	29
PSM	HSPQPSPSSSFNEGLLTGGHR	73	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=12215	67.131	3	2271.007	2271.0070	R	H	599	620
PSM	IEDVGSDEEDDSGKDK	74	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3251	17.787	2	1816.6888	1816.6888	K	K	250	266
PSM	KHVTTAEGTPGTTDQEGPPPDGPPEK	75	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=4993	26.823	3	2722.2123	2722.2123	R	R	1497	1523
PSM	KQSLGELIGTLNAAK	76	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=17597	102.22	2	1621.844	1621.8440	R	V	56	71
PSM	KRESESESDETPPAAPQLIK	77	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=9630	52.416	2	2291.0682	2291.0682	R	K	448	468
PSM	LGSVTHVTSFSHAPPSSR	78	sp|P53814-2|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=9478	51.521	2	1945.9047	1945.9047	R	G	65	83
PSM	LHNENAEMDSDSSSSGTETDLHGSLR	79	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=6742	36.222	3	2884.1455	2884.1455	R	V	220	246
PSM	NVAEALGHSPKDPGGGGGPVR	80	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=7642	41.323	3	2050.9586	2050.9586	K	A	428	449
PSM	NVAEALGHSPKDPGGGGGPVR	81	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=7671	41.469	2	2050.9586	2050.9586	K	A	428	449
PSM	RASAAAAAGGGATGHPGGGQGAENPAGLK	82	sp|Q07617|SPAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=5807	31.134	3	2538.1725	2538.1725	R	S	421	450
PSM	RHSTSDLSDATFSDIR	83	sp|Q9P227-2|RHG23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=11466	62.703	2	1886.816	1886.8160	K	R	675	691
PSM	RKPSVPDSASPADDSFVDPGER	84	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=10870	59.301	3	2408.0645	2408.0645	K	L	18	40
PSM	RLSTSPDVIQGHQPR	85	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7246	39.125	2	1769.8574	1769.8574	R	D	264	279
PSM	RNSIEVAGLSHGLEGLR	86	sp|Q16825|PTN21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=15260	86.332	2	1886.9364	1886.9364	K	L	635	652
PSM	RPASPSHNGSSGGGYGASK	87	sp|Q6PI98|IN80C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=906	6.677	2	1852.7854	1852.7854	K	K	23	42
PSM	SAPTAPTPPPPPPPATPR	88	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=8379	45.449	2	1827.892	1827.8921	R	K	799	817
PSM	SGGGLHSVAEGVRLSPEPGR	89	sp|Q9NWK9-2|BCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=11094	60.586	2	2040.9742	2040.9742	K	E	11	31
PSM	SHLVHGSSPGVMGTSVATSASK	90	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5526	29.644	3	2191.9933	2191.9933	K	I	1027	1049
PSM	SRPLSHYSSFGSSGGSGGGSMMGGESADK	91	sp|Q7LFL8|CXXC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,21-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=7192	38.838	3	2888.1379	2888.1379	R	A	76	105
PSM	WAHDKFSGEEGEIEDDESGTENR	92	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=11261	61.516	3	2716.0562	2716.0562	K	E	922	945
PSM	WAHDKFSGEEGEIEDDESGTENR	93	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=11284	61.64	2	2716.0562	2716.0562	K	E	922	945
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	94	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=17404	100.89598666666667	3	3442.4010	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	95	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16975	97.90008333333334	3	3442.4014	3442.4027	K	L	104	135
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	96	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=11160	60.96857166666667	3	2814.242698	2814.243258	R	G	194	223
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	97	sp|Q8N122|RPTOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21	ms_run[1]:scan=8986	48.825215	3	2672.209521	2671.223903	K	Q	868	895
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	98	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12907	71.33082833333333	3	3072.3934	3072.3933	R	T	553	583
PSM	EPRPNSSPSPSPGQASETPHPRPS	99	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=4660	25.014	3	2575.1453	2575.1453	R	-	327	351
