MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr17.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr17.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	725-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2048-UNIMOD:21	0.01	43.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	43.0	4	1	0
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	445-UNIMOD:21	0.01	42.0	3	1	0
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	4298-UNIMOD:21	0.00	42.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	120-UNIMOD:21,132-UNIMOD:21,112-UNIMOD:21	0.17	41.0	4	2	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	266-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|O94823|AT10B_HUMAN	Probable phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1371-UNIMOD:21,1381-UNIMOD:21	0.01	40.0	3	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	266-UNIMOD:21	0.05	40.0	4	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2532-UNIMOD:21	0.00	39.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q8NFZ5-2|TNIP2_HUMAN	Isoform 2 of TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	79-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.15	39.0	5	2	1
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	114-UNIMOD:21,122-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	415-UNIMOD:35	0.04	39.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	614-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q0ZGT2|NEXN_HUMAN	Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	564-UNIMOD:21,566-UNIMOD:35,569-UNIMOD:21	0.04	39.0	3	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	118-UNIMOD:21	0.03	38.0	3	1	0
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	625-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	58-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	451-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	43-UNIMOD:21	0.05	38.0	4	1	0
PRT	sp|P78317|RNF4_HUMAN	E3 ubiquitin-protein ligase RNF4 OS=Homo sapiens OX=9606 GN=RNF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	91-UNIMOD:4,94-UNIMOD:21	0.12	38.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	234-UNIMOD:21,236-UNIMOD:21	0.07	38.0	3	1	0
PRT	sp|O43318-4|M3K7_HUMAN	Isoform 1D of Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	412-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1246-UNIMOD:21,1255-UNIMOD:4,1247-UNIMOD:35,1244-UNIMOD:21	0.02	38.0	6	1	0
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	328-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q6P0Q8-2|MAST2_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1161-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	830-UNIMOD:21	0.03	38.0	2	2	2
PRT	sp|Q6PJ61|FBX46_HUMAN	F-box only protein 46 OS=Homo sapiens OX=9606 GN=FBXO46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	334-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	242-UNIMOD:21,240-UNIMOD:21	0.08	37.0	5	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase 2B1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	332-UNIMOD:21	0.07	37.0	2	2	2
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	161-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1505-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	769-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q0ZGT2-4|NEXN_HUMAN	Isoform 4 of Nexilin OS=Homo sapiens OX=9606 GN=NEXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	502-UNIMOD:35,505-UNIMOD:21,500-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	278-UNIMOD:4,287-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	963-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q6UUV9-3|CRTC1_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	149-UNIMOD:21,160-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|Q86UX7-2|URP2_HUMAN	Isoform 2 of Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	478-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	778-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	928-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	113-UNIMOD:21,1047-UNIMOD:21,1048-UNIMOD:35	0.05	36.0	3	2	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q15029-3|U5S1_HUMAN	Isoform 3 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	36-UNIMOD:35,55-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	366-UNIMOD:21	0.06	36.0	2	2	2
PRT	sp|P08235|MCR_HUMAN	Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	703-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P10451-3|OSTP_HUMAN	Isoform C of Osteopontin OS=Homo sapiens OX=9606 GN=SPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	197-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	153-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|P23497-7|SP100_HUMAN	Isoform 7 of Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	375-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	599-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	604-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	205-UNIMOD:21	0.05	36.0	3	1	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.14	36.0	1	1	0
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	372-UNIMOD:35,381-UNIMOD:35,393-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	417-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	597-UNIMOD:35,600-UNIMOD:21,595-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	626-UNIMOD:21	0.03	35.0	2	1	0
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	311-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1690-UNIMOD:21	0.01	35.0	4	1	0
PRT	sp|Q6ZU35|CRACD_HUMAN	Capping protein inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1042-UNIMOD:21,875-UNIMOD:21	0.04	35.0	2	2	2
PRT	sp|O15021-2|MAST4_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=MAST4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	57-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	217-UNIMOD:21,215-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q7Z5Q1-7|CPEB2_HUMAN	Isoform 6 of Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	67-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	864-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	34.0	2	2	2
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	34.0	5	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	377-UNIMOD:21,400-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	767-UNIMOD:21,698-UNIMOD:21,703-UNIMOD:4	0.06	34.0	4	3	2
PRT	sp|Q9BZF2-2|OSBL7_HUMAN	Isoform 2 of Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	226-UNIMOD:21	0.06	34.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	502-UNIMOD:21,507-UNIMOD:4	0.07	34.0	2	2	2
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:21,79-UNIMOD:21	0.06	34.0	3	1	0
