MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000210 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\121102_CRC_T_Fr20.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220618\20220618013151313589^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\121102_CRC_T_Fr20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=750
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	240-UNIMOD:21,242-UNIMOD:21	0.08	45.0	6	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	43-UNIMOD:21	0.05	45.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	45.0	1	1	0
PRT	sp|Q14934-18|NFAC4_HUMAN	Isoform 18 of Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	219-UNIMOD:21	0.03	44.0	2	1	0
PRT	sp|O96013-3|PAK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	105-UNIMOD:21,123-UNIMOD:4,114-UNIMOD:21	0.08	42.0	2	1	0
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	299-UNIMOD:4	0.09	42.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	188-UNIMOD:21,198-UNIMOD:21,194-UNIMOD:21,200-UNIMOD:21	0.04	41.0	6	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	183-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P17029|ZKSC1_HUMAN	Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	208-UNIMOD:21	0.03	38.0	3	1	0
PRT	sp|P15259|PGAM2_HUMAN	Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.15	38.0	3	2	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	19-UNIMOD:21,17-UNIMOD:21	0.20	38.0	4	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,58-UNIMOD:4	0.07	38.0	2	2	2
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	102-UNIMOD:21,124-UNIMOD:35	0.22	38.0	5	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	246-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	51-UNIMOD:21,74-UNIMOD:4,126-UNIMOD:21,120-UNIMOD:21	0.11	37.0	3	2	1
PRT	sp|Q86XR7|TCAM2_HUMAN	TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	22-UNIMOD:21	0.07	37.0	2	1	0
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	691-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	13-UNIMOD:21,26-UNIMOD:35	0.04	37.0	1	1	1
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	17-UNIMOD:21	0.14	37.0	1	1	1
PRT	sp|Q9BQQ3-3|GORS1_HUMAN	Isoform 3 of Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	143-UNIMOD:21	0.16	36.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	262-UNIMOD:21,265-UNIMOD:35,626-UNIMOD:21	0.05	35.0	6	2	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	112-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	39-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	108-UNIMOD:35,122-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	970-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q8N4C8-4|MINK1_HUMAN	Isoform 4 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	713-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	255-UNIMOD:21	0.04	34.0	4	4	4
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	1	0
PRT	sp|Q9H4H8-2|FA83D_HUMAN	Isoform 2 of Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	347-UNIMOD:4,353-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	268-UNIMOD:21,287-UNIMOD:21,512-UNIMOD:21	0.05	34.0	3	3	3
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	495-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	125-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	22-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	830-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,18-UNIMOD:21,2-UNIMOD:21	0.09	34.0	2	2	2
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	857-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9BSQ5-4|CCM2_HUMAN	Isoform 4 of Cerebral cavernous malformations 2 protein OS=Homo sapiens OX=9606 GN=CCM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	180-UNIMOD:21,181-UNIMOD:21	0.06	33.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	159-UNIMOD:21	0.04	33.0	4	1	0
PRT	sp|Q15642-4|CIP4_HUMAN	Isoform 4 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	450-UNIMOD:21,444-UNIMOD:21	0.06	33.0	3	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:21,83-UNIMOD:35,76-UNIMOD:21	0.20	33.0	2	1	0
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	832-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:21,22-UNIMOD:21,27-UNIMOD:21	0.02	33.0	4	1	0
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1762-UNIMOD:4,1769-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q9UD71-2|PPR1B_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	9-UNIMOD:21	0.11	33.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P49917|DNLI4_HUMAN	DNA ligase 4 OS=Homo sapiens OX=9606 GN=LIG4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	34-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	306-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	21-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q9NTX7|RN146_HUMAN	E3 ubiquitin-protein ligase RNF146 OS=Homo sapiens OX=9606 GN=RNF146 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	329-UNIMOD:21,334-UNIMOD:21,340-UNIMOD:21,342-UNIMOD:21,344-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	575-UNIMOD:21	0.01	31.0	4	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	74-UNIMOD:21	0.11	31.0	1	1	1
