MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr18.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:21,242-UNIMOD:21	0.08	43.0	5	1	0
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	321-UNIMOD:35,330-UNIMOD:21	0.06	43.0	4	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	830-UNIMOD:21	0.03	43.0	3	2	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,58-UNIMOD:4	0.07	42.0	4	2	1
PRT	sp|Q8IVH8-3|M4K3_HUMAN	Isoform 3 of Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	309-UNIMOD:21	0.04	41.0	3	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1010-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	211-UNIMOD:21	0.10	39.0	6	2	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	43-UNIMOD:21	0.05	39.0	5	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.15	39.0	3	2	1
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	52-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P12931|SRC_HUMAN	Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	17-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|Q96F24-3|NRBF2_HUMAN	Isoform 3 of Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	103-UNIMOD:21	0.10	38.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	38.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	129-UNIMOD:4	0.15	38.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	112-UNIMOD:21,132-UNIMOD:21,120-UNIMOD:21	0.17	38.0	3	2	1
PRT	sp|Q9H0K1|SIK2_HUMAN	Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	484-UNIMOD:21,495-UNIMOD:35	0.02	38.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	266-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2048-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	263-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2535-UNIMOD:21	0.00	37.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:4	0.09	37.0	2	1	0
PRT	sp|P98174|FGD1_HUMAN	FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	48-UNIMOD:21,135-UNIMOD:21	0.05	37.0	2	2	2
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	963-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9H3H1-6|MOD5_HUMAN	Isoform 6 of tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:21	0.15	37.0	1	1	1
PRT	sp|Q8IVL1-4|NAV2_HUMAN	Isoform 4 of Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1680-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	362-UNIMOD:35,363-UNIMOD:21	0.01	37.0	2	1	0
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	635-UNIMOD:21,652-UNIMOD:4,681-UNIMOD:21	0.02	37.0	2	2	2
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	205-UNIMOD:21	0.05	37.0	2	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	725-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	255-UNIMOD:21	0.02	36.0	2	2	2
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	282-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	781-UNIMOD:4	0.01	36.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	34-UNIMOD:21,33-UNIMOD:21,676-UNIMOD:35,680-UNIMOD:21	0.03	36.0	3	2	1
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	337-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	151-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	331-UNIMOD:21,341-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|Q13129|RLF_HUMAN	Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1628-UNIMOD:21,1641-UNIMOD:4,1642-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|Q8N5C8-2|TAB3_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	102-UNIMOD:21,103-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	134-UNIMOD:21,157-UNIMOD:35	0.04	36.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1862-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	635-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	618-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	474-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q2NKJ3-2|CTC1_HUMAN	Isoform 2 of CST complex subunit CTC1 OS=Homo sapiens OX=9606 GN=CTC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	671-UNIMOD:4,678-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	637-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	486-UNIMOD:21,487-UNIMOD:35,483-UNIMOD:21	0.03	35.0	3	1	0
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase 2B1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	332-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	21-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	336-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8IXJ6-5|SIR2_HUMAN	Isoform 5 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	298-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	411-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q16473|TENXA_HUMAN	Putative tenascin-XA OS=Homo sapiens OX=9606 GN=TNXA PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	138-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	328-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	244-UNIMOD:28,250-UNIMOD:35,251-UNIMOD:35,264-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	100-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	181-UNIMOD:4	0.07	33.0	2	1	0
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|P10451-3|OSTP_HUMAN	Isoform C of Osteopontin OS=Homo sapiens OX=9606 GN=SPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	207-UNIMOD:21	0.08	33.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	193-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	435-UNIMOD:21,440-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	200-UNIMOD:21	0.11	33.0	1	1	1