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	154-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q8NFZ0|FBH1_HUMAN	F-box DNA helicase 1 OS=Homo sapiens OX=9606 GN=FBH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	124-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P08138-2|TNR16_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	217-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	517-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	21-UNIMOD:21,27-UNIMOD:21	0.07	34.0	2	1	0
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	41-UNIMOD:21	0.15	34.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1097-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	805-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	690-UNIMOD:35,703-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	11-UNIMOD:21,26-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	53-UNIMOD:21	0.12	34.0	1	1	1
PRT	sp|Q86TI0|TBCD1_HUMAN	TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	596-UNIMOD:21,604-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	369-UNIMOD:21	0.03	34.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	226-UNIMOD:21,255-UNIMOD:21	0.05	33.0	3	3	3
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	527-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	382-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	519-UNIMOD:35,529-UNIMOD:21,530-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	151-UNIMOD:21,149-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	951-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q86V15-2|CASZ1_HUMAN	Isoform 2 of Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	54-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	189-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P49796-4|RGS3_HUMAN	Isoform 4 of Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	662-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	299-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P32519-2|ELF1_HUMAN	Isoform 2 of ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	166-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O43513|MED7_HUMAN	Mediator of RNA polymerase II transcription subunit 7 OS=Homo sapiens OX=9606 GN=MED7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	189-UNIMOD:35,197-UNIMOD:4	0.10	33.0	1	1	1
PRT	sp|P67936-2|TPM4_HUMAN	Isoform 2 of Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	134-UNIMOD:21,157-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	33.0	2	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	620-UNIMOD:21	0.00	32.0	2	1	0
PRT	sp|Q86WP2-4|GPBP1_HUMAN	Isoform 4 of Vasculin OS=Homo sapiens OX=9606 GN=GPBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	151-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	58-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	187-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	246-UNIMOD:35	0.05	32.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	299-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	356-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	753-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	44-UNIMOD:21	0.24	32.0	1	1	1
PRT	sp|Q14643-4|ITPR1_HUMAN	Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1703-UNIMOD:21,1730-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1174-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q9H0K1|SIK2_HUMAN	Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	484-UNIMOD:21,495-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	344-UNIMOD:21,242-UNIMOD:21	0.06	32.0	4	2	1
PRT	sp|P00533|EGFR_HUMAN	Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1104-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9H410|DSN1_HUMAN	Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	30-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	235-UNIMOD:4,237-UNIMOD:21,240-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1377-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	623-UNIMOD:4,630-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	155-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	485-UNIMOD:35,501-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	180-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|Q8TEH3-7|DEN1A_HUMAN	Isoform 7 of DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	708-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	541-UNIMOD:21,552-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	464-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	185-UNIMOD:35,186-UNIMOD:21,188-UNIMOD:4	0.10	31.0	1	1	1
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	296-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	448-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	292-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	585-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q5VZ89|DEN4C_HUMAN	DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	690-UNIMOD:35,703-UNIMOD:21	0.01	31.0	1	1	0
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	655-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1098-UNIMOD:28,1111-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	100-UNIMOD:21	0.05	31.0	1	1	0
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	308-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9ULK2-3|AT7L1_HUMAN	Isoform 3 of Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	489-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9Y2J4-3|AMOL2_HUMAN	Isoform 3 of Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	178-UNIMOD:35,183-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1852-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	713-UNIMOD:21,722-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	202-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	74-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q63HR2-2|TNS2_HUMAN	Isoform 2 of Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	999-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P78524|DEN2B_HUMAN	DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	84-UNIMOD:21,92-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	337-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	294-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1358-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	510-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	297-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	214-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	294-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	411-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q5JXC2|MIIP_HUMAN	Migration and invasion-inhibitory protein OS=Homo sapiens OX=9606 GN=MIIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	303-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q6PJG2|MDEAS_HUMAN	Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	461-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	15-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|Q9Y2K7-4|KDM2A_HUMAN	Isoform 4 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	166-UNIMOD:4,176-UNIMOD:21,180-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	294-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q13191|CBLB_HUMAN	E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	885-UNIMOD:21,895-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q5TAQ9-2|DCAF8_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 8 OS=Homo sapiens OX=9606 GN=DCAF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	99-UNIMOD:21	0.08	30.0	1	1	1