PSM	GHTDTEGRPPSPPPTSTPEK	100	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=4105	22.066	2	2166.9583	2166.9583	R	C	353	373
PSM	HISESCPFPSPGGQLAEVHSVSPEQGAK	101	sp|Q5T1V6-2|DDX59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13804	76.967	3	3011.3485	3011.3485	R	D	55	83
PSM	IGHHSTSDDSSAYRSVDEVNYWDK	102	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12504	68.931	3	2927.1437	2927.1437	R	Q	333	357
PSM	IHIDPEIQDGSPTTSR	103	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=10163	55.374	2	1844.8306	1844.8306	R	R	102	118
PSM	KEEEEEEEEYDEGSNLKK	104	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5192	27.871	2	2212.9495	2212.9495	K	Q	230	248
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	105	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6957	37.492	3	4005.3218	4005.3218	K	-	184	216
PSM	KKVEEEDEEEEEEEEEEEEEEDE	106	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7431	40.136	3	2926.0895	2926.0895	R	-	178	201
PSM	KLSVPTSDEEDEVPAPKPR	107	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=9925	54.056	2	2173.0304	2173.0304	K	G	103	122
PSM	KPASPPLPATQQEKPSQTPEAGR	108	sp|Q6ZU35|CRACD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=6505	34.82	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KTFPTVNPSTGEVICQVAEGDKEDVDK	109	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:4	ms_run[2]:scan=14927	84.158	3	2962.423	2962.4230	R	A	52	79
PSM	LKDQDQDEDEEEKEK	110	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=934	6.7874	2	1876.8174	1876.8174	R	R	182	197
PSM	LLKPGEEPSEYTDEEDTK	111	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=8813	47.904	3	2158.9195	2158.9195	R	D	200	218
PSM	NKPGPNIESGNEDDDASFK	112	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=8373	45.415	2	2112.8637	2112.8637	K	I	206	225
PSM	PAAPAAHSAHSASVSPVESR	113	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=3627	19.694	3	2007.9164	2007.9164	R	G	879	899
PSM	PGAEGAPLLPPPLPPPSPPGSGR	114	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=16703	96.038	2	2237.1246	2237.1246	R	G	27	50
PSM	RGPGYTSGTNSEASNASETESDHR	115	sp|Q06787-2|FMR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=3212	17.612	3	2589.0365	2589.0365	R	D	463	487
PSM	RHGSMVSLVSGASGYSATSTSSFK	116	sp|Q9Y5P4-2|CERT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=11669	63.9	3	2499.1101	2499.1101	R	K	129	153
PSM	RHSTEGEEGDVSDVGSR	117	sp|Q8TF61|FBX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=3203	17.573	2	1895.7647	1895.7647	R	T	476	493
PSM	RLPALSHSEGEEDEDEEEDEGK	118	sp|P55201-4|BRPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=7806	42.2	3	2579.0184	2579.0184	R	G	455	477
PSM	RRSIYDTVTDTEMVEK	119	sp|Q6PIF6-2|MYO7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9453	51.39	2	2037.9078	2037.9078	K	V	902	918
PSM	SEVQQPVHPKPLSPDSR	120	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=6391	34.22	2	1979.9466	1979.9466	K	A	350	367
PSM	SLSSSLQAPVVSTVGMQR	121	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=15263	86.347	2	1941.9231	1941.9231	R	L	11	29
PSM	SLVHEVGKPPQDVTDDSPPSK	122	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=8666	47.137	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SRSPLLVTVVESDPRPQGQPR	123	sp|Q5VWN6-2|TASO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=14093	78.817	3	2397.2166	2397.2166	R	R	1230	1251
PSM	VLGAFSDGLAHLDNLK	124	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17912	104.43	2	1668.8835	1668.8835	K	G	68	84
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	125	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=11515	62.998	3	2814.2433	2814.2433	R	G	194	223
PSM	SRPFTVAASFQSTSVKSPK	126	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:21	ms_run[1]:scan=11622	63.637708333333336	3	2104.036771	2104.035421	R	T	588	607
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	127	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15854	90.245775	3	3442.4007	3442.4027	K	L	104	135