PRT	sp|Q9Y6W3|CAN7_HUMAN	Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	31-UNIMOD:4,33-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	374-UNIMOD:21,378-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	353-UNIMOD:21,355-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q14558|KPRA_HUMAN	Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	204-UNIMOD:4,209-UNIMOD:35,215-UNIMOD:21,218-UNIMOD:35	0.08	31.0	1	1	1
PRT	sp|P23497-5|SP100_HUMAN	Isoform SpAlt-C of Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:4,18-UNIMOD:21,24-UNIMOD:35	0.05	31.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1391-UNIMOD:35,1404-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|Q8N4B1-2|SESQ1_HUMAN	Isoform 2 of Sesquipedalian-1 OS=Homo sapiens OX=9606 GN=PHETA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	90-UNIMOD:21,98-UNIMOD:35	0.13	31.0	3	1	0
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	188-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	196-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q6P1M3-2|L2GL2_HUMAN	Isoform A of LLGL scribble cell polarity complex component 2 OS=Homo sapiens OX=9606 GN=LLGL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	680-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	209-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1368-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	172-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1452-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	30.0	1	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	672-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	41-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	72-UNIMOD:21	0.23	30.0	1	1	1
PRT	sp|O60256-4|KPRB_HUMAN	Isoform 4 of Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	141-UNIMOD:21,144-UNIMOD:35	0.10	30.0	2	1	0
PRT	sp|P17676-2|CEBPB_HUMAN	Isoform 2 of CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	42-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q9C0K0-2|BC11B_HUMAN	Isoform 2 of B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	341-UNIMOD:35,346-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	483-UNIMOD:21,487-UNIMOD:35,486-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|Q7Z422|SZRD1_HUMAN	SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	37-UNIMOD:21	0.17	30.0	1	1	0
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	29.0	3	3	3
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	366-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	635-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9P2K8-2|E2AK4_HUMAN	Isoform 2 of eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	667-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|Q5JTD0-4|TJAP1_HUMAN	Isoform 4 of Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	133-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	321-UNIMOD:35,330-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	218-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q969H4-2|CNKR1_HUMAN	Isoform 2 of Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	293-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	21-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	398-UNIMOD:21,406-UNIMOD:21,416-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	2	1	0
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	4328-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q3T8J9-3|GON4L_HUMAN	Isoform 3 of GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1896-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	1999-UNIMOD:21,89-UNIMOD:21	0.02	29.0	3	2	1
PRT	sp|O75970|MPDZ_HUMAN	Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1584-UNIMOD:21,1604-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	2	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	4	2	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P98177-2|FOXO4_HUMAN	Isoform Zeta of Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	175-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q96F44-2|TRI11_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:21,92-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|Q5TZA2|CROCC_HUMAN	Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	515-UNIMOD:4,519-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	303-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1148-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q12929-2|EPS8_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	425-UNIMOD:21,427-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	266-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	213-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	227-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q96CC6|RHDF1_HUMAN	Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	49-UNIMOD:21,52-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	446-UNIMOD:21,453-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9H4M7|PKHA4_HUMAN	Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	329-UNIMOD:21	0.03	28.0	3	1	0