PRT	sp|P08559-4|ODPA_HUMAN	Isoform 4 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	331-UNIMOD:21,332-UNIMOD:35	0.04	30.0	2	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	1	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21	ms_run[2]:scan=8358	45.818	3	2671.2239	2671.2239	K	Q	710	737
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	2	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12693	71.74486666666667	3	3072.3929	3072.3933	R	T	553	583
PSM	SHVSSEPYEPISPPQVPVVHEK	3	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:21	ms_run[2]:scan=13787	78.84	3	2521.189	2521.1890	R	Q	2037	2059
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	4	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15185	88.28762333333333	3	3442.4018	3442.4027	K	L	104	135
PSM	HLEHAPSPSDVSNAPEVK	5	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=7954	43.547	2	1992.8942	1992.8942	K	A	439	457
PSM	IHGSGHVEEPASPLAAYQK	6	sp|Q12955|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=8697	47.782	2	2069.9572	2069.9572	K	S	4287	4306
PSM	LKDLGHPVEEEDELESGDQEDEDDESEDPGK	7	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10432	57.763	3	3483.4445	3483.4445	K	D	927	958
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	8	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=9223	50.722	3	2602.1925	2602.1925	R	F	118	143
PSM	KTPSKPPAQLSPSVPK	9	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=6663	36.332	2	1740.9175	1740.9175	K	R	256	272
PSM	PTHHPVSSITGQDFSASTPK	10	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=9436	51.913	3	2172.9841	2172.9841	R	S	1364	1384
PSM	RLSTSPDVIQGHQPR	11	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=7344	40.133	2	1769.8574	1769.8574	R	D	264	279
PSM	HADHSSLTLGSGSSTTR	12	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=4632	25.139	2	1792.7741	1792.7741	R	L	2522	2539
PSM	KEEEEEEEEYDEGSNLKK	13	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5209	28.234	3	2212.9495	2212.9495	K	Q	230	248
PSM	NVGERSPDQSEHTDGHTSVQSVIEK	14	sp|Q8NFZ5-2|TNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=7214	39.42	3	2815.241	2815.2410	R	L	74	99
PSM	RAAEDDEDDDVDTKK	15	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=911	6.594	2	1720.7388	1720.7388	K	Q	89	104
PSM	RRDSLDSSTEASGSDVVLGGR	16	sp|Q9Y2I9|TBC30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=9288	51.082	3	2243.0179	2243.0179	R	S	111	132
PSM	SHVSSEPYEPISPPQVPVVHEK	17	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=13640	77.831	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLGVDMDDKDDAHYAVQAR	18	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:35	ms_run[2]:scan=7806	42.663	2	2120.9433	2120.9433	R	R	410	429
PSM	SPPDQPAVPHPPPSTPIK	19	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=9195	50.574	2	1940.9397	1940.9397	K	L	600	618
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	20	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5956	32.26182333333333	3	3008.169799	3007.187379	K	S	554	579
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	21	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=11640	65.045	3	2956.4332	2956.4332	K	L	117	144
PSM	GESAEDKEHEEGRDSEEGPR	22	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=1127	7.4472	2	2321.9034	2321.9034	K	C	611	631
PSM	KQSLGELIGTLNAAK	23	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=17053	102.44	2	1621.844	1621.8440	R	V	56	71
PSM	KRESESESDETPPAAPQLIK	24	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=9591	52.819	2	2291.0682	2291.0682	R	K	448	468
PSM	PGAEGAPLLPPPLPPPSPPGSGR	25	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=16168	95.532	2	2237.1246	2237.1246	R	G	27	50
PSM	PGAEGAPLLPPPLPPPSPPGSGR	26	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=16445	97.644	2	2237.1246	2237.1246	R	G	27	50
PSM	PTHHPVSSITGQDFSASTPK	27	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=9420	51.826	2	2172.9841	2172.9841	R	S	1364	1384
PSM	RLPQDHADSCVVSSDDEELSR	28	sp|P78317|RNF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=8827	48.52	3	2494.0432	2494.0432	R	D	82	103
PSM	RPASPSSPEHLPATPAESPAQR	29	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=7942	43.487	2	2362.1067	2362.1067	K	F	231	253
PSM	RRSIQDLTVTGTEPGQVSSR	30	sp|O43318-4|M3K7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=9445	51.963	3	2266.1067	2266.1067	R	S	410	430
PSM	RTPTMPQEEAAACPPHILPPEK	31	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12623	71.297	3	2549.1808	2549.1808	R	R	1243	1265
PSM	SLNSTPPPPPAPAPAPPPALAR	32	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=12374	69.638	2	2195.114	2195.1140	R	P	328	350
PSM	SLSSGESGPGSPTHSHSLSPR	33	sp|Q6P0Q8-2|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=5714	30.926	2	2142.9331	2142.9331	R	S	1161	1182
PSM	STAQQELDGKPASPTPVIVASHTANK	34	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=9295	51.117	3	2726.3276	2726.3276	R	E	818	844
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	35	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	13-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=6828	37.29577666666667	3	3008.169616	3007.187379	K	S	554	579
PSM	ADEASEGDSPAPARPEDTPPAPPPPPAR	36	sp|Q6PJ61|FBX46_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=8838	48.585	3	2871.2712	2871.2712	R	D	330	358
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	37	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	28-UNIMOD:21	ms_run[2]:scan=10374	57.393	3	3407.6452	3407.6452	R	N	215	246
PSM	DASDDLDDLNFFNQK	38	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18496	113.6	2	1755.7588	1755.7588	K	K	65	80
PSM	EPRPNSSPSPSPGQASETPHPRPS	39	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=4711	25.614	3	2575.1453	2575.1453	R	-	327	351
PSM	IHEKDPNSATATAPPSPLK	40	sp|Q92766-6|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=6175	33.493	2	2052.9881	2052.9881	K	R	146	165