PRT	sp|P21860-5|ERBB3_HUMAN	Isoform 5 of Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	339-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1174-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:21	0.12	33.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q96RU3|FNBP1_HUMAN	Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	308-UNIMOD:21,307-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	619-UNIMOD:21,620-UNIMOD:21	0.01	32.0	3	1	0
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	113-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	802-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	118-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	79-UNIMOD:21,75-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|O00712-6|NFIB_HUMAN	Isoform 6 of Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	76-UNIMOD:21,74-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	470-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9UIS9-4|MBD1_HUMAN	Isoform 4 of Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	297-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	181-UNIMOD:21,185-UNIMOD:35,188-UNIMOD:4	0.10	32.0	1	1	1
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	34-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	805-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1117-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	366-UNIMOD:21	0.06	32.0	2	2	2
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	626-UNIMOD:21	0.05	32.0	2	2	2
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	799-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	167-UNIMOD:28,181-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	587-UNIMOD:21,591-UNIMOD:21,597-UNIMOD:21,611-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q15029-3|U5S1_HUMAN	Isoform 3 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	36-UNIMOD:35,55-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	575-UNIMOD:21	0.01	31.0	3	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	189-UNIMOD:35,191-UNIMOD:21,194-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1690-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	510-UNIMOD:21,283-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	214-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	596-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q13563-2|PKD2_HUMAN	Isoform 2 of Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	164-UNIMOD:4,166-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	344-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q14686|NCOA6_HUMAN	Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	2018-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P26358-2|DNMT1_HUMAN	Isoform 2 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	122-UNIMOD:35,133-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	864-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	328-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	272-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P78316|NOP14_HUMAN	Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	312-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	873-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	30.0	1	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	246-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:4,420-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1233-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|P52746|ZN142_HUMAN	Zinc finger protein 142 OS=Homo sapiens OX=9606 GN=ZNF142 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1319-UNIMOD:21,1330-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	966-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9UMN6|KMT2B_HUMAN	Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1836-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	218-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q96NB3|ZN830_HUMAN	Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	437-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	297-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q5TC79|ZBT37_HUMAN	Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	455-UNIMOD:4,465-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	436-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	742-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	168-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1176-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1161-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	1278-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9H4G0-4|E41L1_HUMAN	Isoform 4 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	406-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8TC05-4|MDM1_HUMAN	Isoform 4 of Nuclear protein MDM1 OS=Homo sapiens OX=9606 GN=MDM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	508-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	179-UNIMOD:21	0.11	30.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	263-UNIMOD:35,264-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	447-UNIMOD:21,453-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	597-UNIMOD:21,605-UNIMOD:35,607-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q9ULK2-3|AT7L1_HUMAN	Isoform 3 of Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	481-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	637-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q99795|GPA33_HUMAN	Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	469-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|O95425-4|SVIL_HUMAN	Isoform SV4 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	259-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	445-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P36873|PP1G_HUMAN	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	307-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:21	0.24	29.