PSM	SRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVK	128	sp|Q00013|EM55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	17-UNIMOD:35,27-UNIMOD:21	ms_run[1]:scan=11296	61.71268166666667	3	3433.547834	3432.565715	R	G	31	63
PSM	IYHLPDAESDEDEDFK	129	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:21	ms_run[1]:scan=13699	76.28614166666667	2	2002.790798	2001.788099	K	E	210	226
PSM	ASPGHSPHYFAASSPTSPNALPPAR	130	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21	ms_run[1]:scan=11088	60.553535	3	2596.188329	2596.186001	R	K	1847	1872
PSM	TIDLGAAAHYTGDKASPDQNASTHTPQSSVK	131	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:21	ms_run[1]:scan=10844	59.150484999999996	3	3248.462666	3247.478280	K	T	284	315
PSM	DASDDLDDLNFFNQK	132	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19161	113.33	2	1755.7588	1755.7588	K	K	65	80
PSM	ELLHSVHPESPNLK	133	sp|Q9Y217|MTMR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=9263	50.381	2	1678.808	1678.8080	K	T	552	566
PSM	FLQEHGSDSFLAEHK	134	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=11376	62.19	2	1823.788	1823.7880	K	L	28	43
PSM	HNPSIGEGSVGGLTGSLSASGSHMDR	135	sp|Q9NV58-2|RN19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=11857	65.001	3	2605.1228	2605.1228	R	I	499	525
PSM	HPPLYQAGLTPPLSPPK	136	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=15019	84.778	2	1891.9597	1891.9597	R	S	1295	1312
PSM	HREDSDVEMVEDDSR	137	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5658	30.307	2	1913.7099	1913.7099	R	K	232	247
PSM	IACRSPQPDPVGTPTIFKPQSK	138	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=12234	67.237	3	2503.2294	2503.2294	K	R	1859	1881
PSM	ILGSASPEEEQEKPILDRPTR	139	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=11051	60.334	2	2444.1948	2444.1948	R	I	82	103
PSM	KEESEESDDDMGFGLFD	140	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:35	ms_run[2]:scan=16044	91.548	2	1964.7469	1964.7469	K	-	73	90
PSM	KFSAGGDSDPPLKR	141	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=5540	29.72	2	1553.7239	1553.7239	R	S	288	302
PSM	KMSDDEDDDEEEYGKEEHEK	142	sp|Q7KZ85-3|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=2793	15.5	3	2551.9058	2551.9058	K	E	123	143
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	143	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=13371	74.237	3	2662.3156	2662.3156	K	K	763	788
PSM	KVEEEQEADEEDVSEEEAESK	144	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=6384	34.185	3	2516.9803	2516.9803	K	E	234	255
PSM	LKEDILENEDEQNSPPKK	145	sp|Q9NTI5-5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=8276	44.886	3	2205.0202	2205.0202	R	G	40	58
PSM	PAAPAAHSAHSASVSPVESR	146	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=3650	19.8	2	2007.9164	2007.9164	R	G	879	899
PSM	PVLHMVSSEQHSADLNR	147	sp|Q05209-2|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=7297	39.418	2	2014.8932	2014.8932	K	N	261	278
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	148	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11872	65.086	3	3319.3595	3319.3595	R	L	585	614
PSM	RGEGDAPFSEPGTTSTQRPSSPETATK	149	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21	ms_run[2]:scan=7860	42.483	3	2870.272	2870.2720	R	Q	303	330
PSM	RHTSAEEEEPPPVK	150	sp|Q9BZ95-3|NSD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=2535	14.272	2	1684.7458	1684.7458	R	I	454	468
PSM	RKPSPEPEGEVGPPK	151	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=3931	21.199	2	1682.8029	1682.8029	K	I	341	356
PSM	RPASVSSSAAVEHEQR	152	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=3146	17.311	2	1789.8108	1789.8108	K	E	237	253
PSM	RQVSASELHTSGILGPETLR	153	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=14147	79.141	3	2230.1107	2230.1107	R	D	2715	2735
PSM	RRSDSTLFSTVDTDEIPAK	154	sp|Q9HC62|SENP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=14033	78.421	3	2217.0315	2217.0315	R	R	30	49