PSM	KHVTTAEGTPGTTDQEGPPPDGPPEK	41	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=5043	27.365	3	2722.2123	2722.2123	R	R	1497	1523
PSM	KKVEEEDEEEEEEEEEEEEEEDE	42	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7343	40.129	3	2926.0895	2926.0895	R	-	178	201
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	43	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=13066	74.1	3	2662.3156	2662.3156	K	K	763	788
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	44	sp|Q0ZGT2-4|NEXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=5572	30.158	3	3007.1874	3007.1874	K	S	490	515
PSM	KYSDASDCHGEDSQAFCEK	45	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=4738	25.76	3	2232.8688	2232.8688	R	F	271	290
PSM	PGAEGAPLLPPPLPPPSPPGSGR	46	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=16030	94.52	2	2237.1246	2237.1246	R	G	27	50
PSM	RAPSVANVGSHCDLSLK	47	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9846	54.282	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RHSVVAGGGGGEGR	48	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=838	6.3377	2	1374.6154	1374.6154	K	K	961	975
PSM	RTNSDSALHQSTMTPTQPESFSSGSQDVHQK	49	sp|Q6UUV9-3|CRTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=7777	42.501	3	3483.4998	3483.4998	R	R	148	179
PSM	RTPTMPQEEAAACPPHILPPEK	50	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12469	70.267	3	2549.1808	2549.1808	R	R	1243	1265
PSM	TGSGGPGNHPHGPDASAEGLNPYGLVAPR	51	sp|Q86UX7-2|URP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=14124	81.096	3	2861.2882	2861.2882	R	F	478	507
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	52	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=12166	68.339	3	3174.5598	3174.5598	K	N	773	803
PSM	WAHDKFSGEEGEIEDDESGTENR	53	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=11121	61.907	3	2716.0562	2716.0562	K	E	922	945
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	54	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15035	87.27555	3	3444.4072	3442.4022	K	L	104	135
PSM	AAEDDEDDDVDTKK	55	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1251	7.9511	2	1564.6377	1564.6377	R	Q	90	104
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	56	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21	ms_run[2]:scan=6334	34.386	3	2864.2839	2864.2839	R	G	88	119
PSM	DHNEEEGEETGLRDEK	57	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3141	17.416	2	1885.7926	1885.7926	R	P	441	457
PSM	DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK	58	sp|Q15029-3|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=9554	52.602	3	3698.354	3698.3540	K	K	32	64
PSM	FADQDDIGNVSFDR	59	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13279	75.502	2	1597.7009	1597.7009	K	V	489	503
PSM	FASDDEHDEHDENGATGPVK	60	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=3649	19.865	3	2168.8883	2168.8883	K	R	364	384
PSM	GIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAK	61	sp|P08235|MCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:21	ms_run[2]:scan=10897	60.57	3	3649.709	3649.7090	K	E	683	716
PSM	GKDSYETSQLDDQSAETHSHK	62	sp|P10451-3|OSTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=4816	26.162	3	2441.9973	2441.9973	R	Q	194	215
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	63	sp|Q0ZGT2-4|NEXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=5257	28.444	3	3007.1874	3007.1874	K	S	490	515
PSM	PGAEGAPLLPPPLPPPSPPGSGR	64	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=16300	96.547	2	2237.1246	2237.1246	R	G	27	50
PSM	RENPPVEDSSDEDDKR	65	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1586	9.4872	3	1886.8242	1886.8242	K	N	490	506
PSM	RKPEDVLDDDDAGSAPLK	66	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=10157	56.153	2	2019.915	2019.9150	R	S	140	158
PSM	RPASPSSPEHLPATPAESPAQR	67	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=7766	42.439	2	2362.1067	2362.1067	K	F	231	253
PSM	RVIGQDHDFSESSEEEAPAEASSGALR	68	sp|P23497-7|SP100_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=11008	61.229	3	2953.2727	2953.2727	K	S	363	390
PSM	SHSDASVGSHSSTESEHGSSSPR	69	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=876	6.4679	3	2390.9361	2390.9361	R	F	597	620
PSM	SRPFTVAASFQSTSVKSPK	70	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=11432	63.793	3	2104.0354	2104.0354	R	T	588	607
PSM	VIPAKSPPPPTHSTQLGAPSR	71	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=6947	37.94	3	2217.1307	2217.1307	K	K	200	221
PSM	RAAEDDEDDDVDTKK	72	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1165	7.609398333333334	2	1721.740321	1720.738767	K	Q	90	105
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKR	73	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:35,10-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=13099	74.32520833333334	3	3742.562389	3742.565183	R	I	372	405
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	74	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5719	30.953595	3	3008.169088	3007.187379	K	S	554	579
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	75	sp|O60784-3|TOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=12442	70.083	3	2574.2228	2574.2228	K	K	408	434
PSM	AHSLMELSPSAPPGGSPHLDSSR	76	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=10109	55.877	3	2425.0733	2425.0733	K	S	593	616
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	77	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	26-UNIMOD:21	ms_run[2]:scan=6154	33.369	3	2864.2839	2864.2839	R	G	88	119
PSM	APTVPPPLPPTPPQPAR	78	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=12638	71.385	2	1811.9335	1811.9335	R	R	616	633
PSM	AQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	79	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	29-UNIMOD:21	ms_run[2]:scan=12280	69.065	3	3092.4101	3092.4101	R	V	283	316
PSM	HSTPSNSSNPSGPPSPNSPHR	80	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21	ms_run[2]:scan=1732	10.143	2	2219.9345	2219.9345	K	S	1676	1697
PSM	KPASPPLPATQQEKPSQTPEAGR	81	sp|Q6ZU35|CRACD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=6510	35.416	3	2494.2217	2494.2217	R	K	1039	1062
PSM	PHSPLSAHAGNSPQDSPR	82	sp|O15021-2|MAST4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=3300	18.143	2	1933.8432	1933.8432	R	N	52	70
PSM	RGADEDDEKEWGDDEEEQPSK	83	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=5621	30.4	3	2462.9946	2462.9946	K	R	587	608
PSM	RKTMQGEGPQLLLSEAVSR	84	sp|P46379-2|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=14910	86.431	3	2195.077	2195.0770	R	A	1045	1064
PSM	RLSTSPDVIQGHQPR	85	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=7159	39.11	2	1769.8574	1769.8574	R	D	264	279
PSM	RPAEATSSPTSPERPR	86	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=1992	11.388	2	1817.8421	1817.8421	R	H	210	226