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	215-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	27-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q9UBF8-3|PI4KB_HUMAN	Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	179-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	43-UNIMOD:21,54-UNIMOD:4	0.04	29.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	236-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	915-UNIMOD:21,924-UNIMOD:35,929-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	114-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	905-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	616-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q9ULL8-2|SHRM4_HUMAN	Isoform 2 of Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	377-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	2191-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q5TAQ9-2|DCAF8_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 8 OS=Homo sapiens OX=9606 GN=DCAF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	99-UNIMOD:21	0.08	29.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	29.0	1	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	53-UNIMOD:21	0.12	29.0	1	1	1
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	369-UNIMOD:35,375-UNIMOD:21	0.02	29.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	1	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	26-UNIMOD:21	ms_run[2]:scan=9999	58.351	3	3407.6452	3407.6452	R	N	215	246
PSM	HTFMGVVSLGSPSGEVSHPR	2	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11132	65.466	2	2175.9773	2175.9773	R	K	318	338
PSM	STAQQELDGKPASPTPVIVASHTANK	3	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=9419	54.697	3	2726.3276	2726.3276	R	E	818	844
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	4	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	28-UNIMOD:21	ms_run[2]:scan=9677	56.341	3	3407.6452	3407.6452	R	N	215	246
PSM	VHTECCHGDLLECADDR	5	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6568	37.729	2	2085.8303	2085.8303	K	A	265	282
PSM	GHVAHLEDDEGDDDESK	6	sp|Q8IVH8-3|M4K3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=2228	12.668	2	1866.7504	1866.7504	R	H	386	403
PSM	SGPKPFSAPKPQTSPSPK	7	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=5819	33.197	2	1916.9397	1916.9397	R	R	294	312
PSM	VHTECCHGDLLECADDR	8	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7163	41.254	2	2085.8303	2085.8303	K	A	265	282
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	9	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:21	ms_run[2]:scan=15763	98.715	3	2618.3622	2618.3622	R	S	989	1017
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	10	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	28-UNIMOD:21	ms_run[2]:scan=9839	57.347	3	3407.6452	3407.6452	R	N	215	246
PSM	LLKPGEEPSEYTDEEDTKDHNK	11	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=6362	36.434	3	2653.1433	2653.1433	R	Q	200	222
PSM	PGAEGAPLLPPPLPPPSPPGSGR	12	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=15579	97.283	2	2237.1246	2237.1246	R	G	27	50
PSM	RAAEDDEDDDVDTKK	13	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1013	6.9293	2	1720.7388	1720.7388	K	Q	89	104
PSM	RPDHSGGSPSPPTSEPAR	14	sp|Q8TAD8|SNIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=1902	11.021	2	1910.8272	1910.8272	R	S	45	63
PSM	SLEPAENVHGAGGGAFPASQTPSKPASADGHR	15	sp|P12931|SRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=8669	50.182	3	3179.4422	3179.4422	R	G	17	49
PSM	SETAPAETATPAPVEKSPAK	16	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6994	40.308365	2	2102.9782	2102.9768	M	K	2	22
PSM	DAAAHLQTSHKPSAEDAEGQSPLSQK	17	sp|Q96F24-3|NRBF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:21	ms_run[2]:scan=6152	35.179	3	2782.2559	2782.2559	K	Y	83	109
PSM	GHLSRPEAQSLSPYTTSANR	18	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=8346	48.3	2	2251.0383	2251.0383	R	A	251	271
PSM	GHLSRPEAQSLSPYTTSANR	19	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=8425	48.738	3	2251.0383	2251.0383	R	A	251	271
PSM	HIKEEPLSEEEPCTSTAIASPEK	20	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9774	56.942	3	2661.1881	2661.1881	K	K	495	518
PSM	HPHDIIDDINSGAVECPAS	21	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:4	ms_run[2]:scan=12875	76.816	2	2045.9113	2045.9113	R	-	114	133
PSM	HTFMGVVSLGSPSGEVSHPR	22	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11248	66.257	3	2175.9773	2175.9773	R	K	318	338
PSM	IHIDPEIQDGSPTTSR	23	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=9542	55.421	2	1844.8306	1844.8306	R	R	102	118
PSM	RHTLSEVTNQLVVMPGAGK	24	sp|Q9H0K1|SIK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11756	69.623	3	2132.0449	2132.0449	R	I	482	501
PSM	RLSTSPDVIQGHQPR	25	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6861	39.453	2	1769.8574	1769.8574	R	D	264	279
PSM	SHVSSEPYEPISPPQVPVVHEK	26	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=13135	78.622	3	2521.189	2521.1890	R	Q	2037	2059
PSM	ESEDKPEIEDVGSDEEEEK	27	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7729	44.575	2	2271.8792	2271.8792	K	K	251	270
PSM	HADHSSLTLGSGSSTTR	28	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=4405	24.887	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HELQANCYEEVKDR	29	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=5326	30.339	2	1789.8053	1789.8053	K	C	133	147
PSM	RGSGSALGGPLDPQFVGPSDTSLGAAPGHR	30	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=14673	90.139	3	2940.3879	2940.3879	R	V	46	76
PSM	RHSVVAGGGGGEGR	31	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=858	6.3818	2	1374.6154	1374.6154	K	K	961	975