PRT	sp|Q6ZNJ1-2|NBEL2_HUMAN	Isoform 2 of Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	1824-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	614-UNIMOD:21,624-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|P78524|DEN2B_HUMAN	DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	413-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1419-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q96FF7|MISP3_HUMAN	Uncharacterized protein MISP3 OS=Homo sapiens OX=9606 GN=MISP3 PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	91-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q92540-2|SMG7_HUMAN	Isoform 2 of Protein SMG7 OS=Homo sapiens OX=9606 GN=SMG7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	735-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	278-UNIMOD:35,280-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q9NTI5-5|PDS5B_HUMAN	Isoform 5 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	71-UNIMOD:21	0.11	27.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	245-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1489-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1761-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1690-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q92729-3|PTPRU_HUMAN	Isoform 3 of Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	853-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q6ZUJ8-3|BCAP_HUMAN	Isoform 3 of Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	358-UNIMOD:21,370-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	230-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q07890-2|SOS2_HUMAN	Isoform 2 of Son of sevenless homolog 2 OS=Homo sapiens OX=9606 GN=SOS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1169-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	572-UNIMOD:35,577-UNIMOD:35,585-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q5T1R4|ZEP3_HUMAN	Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1414-UNIMOD:21,1417-UNIMOD:21,1421-UNIMOD:21,1423-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9NPF8-2|ADAP2_HUMAN	Isoform 2 of Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ADAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	330-UNIMOD:21,333-UNIMOD:21,342-UNIMOD:4,344-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	318-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1070-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	184-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	313-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|O14494|PLPP1_HUMAN	Phospholipid phosphatase 1 OS=Homo sapiens OX=9606 GN=PLPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	266-UNIMOD:21	0.09	26.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	1365-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	396-UNIMOD:21,390-UNIMOD:21	0.02	26.0	3	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	214-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|Q9UPN7|PP6R1_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	518-UNIMOD:35,529-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	278-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	450-UNIMOD:21,402-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	48-UNIMOD:21	0.12	26.0	1	1	1
PRT	sp|P62995-3|TRA2B_HUMAN	Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	101-UNIMOD:21,108-UNIMOD:35	0.07	26.0	4	1	0
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	391-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	292-UNIMOD:21,296-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	328-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q8TE67-3|ES8L3_HUMAN	Isoform 3 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	206-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	400-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q6PI98|IN80C_HUMAN	INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	28-UNIMOD:21	0.11	26.0	1	1	1
PRT	sp|Q8WU49|CG033_HUMAN	Uncharacterized protein C7orf33 OS=Homo sapiens OX=9606 GN=C7orf33 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	172-UNIMOD:21,174-UNIMOD:21,176-UNIMOD:21,177-UNIMOD:21	0.10	26.0	1	1	1
PRT	sp|P48436|SOX9_HUMAN	Transcription factor SOX-9 OS=Homo sapiens OX=9606 GN=SOX9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	218-UNIMOD:35,236-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	84-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q92608|DOCK2_HUMAN	Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1730-UNIMOD:35,1731-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	205-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8WWI1-4|LMO7_HUMAN	Isoform 4 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1510-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9H9J4-2|UBP42_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	1166-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9P0K8-2|FOXJ2_HUMAN	Isoform FOXJ2.S of Forkhead box protein J2 OS=Homo sapiens OX=9606 GN=FOXJ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	170-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q13615-3|MTMR3_HUMAN	Isoform C of Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	731-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q7Z6B7-2|SRGP1_HUMAN	Isoform 2 of SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	894-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8NBR0|P5I13_HUMAN	Tumor protein p53-inducible protein 13 OS=Homo sapiens OX=9606 GN=TP53I13 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	392-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	262-UNIMOD:21,263-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	839-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	77-UNIMOD:21	0.02	25.