PSM	RSPVSPQLQQQHQAAAAAFLQQR	87	sp|Q7Z5Q1-7|CPEB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21	ms_run[2]:scan=12534	70.739	3	2639.3082	2639.3082	R	N	66	89
PSM	RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR	88	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=13241	75.265	3	3354.647	3354.6470	R	-	861	894
PSM	HSTPSNSSNPSGPPSPNSPHR	89	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:21	ms_run[1]:scan=2171	12.296976666666666	3	2220.918366	2219.934537	K	S	1676	1697
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	90	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	28-UNIMOD:21	ms_run[2]:scan=10025	55.368	3	3407.6452	3407.6452	R	N	215	246
PSM	ESEDKPEIEDVGSDEEEEKK	91	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=7002	38.265	3	2399.9741	2399.9741	K	D	251	271
PSM	GPPSPPAPVMHSPSR	92	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5022	27.234	2	1608.712	1608.7120	R	K	221	236
PSM	GPPSPPAPVMHSPSR	93	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=8032	44.017	2	1592.7171	1592.7171	R	K	221	236
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	94	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=13361	76.015	3	3011.3427	3011.3427	R	D	374	402
PSM	HPEPVPEEGSEDELPPQVHKV	95	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=11123	61.919	3	2428.0948	2428.0948	R	-	758	779
PSM	IPSAPVIPTHQASVTTERPK	96	sp|Q9BZF2-2|OSBL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=10558	58.484	3	2208.1304	2208.1304	R	K	224	244
PSM	KIEQVDKEDEITEK	97	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=4761	25.879	2	1702.8625	1702.8625	R	K	444	458
PSM	KKEPAITSQNSPEAR	98	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=2218	12.559	2	1734.8302	1734.8302	K	E	69	84
PSM	KPLTSSSAAPQRPISTQR	99	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=5142	27.871	2	2004.0154	2004.0154	K	T	151	169
PSM	KRSWSSEEESNQATGTSR	100	sp|Q8NFZ0|FBH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=3666	19.966	3	2118.8968	2118.8968	R	W	122	140
PSM	LHSDSGISVDSQSLHDQQPHTQTASGQALK	101	sp|P08138-2|TNR16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:21	ms_run[2]:scan=8674	47.651	3	3251.4844	3251.4844	K	G	207	237
PSM	LKAEPAAPPAAPSTPAPPPAVPK	102	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=9827	54.187	3	2254.1763	2254.1763	R	E	504	527
PSM	PTHHPVSSITGQDFSASTPK	103	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	18-UNIMOD:21	ms_run[2]:scan=8470	46.458	3	2172.9841	2172.9841	R	S	1364	1384
PSM	RKPSVPDSASPADDSFVDPGER	104	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=10570	58.563	3	2408.0645	2408.0645	K	L	18	40
PSM	RNSSEASSGDFLDLK	105	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=13180	74.845	2	1704.7356	1704.7356	R	G	39	54
PSM	RRDSLDSSTEASGSDVVLGGR	106	sp|Q9Y2I9|TBC30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=9255	50.901	2	2243.0179	2243.0179	R	S	111	132
PSM	RRPSGSEQSDNESVQSGR	107	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=970	6.8322	3	2054.8767	2054.8767	K	S	1094	1112
PSM	SAPTAPTPPPPPPPATPR	108	sp|Q14202-2|ZMYM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=8545	46.931	2	1827.892	1827.8921	R	K	799	817
PSM	SEHTVFIMPPEPPPDDGKDLSPK	109	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12875	72.888	3	2628.1819	2628.1819	K	Y	683	706
PSM	SLSSSLQAPVVSTVGMQR	110	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14928	86.536	2	1941.9231	1941.9231	R	L	11	29
PSM	TYFPHFDLSHGSAQVK	111	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=14569	84.132355	2	1912.850648	1912.850914	K	G	42	58
PSM	RANTLSHFPIECQEPPQPAR	112	sp|Q86TI0|TBCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=11944	66.953275	3	2428.110707	2427.115479	R	G	593	613
PSM	TPKDSPGIPPSANAHQLFR	113	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21	ms_run[1]:scan=12269	68.99338333333334	3	2112.012040	2112.015354	K	G	365	384
PSM	AHSLMELSPSAPPGGSPHLDSSR	114	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=10465	57.927	3	2425.0733	2425.0733	K	S	593	616
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	115	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	26-UNIMOD:21	ms_run[2]:scan=10197	56.379	3	3407.6452	3407.6452	R	N	215	246
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	116	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	28-UNIMOD:21	ms_run[2]:scan=10544	58.404	3	3407.6452	3407.6452	R	N	215	246
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	117	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:21	ms_run[2]:scan=11474	64.036	3	2956.4332	2956.4332	K	L	117	144
PSM	EKEISDDEAEEEKGEK	118	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=2943	16.361	2	1943.7885	1943.7885	R	E	222	238
PSM	GPPSPPAPVMHSPSR	119	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=7859	43.001	2	1592.7171	1592.7171	R	K	221	236
PSM	GVVDSDDLPLNVSR	120	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13520	77.079	2	1484.7471	1484.7471	K	E	435	449
PSM	HIKEEPLSEEEPCTSTAIASPEK	121	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10322	57.095	3	2661.1881	2661.1881	K	K	495	518
PSM	HSTPSNSSNPSGPPSPNSPHR	122	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=1877	10.837	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IEDVGSDEEDDSGKDK	123	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=3286	18.077	2	1816.6888	1816.6888	K	K	250	266
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	124	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=12871	72.864	3	3605.6199	3605.6199	K	L	150	183
PSM	KPGDGEVSPSTEDAPFQHSPLGK	125	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=11789	65.975	3	2459.1006	2459.1006	K	A	520	543
PSM	LEQPEEDKYSKPTAPAPSAPPSPSAPEPPK	126	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:21	ms_run[2]:scan=9454	52.01	3	3221.517	3221.5170	K	A	361	391
PSM	MHIEKDETPLSTPTAR	127	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5884	31.87	2	1920.8652	1920.8652	R	D	519	535
PSM	PRPPQSSTGSTASPPVSTPVTGHK	128	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=6827	37.293	3	2452.1748	2452.1748	K	R	139	163
PSM	PRPTEATVSLSSLVDYPHQAR	129	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=16481	97.921	3	2403.1584	2403.1584	R	V	941	962
PSM	RAAEDDEDDDVDTKK	130	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1069	7.2225	3	1720.7388	1720.7388	K	Q	89	104
PSM	RADAGSHTEGSPSQPR	131	sp|Q86V15-2|CASZ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=716	5.8791	2	1731.7326	1731.7326	K	D	47	63
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	132	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=8855	48.692	3	2602.1925	2602.1925	R	F	118	143
PSM	RPSQNAISFFNVGHSK	133	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=13877	79.438	3	1867.873	1867.8730	R	L	187	203
PSM	RTHSEGSLLQEPR	134	sp|P49796-4|RGS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=6242	33.857	2	1588.7359	1588.7359	R	G	659	672