PSM	RLDSDAVNTIESQSVSPDHNKEPK	32	sp|Q9H3H1-6|MOD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=9506	55.21	3	2745.2607	2745.2607	R	E	124	148
PSM	RQHSSDSVSSINSATSHSSVGSNIESDSK	33	sp|Q8IVL1-4|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=7478	43.063	3	3069.3273	3069.3273	R	K	1676	1705
PSM	SHHAPMSPGSSGGGGQPLAR	34	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2540	14.33	3	1982.8418	1982.8418	R	T	357	377
PSM	SVEDVRPHHTDANNQSACFEAPDQK	35	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6872	39.518	3	2931.2243	2931.2243	R	T	635	660
PSM	VIPAKSPPPPTHSTQLGAPSR	36	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=6335	36.287	3	2217.1307	2217.1307	K	K	200	221
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	37	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=7891	45.562	3	2671.2239	2671.2239	K	Q	710	737
PSM	IEDVGSDEEDDSGK	38	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=3904	22.058	2	1573.5669	1573.5669	K	D	250	264
PSM	KPSPSESPEPWKPFPAVSPEPR	39	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=13851	84.004	3	2525.1992	2525.1992	R	R	280	302
PSM	KQELEEICHDLEAR	40	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4	ms_run[2]:scan=11959	70.956	2	1768.8414	1768.8414	K	V	774	788
PSM	LHDFLAHSSEESEETSSPPR	41	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=8835	51.187	3	2333.9801	2333.9801	K	L	18	38
PSM	LRGTQEVAPPTPLTPTSHTANTSPR	42	sp|P48730-2|KC1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=9125	52.895	3	2708.3283	2708.3283	R	P	334	359
PSM	PRPPQSSTGSTASPPVSTPVTGHK	43	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=6478	37.201	3	2452.1748	2452.1748	K	R	139	163
PSM	RAAEDDEDDDVDTKK	44	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1007	6.9084	3	1720.7388	1720.7388	K	Q	89	104
PSM	RRGSDIDNPTLTVMDISPPSR	45	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12075	71.664	3	2422.1312	2422.1312	R	S	328	349
PSM	SHHAPMSPGSSGGGGQPLAR	46	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=4879	27.717	3	1966.8469	1966.8469	R	T	357	377
PSM	TEHSHSPGDSSAPIQNTDCCHSSER	47	sp|Q13129|RLF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4	ms_run[2]:scan=2650	15.073	3	2875.0923	2875.0923	R	D	1623	1648
PSM	TLVHSSSDGHIDPQHAAGK	48	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=4548	25.708	3	2035.9113	2035.9113	R	Q	97	116
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	49	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=9990	58.29842666666667	3	2909.293247	2908.307590	R	P	132	161
PSM	ASPGHSPHYFAASSPTSPNALPPAR	50	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=9842	57.362	3	2596.186	2596.1860	R	K	1847	1872
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	51	sp|Q93074-3|MED12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=14552	89.2	3	2781.2072	2781.2072	R	E	622	648
PSM	LKSEDELRPEVDEHTQK	52	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=6030	34.458	2	2131.9787	2131.9787	R	T	616	633
PSM	MPGMSPANPSLHSPVPDASHSPR	53	sp|O60244|MED14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7142	41.15	3	2480.0614	2480.0614	R	A	1124	1147
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	54	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=8523	49.304	3	2899.3614	2899.3614	K	S	458	487
PSM	PCLHSATPSTPQTDPTGPEGPHLGQSR	55	sp|Q2NKJ3-2|CTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=8592	49.74	3	2904.2862	2904.2862	R	L	670	697
PSM	RLSESLHVVDENKNESK	56	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=7217	41.528	2	2062.9685	2062.9685	R	L	633	650
PSM	SGPKPFSAPKPQTSPSPK	57	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=5649	32.188	2	1916.9397	1916.9397	R	R	294	312
PSM	VERPPSPFSMAPQASLPPVPPR	58	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14607	89.615	3	2452.1974	2452.1974	K	L	478	500
PSM	EPRPNSSPSPSPGQASETPHPRPS	59	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=4380	24.766	3	2575.1453	2575.1453	R	-	327	351
PSM	HELQANCYEEVKDR	60	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:4	ms_run[2]:scan=5325	30.337	3	1789.8053	1789.8053	K	C	133	147
PSM	HTFMGVVSLGSPSGEVSHPR	61	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=13645	82.437	3	2159.9823	2159.9823	R	K	318	338
PSM	KQSLGELIGTLNAAK	62	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=16196	102.02	2	1621.844	1621.8440	R	V	19	34
PSM	RDSSHNELYYEEAEHER	63	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=7233	41.613	3	2242.8917	2242.8917	R	R	334	351
PSM	REHASIDAQSGAGVPNPSTSASPK	64	sp|Q8IXJ6-5|SIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	22-UNIMOD:21	ms_run[2]:scan=6382	36.563	3	2443.1129	2443.1129	R	K	277	301
PSM	RENPPVEDSSDEDDKR	65	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1546	9.3132	2	1886.8242	1886.8242	K	N	490	506
PSM	RHSFATEGAGAVENFAAAR	66	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=12692	75.691	3	2040.9167	2040.9167	K	Q	409	428
PSM	RLGPLSAEGTTGLAPAGQTSEESRPR	67	sp|Q16473|TENXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:21	ms_run[2]:scan=10631	62.316	3	2717.3134	2717.3134	K	L	120	146
PSM	SLNSTPPPPPAPAPAPPPALAR	68	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=11766	69.686	2	2195.114	2195.1140	R	P	328	350
PSM	VERPPSPFSMAPQASLPPVPPR	69	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14457	88.525	3	2452.1974	2452.1974	K	L	478	500
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	70	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:28,7-UNIMOD:35,8-UNIMOD:35,21-UNIMOD:21	ms_run[1]:scan=11595	68.54539	3	2700.1010	2700.0980	R	G	244	269
PSM	ALQHTESPSETNKPHSK	71	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=918	6.5947	2	1969.8895	1969.8895	K	S	94	111
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	72	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	28-UNIMOD:21	ms_run[2]:scan=9357	54.323	3	3407.6452	3407.6452	R	N	215	246