PSM	SLVHEVGKPPQDVTDDSPPSK	155	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=8240	44.671	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SLVHEVGKPPQDVTDDSPPSK	156	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=8497	46.124	3	2311.0733	2311.0733	R	K	1206	1227
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	157	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=11343	61.99	3	2814.2433	2814.2433	R	G	194	223
PSM	TYFPHFDLSHGSAQVK	158	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=14996	84.62347666666668	2	1912.851058	1912.850914	K	G	42	58
PSM	QDDSPPRPIIGPALPPGFIK	159	sp|Q8IXQ4|GPAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=20016	119.65281	2	2177.0905	2177.0917	K	S	102	122
PSM	AFGESSTESDEEEEEGCGHTHCVR	160	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=6575	35.203	3	2818.012	2818.0120	R	G	69	93
PSM	AHSLMELSPSAPPGGSPHLDSSR	161	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=10574	57.663	3	2425.0733	2425.0733	K	S	593	616
PSM	APAKPPGSGLDLADALDDQDDGR	162	sp|Q8TCZ2-6|C99L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=14982	84.531	3	2293.0822	2293.0822	R	R	62	85
PSM	APTVPPPLPPTPPQPAR	163	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=12720	70.246	2	1811.9335	1811.9335	R	R	616	633
PSM	ASPGHSPHYFAASSPTSPNALPPAR	164	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=11269	61.562	3	2596.186	2596.1860	R	K	1847	1872
PSM	EEQTDTSDGESVTHHIR	165	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=5014	26.945	2	2019.8171	2019.8171	R	R	45	62
PSM	GDTPGHATPGHGGATSSAR	166	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=903	6.6661	2	1812.7541	1812.7541	R	K	271	290
PSM	HREDSDVEMVEDDSR	167	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5843	31.315	2	1913.7099	1913.7099	R	K	232	247
PSM	KRDSDAGSSTPTTSTR	168	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=811	6.3131	2	1745.7581	1745.7581	R	S	1381	1397
PSM	PFSPPIHSSSPPPIAPLAR	169	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=15359	86.979	3	2047.0292	2047.0292	R	A	285	304
PSM	PGAEGAPLLPPPLPPPSPPGSGR	170	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:21	ms_run[2]:scan=16545	94.936	2	2237.1246	2237.1246	R	G	27	50
PSM	RGLLYDSDEEDEERPAR	171	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=9276	50.449	2	2128.9063	2128.9063	R	K	133	150
PSM	RGSLCSGCQKPITGR	172	sp|P49023-4|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=3668	19.874	2	1755.791	1755.7910	R	C	364	379
PSM	RSNSAPLIHGLSDTSPVFQAEAPSAR	173	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=16213	92.61	3	2787.3341	2787.3341	R	R	34	60
PSM	RSPVSPQLQQQHQAAAAAFLQQR	174	sp|Q7Z5Q1-7|CPEB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=12763	70.478	3	2639.3082	2639.3082	R	N	66	89
PSM	SLNSTPPPPPAPAPAPPPALAR	175	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=12540	69.146	2	2195.114	2195.1140	R	P	328	350
PSM	SPPDQPAVPHPPPSTPIK	176	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=9208	50.095	2	1940.9397	1940.9397	K	L	600	618
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	177	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	29-UNIMOD:21	ms_run[2]:scan=7024	37.871	3	3200.3895	3200.3895	K	E	204	236
PSM	SRPFTVAASFQSTSVKSPK	178	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	17-UNIMOD:21	ms_run[2]:scan=11623	63.64	2	2104.0354	2104.0354	R	T	588	607
PSM	STAQQELDGKPASPTPVIVASHTANK	179	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=9771	53.214	3	2726.3276	2726.3276	R	E	818	844
PSM	TKPIVKPQTSPEYGQGINPISR	180	sp|O95793-2|STAU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=10954	59.758	2	2489.2679	2489.2679	K	L	188	210
PSM	VHAYFAPVTPPPSVGGSR	181	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=13386	74.32	2	1917.9138	1917.9138	K	Q	377	395
PSM	VIPAKSPPPPTHSTQLGAPSR	182	sp|Q14814-6|MEF2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=6806	36.609	3	2217.1307	2217.1307	K	K	200	221