PSM	RTPTMPQEEAAACPPHILPPEK	135	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11018	61.29	3	2565.1757	2565.1757	R	R	1243	1265
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	136	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=9236	50.791	3	3112.5078	3112.5078	R	S	818	847
PSM	TIDLGAAAHYTGDKASPDQNASTHTPQSSVK	137	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=10360	57.318	3	3247.4783	3247.4783	K	T	284	315
PSM	TKPPRPDSPATTPNISVK	138	sp|P32519-2|ELF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:21	ms_run[2]:scan=7455	40.734	2	1984.9983	1984.9983	K	K	156	174
PSM	VKTEPMDADDSNNCTGQNEHQR	139	sp|O43513|MED7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=1134	7.4796	3	2561.0507	2561.0507	R	E	184	206
PSM	YSEKEDKYEEEIK	140	sp|P67936-2|TPM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=5419	29.335	2	1688.7781	1688.7781	K	L	214	227
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	141	sp|Q9Y446|PKP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=10880	60.474333333333334	3	2911.294947	2908.307590	R	P	132	161
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	142	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:21,19-UNIMOD:35	ms_run[1]:scan=7927	43.400945	2	2466.044005	2465.043102	R	A	90	114
PSM	AAPPPPPPPPPLESSPR	143	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=9930	54.787	2	1782.8706	1782.8706	K	V	606	623
PSM	AAPPPPPPPPPLESSPR	144	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=10059	55.547	3	1782.8706	1782.8706	K	V	606	623
PSM	AGSEKDDDSFNLHNSNSTHQER	145	sp|Q86WP2-4|GPBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=4771	25.927	3	2567.031	2567.0310	R	D	149	171
PSM	ALVLIAFAQYLQQCPFEDHVK	146	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=23071	151.56	3	2489.2777	2489.2777	K	L	45	66
PSM	APTVPPPLPPTPPQPAR	147	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=12331	69.371	2	1811.9335	1811.9335	R	R	616	633
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	148	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8146	44.609	3	2465.0431	2465.0431	R	A	90	114
PSM	DADDAVYELDGK	149	sp|Q13243|SRSF5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=10943	60.828	2	1309.5674	1309.5674	R	E	49	61
PSM	DKRPLSGPDVGTPQPAGLASGAK	150	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=9744	53.708	3	2298.1369	2298.1369	R	L	176	199
PSM	DPDAQPGGELMLGGTDSK	151	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:35	ms_run[2]:scan=9802	54.033	2	1802.7993	1802.7993	R	Y	236	254
PSM	EPRPNSSPSPSPGQASETPHPR	152	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=4085	22.263	3	2391.0605	2391.0605	R	P	327	349
PSM	HLEHAPSPSDVSNAPEVK	153	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=8080	44.27	3	1992.8942	1992.8942	K	A	439	457
PSM	HQEVQDQDPVFQGSDSSGYQSDHKK	154	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=7014	38.321	3	2925.2203	2925.2203	K	K	284	309
PSM	HRSSISGSLPSSGSLQAVSSR	155	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=10667	59.156	2	2179.0383	2179.0383	R	F	354	375
PSM	IPSAPVIPTHQASVTTERPK	156	sp|Q9BZF2-2|OSBL7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=10724	59.495	3	2208.1304	2208.1304	R	K	224	244
PSM	KFDHESSPGTDEDKSG	157	sp|Q13427|PPIG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:21	ms_run[2]:scan=1615	9.6085	2	1814.6996	1814.6996	K	-	739	755
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	158	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=10947	60.852	3	2637.3415	2637.3415	R	R	31	56
PSM	KTPSKPPAQLSPSVPK	159	sp|P18887|XRCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=6494	35.323	2	1740.9175	1740.9175	K	R	256	272
PSM	PRPPQSSTGSTASPPVSTPVTGHK	160	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=6657	36.284	3	2452.1748	2452.1748	K	R	139	163
PSM	RESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSR	161	sp|Q14643-4|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21,32-UNIMOD:35	ms_run[2]:scan=11758	65.779	3	3145.3884	3145.3884	R	G	1699	1733
PSM	RHNSASVENVSLR	162	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=5624	30.416	2	1547.7206	1547.7206	K	K	1171	1184
PSM	RHTLSEVTNQLVVMPGAGK	163	sp|Q9H0K1|SIK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12349	69.466	3	2132.0449	2132.0449	R	I	482	501
PSM	RKPSPEPEGEVGPPK	164	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=3945	21.499	2	1682.8029	1682.8029	K	I	341	356
PSM	RKPSVPDSASPADDSFVDPGER	165	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=10336	57.169	3	2408.0645	2408.0645	K	L	18	40
PSM	RPAGSVQNPVYHNQPLNPAPSR	166	sp|P00533|EGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=9043	49.73	3	2478.1918	2478.1918	K	D	1100	1122
PSM	RPASVSSSAAVEHEQR	167	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=3188	17.621	2	1789.8108	1789.8108	K	E	237	253
PSM	RTPTMPQEEAAACPPHILPPEK	168	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11188	62.3	3	2565.1757	2565.1757	R	R	1243	1265
PSM	THDHQLESSLSPVEVFAK	169	sp|Q9H410|DSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=14688	84.947	2	2102.9674	2102.9674	K	T	20	38
PSM	VIPAKSPPPPTHSTQLGAPSR	170	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=6728	36.755	2	2217.1307	2217.1307	K	K	200	221
PSM	HLEHAPSPSDVSNAPEVK	171	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=8127	44.51394833333333	3	1995.922512	1992.894236	K	A	439	457
PSM	DGLHFLPHASSSAQSPCGSPGMK	172	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:4,19-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=11306	62.99	3	2463.0348	2463.0348	R	R	219	242
PSM	DKEVSDDEAEEK	173	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=1241	7.9098	2	1472.5556	1472.5556	R	E	227	239
PSM	FHQLDIDDLQSIR	174	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15659	91.706	2	1598.8053	1598.8053	R	A	59	72
PSM	GPPSPPAPVMHSPSR	175	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=8219	45.031	2	1592.7171	1592.7171	R	K	221	236
PSM	GRPPAEKLSPNPPK	176	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=4415	24.023	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GVVDSDDLPLNVSR	177	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13688	78.16	2	1484.7471	1484.7471	K	E	435	449
PSM	HCAPSPDRSPELSSSR	178	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=3209	17.718	2	1861.7778	1861.7778	R	D	622	638
PSM	HPEPVPEEGSEDELPPQVHK	179	sp|Q7Z3C6-2|ATG9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=9305	51.168	3	2329.0264	2329.0264	R	V	758	778
PSM	HSTPSNSSNPSGPPSPNSPHR	180	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:21	ms_run[2]:scan=2624	14.775	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IEDVGSDEEDDSGKDKK	181	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=2337	13.199	2	1944.7837	1944.7837	K	K	250	267