PSM	DPDDHTVCHLLFANQTEK	73	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:4	ms_run[2]:scan=12915	77.077	2	2138.9691	2138.9691	K	D	174	192
PSM	DVDDGSGSPHSPHQLSSK	74	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2626	14.927	2	1848.8238	1848.8238	R	S	1615	1633
PSM	GKDSYETSQLDDQSAETHSHK	75	sp|P10451-3|OSTP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21	ms_run[2]:scan=4244	24.029	3	2441.9973	2441.9973	R	Q	194	215
PSM	GVVDSDDLPLNVSR	76	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12887	76.891	2	1484.7471	1484.7471	K	E	435	449
PSM	HAPSLHGSTELLPLSR	77	sp|Q9H5N1-2|RABE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=12056	71.557	3	1793.8825	1793.8825	R	D	186	202
PSM	HASSSPESPKPAPAPGSHR	78	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1277	8.0286	2	2055.8565	2055.8565	R	E	433	452
PSM	HTFMGVVSLGSPSGEVSHPR	79	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11097	65.256	3	2175.9773	2175.9773	R	K	318	338
PSM	IEDVGSDEEDDSGKDK	80	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=3199	18.145	2	1816.6888	1816.6888	K	K	250	266
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	81	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	23-UNIMOD:21	ms_run[2]:scan=9137	52.971	3	3290.5973	3290.5973	K	E	178	210
PSM	PGAEGAPLLPPPLPPPSPPGSGR	82	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:21	ms_run[2]:scan=15713	98.326	2	2237.1246	2237.1246	R	G	27	50
PSM	RESGPGIAPGPEPHGLTNK	83	sp|P21860-5|ERBB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=7269	41.804	3	1992.9419	1992.9419	K	K	337	356
PSM	RHNSASVENVSLR	84	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21	ms_run[2]:scan=5360	30.529	2	1547.7206	1547.7206	K	K	1171	1184
PSM	SGSSHAPQDVSLSYPQHHVGNSSPTSTSPSR	85	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	22-UNIMOD:21	ms_run[2]:scan=7782	44.913	3	3270.4327	3270.4327	R	Y	86	117
PSM	SKDQDDQKPGPSER	86	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=650	5.5743	2	1585.7332	1585.7332	K	S	467	481
PSM	VERPPSPFSMAPQASLPPVPPR	87	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14186	86.508	3	2452.1974	2452.1974	K	L	478	500
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	88	sp|Q96RU3|FNBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=12471	74.21389166666667	3	3280.586357	3279.599916	K	Q	330	362
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	89	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=10154	59.31495166666667	3	2909.292365	2908.307590	R	P	132	161
PSM	SGPKPFSAPKPQTSPSPK	90	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=4532	25.598953333333334	2	1917.944769	1916.939729	R	R	295	313
PSM	AAEDDEDDDVDTKK	91	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=1213	7.7677	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAPPPPPPPPPLESSPR	92	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=9539	55.407	2	1782.8706	1782.8706	K	V	606	623
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	93	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	26-UNIMOD:21	ms_run[2]:scan=5779	32.95	3	2864.2839	2864.2839	R	G	88	119
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	94	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	26-UNIMOD:21	ms_run[2]:scan=9526	55.336	3	3407.6452	3407.6452	R	N	215	246
PSM	APVHFVEPLSPTGVAGHR	95	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=12408	73.805	2	1949.9513	1949.9513	K	K	793	811
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	96	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=10916	64.063	3	2956.4332	2956.4332	K	L	117	144
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	97	sp|Q93074-3|MED12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=14412	88.188	3	2781.2072	2781.2072	R	E	622	648
PSM	KKEPAITSQNSPEAR	98	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=1974	11.355	3	1734.8302	1734.8302	K	E	69	84
PSM	KPEKPLFSSASPQDSSPR	99	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=6881	39.572	3	2036.9568	2036.9568	K	L	66	84
PSM	KTHSAASSSQGASVNPEPLHSSLDK	100	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21	ms_run[2]:scan=6586	37.833	3	2614.2024	2614.2024	R	L	467	492
PSM	LLKPGEEPSEYTDEEDTKDHNK	101	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:21	ms_run[2]:scan=6689	38.457	3	2653.1433	2653.1433	R	Q	200	222
PSM	PGAEGAPLLPPPLPPPSPPGSGR	102	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	17-UNIMOD:21	ms_run[2]:scan=15321	95.258	2	2237.1246	2237.1246	R	G	27	50
PSM	PGAQPLPPPPPSQSPEPTEPHPR	103	sp|Q9UIS9-4|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21	ms_run[2]:scan=8272	47.846	3	2489.174	2489.1740	R	A	284	307
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	104	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,7-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=10714	62.841	3	3241.3594	3241.3594	R	S	179	208
PSM	RKTDTVVESSVSGDHSGTLR	105	sp|Q9NXL2-1|ARH38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=5677	32.359	3	2210.0329	2210.0329	R	R	32	52
PSM	RNDHDDDEDEEVISK	106	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3083	17.547	2	1814.7555	1814.7555	K	T	341	356
PSM	SAPTAPTPPPPPPPATPR	107	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=7867	45.411	2	1827.892	1827.8921	R	K	799	817
PSM	SGPKPFSAPKPQTSPSPK	108	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:21	ms_run[2]:scan=4502	25.416	2	1916.9397	1916.9397	R	R	294	312
PSM	SHSGVSENDSRPASPSAESDHESER	109	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=2227	12.665	3	2733.09	2733.0900	R	G	1112	1137
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	110	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=8969	51.971	3	3112.5078	3112.5078	R	S	818	847