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	183	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16620	95.45763833333334	3	3442.4011	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	184	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=17798	103.65481833333334	3	3442.4013	3442.4027	K	L	104	135
PSM	VNHEPEPAGGATPGATLPKSPSQLR	185	sp|O00499|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	20-UNIMOD:21	ms_run[1]:scan=10497	57.245284999999996	3	2590.256327	2590.254081	R	K	312	337
PSM	APTVPPPLPPTPPQPAR	186	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=12895	71.254175	2	1812.936708	1811.933522	R	R	616	633
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	187	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=12138	66.64132333333333	3	3174.559346	3174.559825	K	N	773	803
PSM	GTTGQSAEVTGATGQSVGVTGTTR	188	sp|Q7Z5P9|MUC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=3624	19.674898333333335	3	2382.991807	2382.010144	K	S	5831	5855
PSM	APTVPPPLPPTPPQPAR	189	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=12389	68.224	2	1811.9335	1811.9335	R	R	616	633
PSM	APTVPPPLPPTPPQPAR	190	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=12554	69.237	2	1811.9335	1811.9335	R	R	616	633
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	191	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8305	45.047	3	2465.0431	2465.0431	R	A	90	114
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	192	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12748	70.406	3	3459.4297	3459.4297	K	L	104	135
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	193	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	26-UNIMOD:21	ms_run[2]:scan=10783	58.792	3	2826.3046	2826.3046	R	F	52	81
PSM	DKYEPAAVSEQGDKK	194	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=3191	17.524	2	1663.8053	1663.8053	R	G	8	23
PSM	DRSSPPPGYIPDELHQVAR	195	sp|Q9Y2U5|M3K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=13372	74.24	3	2213.0266	2213.0266	R	N	161	180
PSM	FADQDDIGNVSFDR	196	sp|Q5H9R7-6|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13632	75.877	2	1597.7009	1597.7009	K	V	540	554
PSM	GMKDDKEEEEDGTGSPQLNNR	197	sp|P49407-2|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=3877	20.933	3	2427.985	2427.9850	K	-	390	411
PSM	HLDVDLDRQSLSSIDK	198	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=12891	71.227	2	1919.899	1919.8990	K	N	1502	1518
PSM	HLEHAPSPSDVSNAPEVK	199	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=8121	44.024	3	1992.8942	1992.8942	K	A	439	457
PSM	HVFGESDELIGQK	200	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10346	56.419	2	1457.7151	1457.7151	R	V	138	151
PSM	IFQGSFGGPTLYENPHYQSPNMHR	201	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=14552	81.662	3	2872.2429	2872.2429	K	R	243	267
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	202	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5828	31.235	3	4005.3218	4005.3218	K	-	184	216
PSM	KKVEEEDEEEEEEEEEEEEEEDE	203	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7451	40.243	2	2926.0895	2926.0895	R	-	178	201
PSM	KLNHTPVSTMSSSQPVSR	204	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3070	16.947	3	2050.9507	2050.9507	K	P	983	1001
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	205	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=13923	77.731	3	3605.6199	3605.6199	K	L	150	183
PSM	KLSVPTSDEEDEVPAPKPR	206	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=9703	52.82	3	2173.0304	2173.0304	K	G	103	122
PSM	KNQDDDDDDDDGFFGPALPPGFK	207	sp|Q8IXQ4-4|GPAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18003	105.07	3	2524.0666	2524.0666	R	K	78	101
PSM	KPGDGEVSPSTEDAPFQHSPLGK	208	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=11993	65.782	2	2459.1006	2459.1006	K	A	520	543