PSM	KFSGFSAKPNNSGEAPSSPTPK	182	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	18-UNIMOD:21	ms_run[2]:scan=7128	38.971	3	2314.0631	2314.0631	R	R	138	160
PSM	KKEPAITSQNSPEAR	183	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=2024	11.55	2	1734.8302	1734.8302	K	E	69	84
PSM	KMPQLTASAIVSPHGDESPR	184	sp|Q9Y6J9|TAF6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9794	53.994	3	2216.0297	2216.0297	R	G	484	504
PSM	KSPSGPVKSPPLSPVGTTPVK	185	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=9518	52.397	2	2139.1341	2139.1341	R	L	177	198
PSM	KTPELGIVPPPPIPR	186	sp|Q8TEH3-7|DEN1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=15452	90.059	2	1689.9219	1689.9219	R	P	707	722
PSM	KVEEEEDESALKR	187	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3072	17.066	2	1560.7631	1560.7631	R	S	733	746
PSM	KVEEEEDESALKR	188	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=3077	17.087	3	1560.7631	1560.7631	R	S	733	746
PSM	LNHRPSEPELNLNSWPCK	189	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13862	79.333	3	2270.0304	2270.0304	K	S	536	554
PSM	NQTAEKEEFEHQQK	190	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2036	11.608	2	1744.8016	1744.8016	K	E	584	598
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	191	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=9306	51.171	3	2899.3614	2899.3614	K	S	458	487
PSM	RAAEDDEDDDVDTKK	192	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=797	6.1831	3	1720.7388	1720.7388	K	Q	89	104
PSM	RHSSTGDSADAGPPAAGSAR	193	sp|Q6ZU35|CRACD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=1504	9.1037	3	1946.8232	1946.8232	K	G	871	891
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	194	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:35,8-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11269	62.763	3	3241.3594	3241.3594	R	S	179	208
PSM	RKPSPEPEGEVGPPK	195	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=3761	20.494	2	1682.8029	1682.8029	K	I	341	356
PSM	RLSGGSHSYGGESPR	196	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=2854	15.923	2	1625.6947	1625.6947	R	L	294	309
PSM	RLSTSPDVIQGHQPR	197	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=7534	41.155	3	1769.8574	1769.8574	R	D	264	279
PSM	RPAEATSSPTSPERPR	198	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=1783	10.397	2	1817.8421	1817.8421	R	H	210	226
PSM	RPASPSSPEHLPATPAESPAQR	199	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=7619	41.637	3	2362.1067	2362.1067	K	F	231	253
PSM	RTPTMPQEEAAACPPHILPPEK	200	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10847	60.278	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVSEVEEEKEPVPQPLPSDDTR	201	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10233	56.611	3	2615.2116	2615.2116	R	V	446	468
PSM	SSVVSPSHPPPAPPLGSPPGPK	202	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=11524	64.351	2	2168.0667	2168.0667	R	P	292	314
PSM	TKFASDDEHDEHDENGATGPVK	203	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=4255	23.126	3	2477.9973	2477.9973	K	R	362	384
PSM	VPSPHETKPDEDAEAFENHAEK	204	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=8583	47.161	3	2556.0806	2556.0806	K	L	583	605
PSM	SEHTVFIMPPEPPPDDGKDLSPK	205	sp|Q5VZ89|DEN4C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:35,21-UNIMOD:21	ms_run[1]:scan=12716	71.88313333333333	3	2628.179789	2628.181887	K	Y	683	706
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	206	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13933	79.78092833333334	3	3460.414096	3459.429735	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	207	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14847	86.01789166666666	3	3442.4010	3442.4027	K	L	104	135
PSM	AFKPEETSSNSDPPSPPVLNNSHPVPR	208	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21	ms_run[1]:scan=10904	60.605331666666665	3	2981.367667	2979.376381	R	S	641	668
PSM	QPYPSRPPFDNQHSQDLDSR	209	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=11938	66.917	3	2446.0328	2446.0334	K	Q	1098	1118
PSM	KKEPAITSQNSPEAR	210	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=2366	13.37592	2	1734.820923	1734.830179	K	E	90	105
PSM	ALRPGDLPPSPDDVKR	211	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=9006	49.544	3	1811.8931	1811.8931	R	R	299	315
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	212	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	28-UNIMOD:21	ms_run[2]:scan=10710	59.413	3	3407.6452	3407.6452	R	N	215	246
PSM	APSAVSPIPAVIPSPSHKPSK	213	sp|Q9ULK2-3|AT7L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=12307	69.22	3	2146.1188	2146.1188	K	T	476	497
PSM	APSHMSSSHSFPQLAR	214	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=7428	40.593	2	1834.7822	1834.7822	R	N	174	190
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	215	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=11312	63.03	3	2956.4332	2956.4332	K	L	117	144
PSM	ASPGHSPHYFAASSPTSPNALPPAR	216	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=10805	60.009	3	2596.186	2596.1860	R	K	1847	1872
PSM	ATGNDLRPPPPSPSSDLTHPMK	217	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8610	47.305	3	2410.0988	2410.0988	R	T	702	724
PSM	ERDHSPTPSVFNSDEER	218	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=7264	39.713	2	2080.8487	2080.8487	R	Y	414	431
PSM	FSAVKDELPQSPGLIHGR	219	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=12851	72.752	2	2029.9986	2029.9986	R	E	192	210
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	220	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=12302	69.197	3	2649.1708	2649.1708	K	S	61	87
PSM	GPPSPPAPVMHSPSR	221	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5405	29.262	2	1608.712	1608.7120	R	K	221	236
PSM	GRPPAEKLSPNPPK	222	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=4234	23.009	2	1566.7919	1566.7919	R	L	1369	1383
PSM	HLPGPGQQPGPWGPEQASSPAR	223	sp|Q63HR2-2|TNS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	19-UNIMOD:21	ms_run[2]:scan=11596	64.79	3	2330.0593	2330.0593	R	G	981	1003
PSM	HPEPVPEEGSEDELPPQVHKV	224	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=11583	64.712	3	2428.0948	2428.0948	R	-	758	779
PSM	HPPAPSPQNPQDPSPDTSPPTCPFK	225	sp|P78524|DEN2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=10363	57.338	3	2775.2	2775.2000	R	T	71	96
PSM	IGHHSTSDDSSAYR	226	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=1585	9.4848	2	1611.6315	1611.6315	R	S	333	347
PSM	IHIDPEIQDGSPTTSR	227	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=10057	55.535	2	1844.8306	1844.8306	R	R	102	118
PSM	KADTTTPTTIDPIHEPPSLPPEPK	228	sp|O60885-2|BRD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=13583	77.476	3	2661.2939	2661.2939	R	T	291	315
PSM	KHPGGGESDASPEAGSGGGGVALK	229	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=4721	25.666	3	2200.975	2200.9750	K	K	14	38