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	1	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	26-UNIMOD:21	ms_run[2]:scan=8717	56.327	3	3407.6452	3407.6452	R	N	215	246
PSM	PGAEGAPLLPPPLPPPSPPGSGR	2	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21	ms_run[2]:scan=14411	95.731	2	2237.1246	2237.1246	R	G	27	50
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	3	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13293	87.79421666666666	3	3442.4002	3442.4027	K	L	104	135
PSM	RGSLGEEGSEPPPPPPLPLAR	4	sp|Q14934-18|NFAC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=12056	78.995	2	2232.094	2232.0940	R	D	217	238
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	5	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	28-UNIMOD:21	ms_run[2]:scan=8868	57.335	3	3407.6452	3407.6452	R	N	215	246
PSM	GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPR	6	sp|O96013-3|PAK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=13693	90.597	3	3454.6857	3454.6857	R	S	102	138
PSM	REDKEDEEDEEDDDVSHVDEEDCLGVQR	7	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	23-UNIMOD:4	ms_run[2]:scan=8124	52.505	3	3390.355	3390.3550	K	E	277	305
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	8	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=13160	86.838	3	2892.3583	2892.3583	K	Q	178	204
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	9	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	26-UNIMOD:21	ms_run[2]:scan=17405	117.36	3	3131.439	3131.4390	K	E	158	187
PSM	GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPR	10	sp|O96013-3|PAK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=13527	89.422	3	3454.6857	3454.6857	R	S	102	138
PSM	ALPAAHIPAPPHEGSPR	11	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=8595	55.545	2	1796.8723	1796.8723	R	D	194	211
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	12	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	28-UNIMOD:21	ms_run[2]:scan=9019	58.343	3	3407.6452	3407.6452	R	N	215	246
PSM	HYGGLTGLNKAETAAK	13	sp|P15259|PGAM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=5853	37.608	2	1629.8475	1629.8475	R	H	91	107
PSM	RAAEDDEDDDVDTKK	14	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=924	6.7855	2	1720.7388	1720.7388	K	Q	89	104
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	15	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=13993	92.72	3	2715.4361	2715.4361	K	I	17	42
PSM	VHTECCHGDLLECADDR	16	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6348	41.042	2	2085.8303	2085.8303	K	A	265	282
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	17	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=9115	58.993181666666665	3	2894.341430	2894.342244	R	-	100	127
PSM	DPDAQPGGELMLGGTDSK	18	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:35	ms_run[2]:scan=8400	54.26	2	1802.7993	1802.7993	R	Y	236	254
PSM	PRSPKPAAPAAPPFSSSSGVLGTGLCELDR	19	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=15533	103.75	3	3101.5005	3101.5005	K	L	49	79
PSM	RHSVDTSPGYHESDSK	20	sp|Q86XR7|TCAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=1264	8.3619	2	1880.769	1880.7690	K	K	20	36
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	21	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9371	60.704	3	2845.2556	2845.2556	K	A	686	710
PSM	SLSSSLQAPVVSTVGMQR	22	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=13102	86.413	2	1941.9231	1941.9231	R	L	11	29
PSM	RRSPESLPAGPGAAALEGGTR	23	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=8797	56.87324666666667	3	2130.039340	2129.037880	R	R	15	36
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	24	sp|Q9BQQ3-3|GORS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=14796	98.511	3	3773.8553	3773.8553	K	Q	139	177
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	25	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[2]:scan=9262	59.999	3	2894.3422	2894.3422	R	-	100	127
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	26	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	26-UNIMOD:21	ms_run[2]:scan=8561	55.324	3	3407.6452	3407.6452	R	N	215	246
PSM	ENHGQADHSPSMTATHFPR	27	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=3655	23.266	2	2214.8902	2214.8902	R	V	254	273
PSM	IHIDPEIQDGSPTTSR	28	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=8617	55.686	2	1844.8306	1844.8306	R	R	102	118
PSM	KDDSHSAEDSEDEKEDHK	29	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=516	4.9716	2	2179.8179	2179.8179	K	N	30	48