PSM	KPRPSEGDEDCLPASK	209	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3836	20.742	3	1864.8026	1864.8026	K	K	247	263
PSM	KTPSKPPAQLSPSVPK	210	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=6669	35.796	2	1740.9175	1740.9175	K	R	256	272
PSM	KVLSPTAAKPSPFEGK	211	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=8764	47.662	2	1735.891	1735.8910	K	T	310	326
PSM	LKDLFDYSPPLHK	212	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=15616	88.614	2	1651.8011	1651.8011	K	N	503	516
PSM	NFTKPQDGDVIAPLITPQKK	213	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=13529	75.237	3	2289.177	2289.1770	R	E	507	527
PSM	QGHRPLSQSIVEAGSVGQTDLNK	214	sp|A6NDB9|PALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=12861	71.045	3	2500.2071	2500.2071	R	R	118	141
PSM	RAAEDDEDDDVDTKK	215	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=899	6.6517	2	1720.7388	1720.7388	K	Q	89	104
PSM	RHSSLIDIDSVPTYK	216	sp|Q7LDG7|GRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=13985	78.117	2	1809.8662	1809.8662	R	W	114	129
PSM	RISHSLYSGIEGLDESPSR	217	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=14230	79.677	2	2182.0056	2182.0056	R	N	700	719
PSM	RPACDPEPGESGSSSDEGCTVVRPEK	218	sp|O15541|R113A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4,15-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=6147	32.893	3	2882.1848	2882.1848	K	K	33	59
PSM	RRPSGSEQSDNESVQSGR	219	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=945	6.8344	3	2054.8767	2054.8767	K	S	1094	1112
PSM	RRSEVVESTTESQDK	220	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=1761	10.26	2	1829.8157	1829.8157	R	E	1420	1435
PSM	RRSTDSSSVSGSLQQETK	221	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=4657	24.992	3	2031.9222	2031.9222	K	Y	87	105
PSM	RVSEVEEEKEPVPQPLPSDDTR	222	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=10394	56.67	3	2615.2116	2615.2116	R	V	446	468
PSM	SDSVLPASHGHLPQAGSLER	223	sp|Q8N4C8-5|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=11444	62.573	2	2136.9953	2136.9953	R	N	690	710
PSM	SGHHPGETPPLITPGSAQS	224	sp|Q14802|FXYD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=9157	49.803	2	1948.868	1948.8680	K	-	69	88
PSM	SHVSSEPYEPISPPQVPVVHEK	225	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=14140	79.102	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SHYTMEFGYSSNSPSTHR	226	sp|O75581|LRP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7407	39.999	3	2182.8415	2182.8415	R	S	1496	1514
PSM	SKDHFGLEGDEESTMLEDSVSPK	227	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12756	70.446	3	2632.0888	2632.0888	K	K	405	428
PSM	STAQQELDGKPASPTPVIVASHTANK	228	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=10037	54.667	3	2726.3276	2726.3276	R	E	818	844
PSM	VHAYFAPVTPPPSVGGSR	229	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=13416	74.504	2	1917.9138	1917.9138	K	Q	377	395
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	230	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=12460	68.651	3	3174.5598	3174.5598	K	N	773	803
PSM	VPFSPGPAPPPHMGELDQER	231	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=11417	62.43	3	2252.9926	2252.9926	R	L	584	604
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	232	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=16517	94.739	3	2929.3908	2929.3908	R	A	635	662
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	233	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=11692	64.028	3	2814.2433	2814.2433	R	G	194	223
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	234	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12048	66.095	3	2814.2433	2814.2433	R	G	194	223
PSM	HIKEEPLSEEEPCTSTAIASPEK	235	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=11253	61.47319833333333	3	2662.174715	2661.188095	K	K	495	518