PSM	TKFASDDEHDEHDENGATGPVK	111	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=4102	23.192	3	2477.9973	2477.9973	K	R	362	384
PSM	TLVHSSSDGHIDPQHAAGK	112	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=4467	25.22	2	2035.9113	2035.9113	R	Q	97	116
PSM	VETLKEEEEELKR	113	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8302	48.032	2	1630.8414	1630.8414	K	K	188	201
PSM	VLTPPHDVDSLPHLR	114	sp|Q9P1Y5|CAMP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=13758	83.269	3	1774.8767	1774.8767	R	K	797	812
PSM	QHEAPSNRPLNELLTPQGPSPR	115	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=12586	74.98614833333333	3	2500.1879	2500.1855	R	T	167	189
PSM	SKKASGSGGGSAALGPSGFGPSGGSGTK	116	sp|P25440|BRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1864	10.83438	3	2669.994282	2670.016640	K	L	587	615
PSM	AGIPQHHPPMAQNLQYPDDSDDEK	117	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=8312	48.089	3	2798.1643	2798.1643	K	K	403	427
PSM	DLDDIEDENEQLK	118	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11017	64.714	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK	119	sp|Q15029-3|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:35,24-UNIMOD:35	ms_run[2]:scan=9064	52.529	3	3698.354	3698.3540	K	K	32	64
PSM	FPPEDFRHSPEDFR	120	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=11587	68.494	2	1854.7727	1854.7727	R	R	567	581
PSM	FPPEDFRHSPEDFR	121	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=11739	69.509	2	1854.7727	1854.7727	R	R	567	581
PSM	HAIMRSPQMVSAIVR	122	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,6-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=6619	38.023	2	1806.8634	1806.8634	R	T	186	201
PSM	HSTPSNSSNPSGPPSPNSPHR	123	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	15-UNIMOD:21	ms_run[2]:scan=1673	9.9209	2	2219.9345	2219.9345	K	S	1676	1697
PSM	KEEEEEEEEYDEGSNLKK	124	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=4965	28.242	3	2212.9495	2212.9495	K	Q	230	248
PSM	KKEPAITSQNSPEAR	125	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=1771	10.412	2	1734.8302	1734.8302	K	E	69	84
PSM	KLNYEENKEESLLEK	126	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8639	50.016	3	1864.9418	1864.9418	K	R	467	482
PSM	LHDFLAHSSEESEETSSPPR	127	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	16-UNIMOD:21	ms_run[2]:scan=8864	51.346	2	2333.9801	2333.9801	K	L	18	38
PSM	LKDLFDYSPPLHK	128	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:21	ms_run[2]:scan=14403	88.111	2	1651.8011	1651.8011	K	N	503	516
PSM	LLKPGEEPSEYTDEEDTK	129	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=8259	47.77	3	2158.9195	2158.9195	R	D	200	218
PSM	LLKPGEEPSEYTDEEDTKDHNK	130	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=6519	37.444	3	2653.1433	2653.1433	R	Q	200	222
PSM	NKPGPNIESGNEDDDASFK	131	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=7878	45.482	2	2112.8637	2112.8637	K	I	206	225
PSM	PGAQPLPPPPPSQSPEPTEPHPR	132	sp|Q9UIS9-4|MBD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=8500	49.157	3	2489.174	2489.1740	R	A	284	307
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	133	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=11187	65.86	3	3239.3932	3239.3932	R	L	585	614
PSM	REDQGPPCPSPVGGGDPLHR	134	sp|Q13563-2|PKD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=7922	45.771	3	2206.9579	2206.9579	R	H	157	177
PSM	RKPSPEPEGEVGPPK	135	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=3871	21.862	2	1682.8029	1682.8029	K	I	341	356
PSM	RNSRTEEPTVASESVENGHR	136	sp|Q14686|NCOA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=4269	24.182	3	2334.035	2334.0350	R	K	2016	2036
PSM	RRGSDIDNPTLTVMDISPPSR	137	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11915	70.655	3	2422.1312	2422.1312	R	S	328	349
PSM	RVGMADANSPPKPLSK	138	sp|P26358-2|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=4146	23.473	2	1762.8437	1762.8437	R	P	119	135
PSM	RVSLEPHQGPGTPESK	139	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:21	ms_run[2]:scan=4169	23.601	2	1797.8411	1797.8411	K	K	853	869
PSM	SPSPPLPTHIPPEPPR	140	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=11597	68.558	3	1797.8815	1797.8815	R	T	326	342
PSM	SVSHGSNHTQKPDEQR	141	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=595	5.3613	2	1885.8068	1885.8068	R	S	681	697
PSM	VHTECCHGDLLECADDR	142	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6542	37.569	3	2085.8303	2085.8303	K	A	265	282
PSM	VLQHYQESDKGEELGPGNVQK	143	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6777	38.968	3	2354.1503	2354.1503	K	E	91	112
PSM	VSKPSQLQAHTPASQQTPPLPPYASPR	144	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:21	ms_run[2]:scan=10699	62.751	3	2962.4702	2962.4702	K	S	250	277
PSM	YSPSQNSPIHHIPSR	145	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=7634	43.995	2	1798.8152	1798.8152	R	R	282	297
PSM	HMSADDLNDGFVLDKDDR	146	sp|P78316|NOP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:35	ms_run[1]:scan=10484	61.43447833333333	3	2077.894005	2077.901098	K	R	311	329
PSM	QRDEDDEAYGKPVK	147	sp|Q53GD3|CTL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1899	11.006518333333334	2	1648.770286	1648.769279	K	Y	5	19
PSM	RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR	148	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=12264	72.86057666666667	3	3354.649146	3354.647017	R	-	861	894
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	149	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	26-UNIMOD:21	ms_run[2]:scan=5958	34.014	3	2864.2839	2864.2839	R	G	88	119
PSM	APTVPPPLPPTPPQPAR	150	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=11559	68.336	2	1811.9335	1811.9335	R	R	616	633