PSM	MHNLHGTKPPPSEGSDEEEEEEDEEDEEER	30	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=4900	31.313	3	3604.3581	3604.3581	R	K	108	138
PSM	PSSAHVGLRSPEASASASPHTPR	31	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=4816	30.743	3	2378.1128	2378.1128	R	E	961	984
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	32	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=13849	91.714	3	2715.4361	2715.4361	K	I	17	42
PSM	GTPKPPGPPAQPPGPPNASSNPDLR	33	sp|Q8N4C8-4|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	20-UNIMOD:21	ms_run[2]:scan=8409	54.315	3	2525.2064	2525.2064	R	R	694	719
PSM	IEDVGSDEEDDSGKDK	34	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=2763	17.595	2	1816.6888	1816.6888	K	K	250	266
PSM	KFNHDGEEEEEDDDYGSR	35	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3133	19.858	2	2169.8359	2169.8359	K	T	270	288
PSM	KPHDCESSTVSEEDYFSSHR	36	sp|Q9H4H8-2|FA83D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=7086	45.766	3	2475.9638	2475.9638	R	D	343	363
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	37	sp|Q9BQQ3-3|GORS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=14941	99.528	3	3773.8553	3773.8553	K	Q	139	177
PSM	NTPSQHSHSIQHSPER	38	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=825	6.3142	2	1920.8228	1920.8228	K	S	256	272
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	39	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	27-UNIMOD:21	ms_run[2]:scan=13386	88.433	3	3259.551	3259.5510	R	K	469	499
PSM	RTPHVQAVQGPLGSPPK	40	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:21	ms_run[2]:scan=7197	46.535	3	1847.9407	1847.9407	R	R	112	129
PSM	SHSGPSSLPEAPLKPPGPLVPPDQQDK	41	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=12410	81.504	3	2854.3902	2854.3902	R	V	16	43
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	42	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=14133	93.729	3	2715.4361	2715.4361	K	I	17	42
PSM	STAQQELDGKPASPTPVIVASHTANK	43	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=8498	54.895	3	2726.3276	2726.3276	R	E	818	844
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	44	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=8960	57.955705	3	2896.348020	2894.342244	R	-	100	127
PSM	SETAPAETATPAPVEKSPAK	45	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6189	39.948735	2	2102.9760	2102.9768	M	K	2	22
PSM	RQLSHDHESVGPPSLDAQPNSK	46	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=6037	38.93202333333333	3	2479.129979	2478.128880	R	T	854	876
PSM	AAEDDEDDDVDTKK	47	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1086	7.5378	2	1564.6377	1564.6377	R	Q	90	104
PSM	AIFDGASTPTHHLSLHSDDSSTK	48	sp|Q9BSQ5-4|CCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=9473	61.332	3	2503.1017	2503.1017	R	V	174	197
PSM	ALPAAHIPAPPHEGSPR	49	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=8445	54.536	2	1796.8723	1796.8723	R	D	194	211
PSM	DASDDLDDLNFFNQK	50	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16902	113.66	2	1755.7588	1755.7588	K	K	65	80
PSM	FADQDDIGNVSFDR	51	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11544	75.445	2	1597.7009	1597.7009	K	V	489	503
PSM	FHFPPLDTHSPTNDVQPGR	52	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=12577	82.692	3	2241.0004	2241.0004	R	F	150	169
PSM	HARPPDPPASAPPDSSSNSASQDTK	53	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:21	ms_run[2]:scan=3268	20.769	3	2596.1191	2596.1191	R	E	430	455
PSM	KEESEESDDDMGFGLFD	54	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=14779	98.393	2	2044.7133	2044.7133	K	-	73	90
PSM	LRSVGAPGGAPTPALGPSAPQKPLR	55	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=9334	60.456	3	2474.3159	2474.3159	R	R	830	855
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	56	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=5532	35.344	3	2750.1933	2750.1933	R	T	13	39
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	57	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=14283	94.818	3	2715.4361	2715.4361	K	I	17	42
PSM	TPGHPPPPEIPSELGACDFEKPESPR	58	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	17-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=12712	83.661	3	2920.3103	2920.3103	R	A	1746	1772
PSM	FRLSEHSSPEEEASPHQR	59	sp|Q9UD71-2|PPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=6065	39.114909999999995	3	2201.9486	2201.9486	L	A	3	21
PSM	APSVANVGSHCDLSLK	60	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9471	61.32	2	1733.7808	1733.7808	R	I	2142	2158
PSM	FHFPPLDTHSPTNDVQPGR	61	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=12435	81.687	3	2241.0004	2241.0004	R	F	150	169
PSM	GVVDSDDLPLNVSR	62	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11756	76.942	2	1484.7471	1484.7471	K	E	435	449
PSM	HQSFYIETKLDGER	63	sp|P49917|DNLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9436	61.121	2	1721.8373	1721.8373	K	M	265	279
PSM	KEESEESDDDMGFGLFD	64	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=14927	99.419	2	2044.7133	2044.7133	K	-	73	90
PSM	RKTDTVVESSVSGDHSGTLR	65	sp|Q9NXL2-1|ARH38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=5007	31.959	3	2210.0329	2210.0329	R	R	32	52