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	236	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=17143	99.033495	3	3442.3996	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	237	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14773	83.13451666666666	3	3442.4030	3442.4027	K	L	104	135
PSM	KNQKPSQVNGAPGSPTEPAGQK	238	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=2547	14.340829999999999	3	2299.090094	2299.095789	K	Q	1254	1276
PSM	YRHPSGGSNGATCSTQVSMLTR	239	sp|P32241|VIPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,13-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=7356	39.736763333333336	3	2463.029873	2462.046808	K	V	418	440
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	240	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=12610	69.571	3	2574.2228	2574.2228	K	K	408	434
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	241	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=11715	64.164	3	2956.4332	2956.4332	K	L	117	144
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	242	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13099	72.517	3	3459.4297	3459.4297	K	L	104	135
PSM	ESEDKPEIEDVGSDEEEEK	243	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=8212	44.526	2	2271.8792	2271.8792	K	K	251	270
PSM	GIRPFPSEETTENDDDVYR	244	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11680	63.968	3	2239.0029	2239.0029	K	S	125	144
PSM	GVVDSDDLPLNVSR	245	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13847	77.235	2	1484.7471	1484.7471	K	E	435	449
PSM	HLEHAPSPSDVSNAPEVK	246	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8104	43.924	2	1992.8942	1992.8942	K	A	439	457
PSM	HLQVNVTNPVQCSLHGK	247	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=10374	56.563	3	2009.9506	2009.9506	R	K	959	976
PSM	HPPLYQAGLTPPLSPPK	248	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=14870	83.77	2	1891.9597	1891.9597	R	S	1295	1312
PSM	HQDGLPYIDDSPSSSPHLSSK	249	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=12857	71.018	3	2346.0165	2346.0165	R	G	449	470
PSM	KDDTDDEIAKYDGK	250	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5701	30.546	2	1611.7264	1611.7264	K	W	125	139
PSM	KHEADELSGDASVEDDAFIK	251	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=12819	70.804	3	2254.9631	2254.9631	K	D	86	106
PSM	KPASPPLPATQQEKPSQTPEAGR	252	sp|Q6ZU35|CRACD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=6312	33.809	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KPEEMPTACPGHSPR	253	sp|Q9NZC9|SMAL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=1316	8.3318	2	1788.7325	1788.7325	K	S	100	115
PSM	KPLTSSSAAPQRPISTQR	254	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=5290	28.366	2	2004.0154	2004.0154	K	T	151	169
PSM	KSPSLESLSRPPSLGFGDTR	255	sp|Q5M775-4|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=15560	88.271	2	2210.0733	2210.0733	R	L	830	850
PSM	KSQVAELNDDDKDDEIVFK	256	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11781	64.543	3	2207.0594	2207.0594	R	Q	246	265
PSM	KSVSSENPTYPSAPLKPVTVPPR	257	sp|Q5HYK7|SH319_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=11764	64.444	3	2530.2833	2530.2833	K	L	147	170
PSM	LKDQDQDEDEEEKEK	258	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=927	6.7627	3	1876.8174	1876.8174	R	R	182	197
PSM	NAGSAVTMSDEHANKPAESPTSVLEKPDR	259	sp|Q9C0G0-3|ZN407_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=8805	47.865	3	3133.4023	3133.4023	K	G	934	963
PSM	NFTKPQDGDVIAPLITPQKK	260	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=13369	74.226	3	2289.177	2289.1770	R	E	507	527
PSM	PFSSPSMSPSHGMNIHNLASGK	261	sp|Q96S59-2|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=8499	46.136	3	2394.0134	2394.0134	R	G	139	161
PSM	PGAEGAPLLPPPLPPPSPPGSGR	262	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:21	ms_run[2]:scan=16905	97.407	2	2237.1246	2237.1246	R	G	27	50
PSM	PKSPHNSGLVNLTER	263	sp|Q96JM2|ZN462_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=8181	44.365	3	1727.8356	1727.8356	K	S	348	363