PSM	KKEPAITSQNSPEAR	230	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=2102	11.944	3	1734.8302	1734.8302	K	E	69	84
PSM	KRPEPSSDYDLSPAK	231	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=5705	30.873	2	1768.8033	1768.8033	R	Q	1347	1362
PSM	LKDLFDYSPPLHK	232	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=14986	86.925	2	1651.8011	1651.8011	K	N	503	516
PSM	LKDLFDYSPPLHK	233	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=15283	88.944	2	1651.8011	1651.8011	K	N	503	516
PSM	LKDQDQDEDEEEKEK	234	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=959	6.7869	2	1876.8174	1876.8174	R	R	182	197
PSM	MGHAGAIIAGGK	235	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=2541	14.363	2	1097.5652	1097.5652	R	G	297	309
PSM	MHIEKDETPLSTPTAR	236	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=8312	45.534	2	1904.8703	1904.8703	R	D	519	535
PSM	NKPGPNIESGNEDDDASFK	237	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=8307	45.511	2	2112.8637	2112.8637	K	I	206	225
PSM	PFSPPIHSSSPPPIAPLAR	238	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=15105	87.78	3	2047.0292	2047.0292	R	A	285	304
PSM	RAAEDDEDDDVDTKK	239	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1399	8.6292	2	1720.7388	1720.7388	K	Q	89	104
PSM	RHSFATEGAGAVENFAAAR	240	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=13302	75.641	3	2040.9167	2040.9167	K	Q	409	428
PSM	RKPSPEPEGEVGPPK	241	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=4554	24.759	2	1682.8029	1682.8029	K	I	341	356
PSM	RKSFDASDTLALPR	242	sp|Q5JXC2|MIIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=11572	64.644	2	1655.8032	1655.8032	R	H	301	315
PSM	RLSTSPDVIQGHQPR	243	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7347	40.149	3	1769.8574	1769.8574	R	D	264	279
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	244	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=9038	49.701	3	2602.1925	2602.1925	R	F	118	143
PSM	RRASQEANLLTLAQK	245	sp|Q6PJG2|MDEAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=11535	64.411	3	1777.92	1777.9200	R	A	458	473
PSM	RRGDSESEEDEQDSEEVR	246	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=2560	14.461	3	2230.8612	2230.8612	R	L	11	29
PSM	RTPTMPQEEAAACPPHILPPEK	247	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11356	63.316	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SASYPCAAPRPGAPETTALHGGFQR	248	sp|Q7Z3C6-2|ATG9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=11454	63.916	3	2678.2061	2678.2061	R	R	698	723
PSM	SCDEPLTPPPHSPTSMLQLIHDPVSPR	249	sp|Q9Y2K7-4|KDM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=15208	88.447	3	3103.4144	3103.4144	R	G	165	192
PSM	SHVSSEPYEPISPPQVPVVHEK	250	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=13481	76.826	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SSWHQSSFHSTR	251	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21	ms_run[2]:scan=4469	24.309	2	1525.61	1525.6100	R	T	288	300
PSM	TPKDSPGIPPSANAHQLFR	252	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=11300	62.955	3	2112.0154	2112.0154	K	G	365	384
PSM	TSQDYDQLPSCSDGSQAPARPPKPR	253	sp|Q13191|CBLB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=8601	47.252	3	2837.244	2837.2440	R	P	885	910
PSM	VHDRSEEEEEEEEEEEEEQPR	254	sp|Q5TAQ9-2|DCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=6051	32.778	3	2751.0305	2751.0305	R	R	95	116
PSM	VIPAKSPPPPTHSTQLGAPSR	255	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=6757	36.926	3	2217.1307	2217.1307	K	K	200	221
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	256	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=12005	67.331	3	3174.5598	3174.5598	K	N	773	803
PSM	YHGHSMSDPGVSYR	257	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3561	19.444	2	1687.645	1687.6450	R	T	327	341
PSM	YHGHSMSDPGVSYR	258	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3753	20.458	2	1687.645	1687.6450	R	T	327	341
PSM	AFKPEETSSNSDPPSPPVLNNSHPVPR	259	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=11428	63.76860166666667	3	2980.359846	2979.376381	R	S	641	668
PSM	HRSSISGSLPSSGSLQAVSSR	260	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=10573	58.578155	3	2179.039728	2179.038274	R	F	354	375
PSM	TPKDSPGIPPSANAHQLFR	261	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=11620	64.92687166666667	2	2113.017465	2112.015354	K	G	365	384
.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=5599	30.284686666666666	2	1553.723477	1553.723923	R	S	288	302
PSM	GRPPAEKLSPNPPK	253	sp|P51531|SMCA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=4234	23.008505	2	1566.791743	1566.791943	R	L	1369	1383
PSM	RKSFDASDTLALPR	254	sp|Q5JXC2|MIIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=11572	64.64432666666667	2	1655.804331	1655.803236	R	H	301	315
PSM	RKPSPEPEGEVGPPK	255	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=4554	24.758895000000003	2	1682.802751	1682.802901	K	I	357	372
PSM	RRDSGDNSAPSGQER	256	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=610	5.467230000000001	2	1710.707203	1710.707104	K	E	73	88
PSM	RPMEEDGEEKSPSK	257	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=656	5.647201666666667	2	1713.689759	1713.691696	K	K	372	386
PSM	KRPEPSSDYDLSPAK	258	sp|Q6W2J9|BCOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=5705	30.87296	2	1768.801625	1768.803295	R	Q	1399	1414
PSM	ALRPGDLPPSPDDVKR	259	sp|O75382|TRIM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=9006	49.54373833333334	3	1811.892065	1811.893113	R	R	418	434
PSM	APSHMSSSHSFPQLAR	260	sp|Q9Y2J4|AMOL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=7428	40.59292166666667	2	1834.781057	1834.782183	R	N	174	190
PSM	VRPASTGGLSLLPPPPGGK	261	sp|Q9NVZ3|NECP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=14467	83.42439499999999	2	1879.993282	1879.992099	R	T	177	196
PSM	MHIEKDETPLSTPTAR	262	sp|Q9UI36|DACH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=8312	45.53426833333334	2	1904.872309	1904.870329	R	D	571	587
PSM	ERDHSPTPSVFNSDEER	263	sp|Q6UN15|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=7264	39.71288	2	2080.847290	2080.848742	R	Y	488	505
PSM	VIPAKSPPPPTHSTQLGAPSR	264	sp|Q14814|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=6757	36.926498333333335	3	2217.130092	2217.130718	K	K	246	267
PSM	ATGNDLRPPPPSPSSDLTHPMK	265	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=8610	47.30475333333333	3	2410.099068	2410.098826	R	T	702	724
PSM	SASYPCAAPRPGAPETTALHGGFQR	266	sp|Q7Z3C6|ATG9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=11454	63.91608666666667	3	2678.207533	2678.206085	R	R	759	784
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	267	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=12005	67.33064333333334	3	3174.559312	3174.559825	K	N	773	803