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	151	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12601	75.094	3	3459.4297	3459.4297	K	L	104	135
PSM	DPDAQPGGELMLGGTDSK	152	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:35	ms_run[2]:scan=9302	53.983	2	1802.7993	1802.7993	R	Y	236	254
PSM	EEDCHSPTSKPPKPDQPLK	153	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=3624	20.472	2	2269.0086	2269.0086	K	V	415	434
PSM	ERGSDASGQLFHGR	154	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=5796	33.047	2	1595.6842	1595.6842	R	A	1230	1244
PSM	FADQDDIGNVSFDR	155	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12638	75.332	2	1597.7009	1597.7009	K	V	489	503
PSM	FNLTYVSHDGDDKK	156	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8273	47.85	2	1637.7686	1637.7686	R	R	571	585
PSM	GDDGIFDDNFIEER	157	sp|O60493-2|SNX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16191	101.98	2	1640.6954	1640.6954	R	K	73	87
PSM	GPPSPPAPVMHSPSR	158	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5086	28.974	2	1608.712	1608.7120	R	K	221	236
PSM	HPEPAQPAPGSPAETTEGPLHCSR	159	sp|P52746|ZN142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=7333	42.206	3	2602.1272	2602.1272	R	C	1309	1333
PSM	HSPAPPPDPGFPAPSPPPADSPSEGFSLK	160	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:21	ms_run[2]:scan=14826	91.308	3	2959.343	2959.3430	R	A	952	981
PSM	HSPIQNLDPPLRPDSGSAPPPAPR	161	sp|Q9UMN6|KMT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:21	ms_run[2]:scan=10893	63.934	3	2595.2595	2595.2595	R	S	1835	1859
PSM	IYHLPDAESDEDEDFKEQTR	162	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=11684	69.134	3	2516.0381	2516.0381	K	L	210	230
PSM	KAPDADDQDVKR	163	sp|Q96NB3|ZN830_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=915	6.5842	2	1356.6634	1356.6634	R	A	104	116
PSM	KHPGGGESDASPEAGSGGGGVALK	164	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=4471	25.24	3	2200.975	2200.9750	K	K	14	38
PSM	KIPVFHNGSTPTLGETPK	165	sp|Q9Y6M7-11|S4A7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=10993	64.551	2	2001.9925	2001.9925	R	E	429	447
PSM	KPEKPLFSSASPQDSSPR	166	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=6785	39.006	2	2036.9568	2036.9568	K	L	66	84
PSM	KQELEEICHDLEAR	167	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=11926	70.72	3	1768.8414	1768.8414	K	V	774	788
PSM	LHEDDKEQDIADK	168	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2268	12.886	2	1554.7162	1554.7162	R	M	1113	1126
PSM	MGHAGAIIAGGK	169	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:35	ms_run[2]:scan=2449	13.853	2	1097.5652	1097.5652	R	G	297	309
PSM	NHPGCIPLEGPHSISPETTVTSR	170	sp|Q5TC79|ZBT37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=11629	68.784	3	2565.1683	2565.1683	K	G	451	474
PSM	NVAEALGHSPKDPGGGGGPVR	171	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=7275	41.837	3	2050.9586	2050.9586	K	A	428	449
PSM	PGAEGAPLLPPPLPPPSPPGSGR	172	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:21	ms_run[2]:scan=15449	96.277	2	2237.1246	2237.1246	R	G	27	50
PSM	PLPTLEVKPPDRPSSK	173	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=11099	65.267	2	1839.9496	1839.9496	R	S	729	745
PSM	PYHPPPLFPPSPQPPDSTPR	174	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=13510	81.368	3	2303.0776	2303.0776	R	Q	158	178
PSM	RGESLDNLDSPR	175	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=7006	40.371	2	1437.6249	1437.6249	R	S	1173	1185
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	176	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:21	ms_run[2]:scan=8208	47.492	3	2602.1925	2602.1925	R	F	118	143
PSM	RRPESAPAESSPSK	177	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=803	6.1773	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RSSLPLDHGSPAQENPESEK	178	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7164	41.257	3	2257.0012	2257.0012	R	S	1276	1296
PSM	SLDGAEFSRPASVSENHDAGPDGDKR	179	sp|Q9H4G0-4|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=8185	47.358	3	2793.1991	2793.1991	R	D	399	425
PSM	SLEPAENVHGAGGGAFPASQTPSKPASADGHR	180	sp|P12931|SRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:21	ms_run[2]:scan=8838	51.202	3	3179.4422	3179.4422	R	G	17	49
PSM	STAQQELDGKPASPTPVIVASHTANK	181	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=8839	51.205	3	2726.3276	2726.3276	R	E	818	844
PSM	THHDLTTPAVGGAVLVSPSK	182	sp|Q8TC05-4|MDM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:21	ms_run[2]:scan=10523	61.653	3	2066.0198	2066.0198	R	M	492	512
PSM	VIPAKSPPPPTHSTQLGAPSR	183	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=6494	37.294	3	2217.1307	2217.1307	K	K	200	221
PSM	VLATEDRSDHLIQTDTVNLHR	184	sp|P51151|RAB9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=10518	61.619	3	2512.2071	2512.2071	R	K	172	193
PSM	YHGHSMSDPGVSYR	185	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=3276	18.528	2	1687.645	1687.6450	R	T	258	272
PSM	TKPTQAAGPSSPQKPPTPEETK	186	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=3993	22.55647833333333	3	2437.103379	2436.097503	K	A	437	459
PSM	RNSRTEEPTVASESVENGHR	187	sp|Q14686|NCOA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=4300	24.357583333333334	3	2335.020469	2334.034980	R	K	2016	2036
PSM	SGPKPFSAPKPQTSPSPK	188	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=6108	34.91377833333333	2	1917.925891	1916.939729	R	R	295	313
PSM	AAPPPPPPPPPLESSPR	189	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=9374	54.415	3	1782.8706	1782.8706	K	V	606	623
PSM	AAPPPPPPPPPLESSPR	190	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=9696	56.451	3	1782.8706	1782.8706	K	V	606	623
PSM	AGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMR	191	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:21,29-UNIMOD:35,31-UNIMOD:35	ms_run[2]:scan=11065	65.04	3	3325.5149	3325.5149	R	S	577	609