PSM	PYFEGLSHSSSQTEIGSIHSAR	264	sp|Q86VP3-4|PACS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=13410	74.47	3	2469.0962	2469.0962	R	S	246	268
PSM	RAAEDDEDDDVDTK	265	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1331	8.3972	2	1592.6438	1592.6438	K	K	89	103
PSM	RKPSVPDSASPADDSFVDPGER	266	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=10691	58.29	3	2408.0645	2408.0645	K	L	18	40
PSM	RPMEEDGEEKSPSK	267	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=633	5.5908	2	1713.6917	1713.6917	K	K	372	386
PSM	RSSPSARPPDVPGQQPQAAK	268	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=5165	27.746	2	2153.0379	2153.0379	R	S	81	101
PSM	SLSQGTQLPSHVTPTTGVPTMSLHTPPSPSR	269	sp|Q9NZN8-4|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=12797	70.676	3	3293.5752	3293.5752	R	G	99	130
PSM	SLVHEVGKPPQDVTDDSPPSK	270	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:21	ms_run[2]:scan=8789	47.776	2	2311.0733	2311.0733	R	K	1206	1227
PSM	SRSPLLVTVVESDPRPQGQPR	271	sp|Q5VWN6-2|TASO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=13937	77.812	3	2397.2166	2397.2166	R	R	1230	1251
PSM	TPPGPPPPDDDEDDPVPLPVSGDKEEDAPHR	272	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:21	ms_run[2]:scan=13013	71.962	3	3366.4565	3366.4565	R	E	184	215
PSM	VGAHAGEYGAEALER	273	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7751	41.885	2	1528.727	1528.7270	K	M	18	33
PSM	VKHEVSGETVVFQGGALGK	274	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=11629	63.667	2	2020.9983	2020.9983	R	T	1038	1057
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	275	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=12295	67.646	3	3174.5598	3174.5598	K	N	773	803
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	276	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=16221	92.664	3	2929.3908	2929.3908	R	A	635	662
PSM	YHGHSMSDPGVSYR	277	sp|P08559-4|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3414	18.628	2	1687.645	1687.6450	R	T	327	341
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	278	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14440	80.96502666666667	3	3460.426892	3459.429735	K	L	104	135
PSM	PFSPPIHSSSPPPIAPLAR	279	sp|Q9BQI5|SGIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=15512	87.984245	3	2048.032865	2047.029213	R	A	484	503
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	280	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=9691	52.756056666666666	3	3112.500381	3112.507789	R	S	847	876
N407_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=8805	47.865473333333334	3	3133.402362	3133.402338	K	G	934	963
PSM	SLSQGTQLPSHVTPTTGVPTMSLHTPPSPSR	282	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	21-UNIMOD:35,28-UNIMOD:21	ms_run[1]:scan=12797	70.675935	3	3293.572808	3293.575158	R	G	99	130
PSM	HMSSMEHTEEGLR	283	sp|Q9H6U6|BCAS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:35,4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1670	9.81981	2	1654.611502	1654.611672	R	E	847	860
PSM	RPMEEDGEEKSPSK	284	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=633	5.590801666666667	2	1713.689823	1713.691696	K	K	372	386
PSM	KPEEMPTACPGHSPR	285	sp|Q9NZC9|SMAL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1316	8.331818333333333	2	1788.731614	1788.732456	K	S	100	115
PSM	KPLTSSSAAPQRPISTQR	286	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=5290	28.36570833333333	2	2004.014992	2004.015354	K	T	151	169
PSM	KPLTSSSAAPQRPISTQR	287	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=4501	24.14288833333333	2	2004.015208	2004.015354	K	T	151	169
PSM	GMKDDKEEEEDGTGSPQLNNR	288	sp|P49407|ARRB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=2689	15.041095	2	2443.981118	2443.979893	K	-	398	419
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	289	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=9691	52.756056666666666	3	3112.500381	3112.507789	R	S	847	876