PSM	ALVLIAFAQYLQQCPFEDHVK	192	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=22206	151.41	3	2489.2777	2489.2777	K	L	45	66
PSM	APSAVSPIPAVIPSPSHKPSK	193	sp|Q9ULK2-3|AT7L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=11465	67.697	3	2146.1188	2146.1188	K	T	476	497
PSM	DKFNECGHVLYADIK	194	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=10907	64.007	2	1807.8563	1807.8563	K	M	632	647
PSM	DPDDHTVCHLLFANQTEK	195	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:4	ms_run[2]:scan=13049	77.993	3	2138.9691	2138.9691	K	D	174	192
PSM	EREEEDDYRQEEQR	196	sp|Q99795|GPA33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2015	11.611	2	1909.8038	1909.8038	R	S	294	308
PSM	FASDDEHDEHDENGATGPVKR	197	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=3941	22.271	3	2404.9557	2404.9557	K	A	364	385
PSM	FPPEDFRHSPEDFR	198	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=11284	66.475	2	1854.7727	1854.7727	R	R	567	581
PSM	GAGAAGLPQPPRESPQLHER	199	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:21	ms_run[2]:scan=8833	51.175	2	2147.0273	2147.0273	R	E	456	476
PSM	GPPSPPAPVMHSPSR	200	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5138	29.278	3	1608.712	1608.7120	R	K	221	236
PSM	HAHSSSLQQAASR	201	sp|O95425-4|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=1171	7.5857	2	1458.6365	1458.6365	K	S	248	261
PSM	HLEHAPSPSDVSNAPEVK	202	sp|Q9Y4C1|KDM3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=7617	43.899	3	1992.8942	1992.8942	K	A	439	457
PSM	KPNATRPVTPPR	203	sp|P36873|PP1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=2415	13.669	2	1412.7289	1412.7289	K	G	303	315
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	204	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=10374	60.735	3	2637.3415	2637.3415	R	R	31	56
PSM	LKEFLEDYDDDRDDPK	205	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10485	61.438	2	2011.9011	2011.9011	R	Y	496	512
PSM	LLKPGEEPSEYTDEEDTKDHNK	206	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=6197	35.424	3	2653.1433	2653.1433	R	Q	200	222
PSM	LLKPGEEPSEYTDEEDTKDHNK	207	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:21	ms_run[2]:scan=6527	37.484	2	2653.1433	2653.1433	R	Q	200	222
PSM	LRSDPGPPTETPSQRPSPLK	208	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=7095	40.878	3	2239.0998	2239.0998	R	R	133	153
PSM	LTRPFPTGTPPPLPPK	209	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=12457	74.128	3	1794.9434	1794.9434	K	N	207	223
PSM	MSHSSSSDTDINEIHTNHK	210	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=3116	17.728	3	2234.89	2234.8900	R	T	676	695
PSM	NKPGPNIESGNEDDDASFK	211	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=7885	45.522	3	2112.8637	2112.8637	K	I	206	225
PSM	PRPPQSSTGSTASPPVSTPVTGHK	212	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=6315	36.192	3	2452.1748	2452.1748	K	R	139	163
PSM	RKPSVPDSASPADDSFVDPGER	213	sp|P16333-2|NCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=9671	56.305	3	2408.0645	2408.0645	K	L	18	40
PSM	RLSEQLAHTPTAFK	214	sp|Q9UBF8-3|PI4KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=10367	60.692	2	1677.824	1677.8240	R	R	177	191
PSM	RLSTLILHGGGTVCR	215	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11903	70.565	2	1718.8651	1718.8651	R	V	41	56
PSM	RPASPSSPEHLPATPAESPAQR	216	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=7327	42.172	3	2362.1067	2362.1067	K	F	231	253
PSM	RPSDLTISINQMGSPGMGHLK	217	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,12-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=10488	61.454	3	2350.0811	2350.0811	R	S	913	934
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	218	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=8556	49.525	3	2602.1925	2602.1925	R	F	118	143
PSM	RRDSLDSSTEASGSDVVLGGR	219	sp|Q9Y2I9|TBC30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=8800	50.982	3	2243.0179	2243.0179	R	S	111	132
PSM	SAPTAPTPPPPPPPATPR	220	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=8040	46.504	2	1827.892	1827.8921	R	K	799	817
PSM	SFPLHSPVAGVAHR	221	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=9418	54.693	2	1553.7504	1553.7504	K	F	900	914
PSM	SHSDASVGSHSSTESEHGSSSPR	222	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	20-UNIMOD:21	ms_run[2]:scan=807	6.1915	3	2390.9361	2390.9361	R	F	597	620
PSM	SLVLGHQSQSSPPHGEADGHPSEK	223	sp|Q9ULL8-2|SHRM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=5094	29.027	3	2560.1344	2560.1344	R	G	368	392
PSM	SQDKLDKDDLEK	224	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3251	18.414	2	1432.7046	1432.7046	R	E	1681	1693
PSM	THEAEIVEGENHTYCIR	225	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=8826	51.146	3	2056.9273	2056.9273	K	F	2177	2194
PSM	VADPDHDHTGFLTEYVATR	226	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12671	75.555	3	2142.997	2142.9970	R	W	173	192
PSM	VHDRSEEEEEEEEEEEEEQPR	227	sp|Q5TAQ9-2|DCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=5762	32.855	3	2751.0305	2751.0305	R	R	95	116
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	228	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14329	87.55629	3	3442.4048	3442.4027	K	L	104	135
PSM	TYFPHFDLSHGSAQVK	229	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=13824	83.776015	2	1912.853125	1912.850914	K	G	42	58
PSM	HSTPSNSSNPSGPPSPNSPHR	230	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=2016	11.613676666666667	3	2220.924724	2219.934537	K	S	1676	1697
PSM	PGAEGAPLLPPPLPPPSPPGSGR	231	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:21	ms_run[1]:scan=15189	94.24380333333333	2	2238.128604	2237.124570	R	G	27	50
PSM	ALAMPGRPESPPVFR	232	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=10550	61.82877333333333	2	1720.821190	1719.816778	R	S	366	381