PSM	SGPKPFSAPKPQTSPSPK	66	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=5030	32.085	2	1916.9397	1916.9397	R	R	294	312
PSM	RLGGLRPESPESLTSVSR	67	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=9864	63.995491666666666	2	2020.009685	2020.010269	R	T	10	28
PSM	SGTDRSVAGGGTVSVSVR	68	sp|Q9NTX7|RN146_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21,6-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=5212	33.22697	2	2093.680624	2090.691480	R	S	329	347
PSM	FHFPPLDTHSPTNDVQPGR	69	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=13033	85.922	3	2241.0004	2241.0004	R	F	150	169
PSM	FPPEDFRHSPEDFR	70	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:21	ms_run[2]:scan=10438	67.948	2	1854.7727	1854.7727	R	R	567	581
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	71	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=10620	69.207	3	2649.1708	2649.1708	K	S	61	87
PSM	HITDKDDFANNR	72	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2662	16.937	2	1444.6695	1444.6695	R	E	592	604
PSM	HRPQVAIICGSGLGGLTDK	73	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=12239	80.314	3	2058.0082	2058.0082	K	L	23	42
PSM	KKDDDDEEIGGPK	74	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1301	8.5272	2	1444.6682	1444.6682	K	E	627	640
PSM	KKDSLHGSTGAVNATR	75	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=1362	8.8115	2	1720.8258	1720.8258	K	P	371	387
PSM	KPVGEVHSQFSTGHANSPCTIIIGK	76	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=9713	62.956	3	2743.3153	2743.3153	K	A	337	362
PSM	LGLAVIHGEAQCTELDMDDGRHSPPMVK	77	sp|Q14558|KPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	12-UNIMOD:4,17-UNIMOD:35,23-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=11045	72.061	3	3187.4138	3187.4138	R	N	193	221
PSM	LNECISPVANEMNHLPAHSHDLQR	78	sp|P23497-5|SP100_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=8683	56.11	3	2877.2688	2877.2688	R	M	13	37
PSM	MTTTSAAAYGTHLSPHVPHR	79	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=7375	47.706	2	2229.9991	2229.9991	R	V	1391	1411
PSM	PGAEGAPLLPPPLPPPSPPGSGR	80	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:21	ms_run[2]:scan=14569	96.862	2	2237.1246	2237.1246	R	G	27	50
PSM	PYHPPPLFPPSPQPPDSTPR	81	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=12529	82.363	3	2303.0776	2303.0776	R	Q	158	178
PSM	RASAPHGPLDMAPFAR	82	sp|Q8N4B1-2|SESQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9523	61.661	3	1788.8131	1788.8131	R	L	88	104
PSM	RASAPHGPLDMAPFAR	83	sp|Q8N4B1-2|SESQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9671	62.671	3	1788.8131	1788.8131	R	L	88	104
PSM	RDSFDDRGPSLNPVLDYDHGSR	84	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=11415	74.58	3	2597.1296	2597.1296	R	S	186	208
PSM	RGSIGENQIKDEK	85	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=2979	18.924	2	1552.7247	1552.7247	K	I	194	207
PSM	RHPAGPPGEAQEGSAK	86	sp|Q6P1M3-2|L2GL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:21	ms_run[2]:scan=1026	7.2681	2	1667.7417	1667.7417	K	A	667	683
PSM	RPGQSFHVNSEVNSVLSPR	87	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	17-UNIMOD:21	ms_run[2]:scan=10791	70.353	3	2189.0379	2189.0379	R	S	193	212
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	88	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21	ms_run[2]:scan=5013	32	3	2750.1933	2750.1933	R	T	13	39
PSM	RSSLSSHSHQSQIYR	89	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:21	ms_run[2]:scan=2269	14.476	2	1851.8377	1851.8377	R	S	1367	1382
PSM	SQAGHTLHHQESR	90	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=621	5.4243	2	1566.6689	1566.6689	R	R	172	185
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	91	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=9429	61.083645	3	2895.336747	2894.342244	R	-	100	127
PSM	GRPPAEKLSPNPPNLTK	92	sp|P51532|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=7006	45.26238333333333	3	1895.970677	1894.966613	R	K	1444	1461
PSM	APTVPPPLPPTPPQPAR	93	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=10518	68.502	2	1811.9335	1811.9335	R	R	616	633
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	94	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=11522	75.281	3	3459.4297	3459.4297	K	L	104	135
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	95	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:21	ms_run[2]:scan=13614	90.032	3	2892.3583	2892.3583	K	Q	178	204
PSM	FHFPPLDTHSPTNDVQPGR	96	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=12718	83.699	3	2241.0004	2241.0004	R	F	150	169
PSM	FHQLDIDDLQSIR	97	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13827	91.555	2	1598.8053	1598.8053	R	A	59	72
PSM	HARPPDPPASAPPDSSSNSASQDTK	98	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:21	ms_run[2]:scan=3433	21.773	3	2596.1191	2596.1191	R	E	430	455
PSM	HEHPPNPPVSPGK	99	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=2691	17.117	2	1471.6609	1471.6609	R	T	663	676
PSM	HHYDSDEKSETR	100	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:21	ms_run[2]:scan=708	5.7986	2	1582.6049	1582.6049	R	E	37	49
PSM	IEDVGSDEEDDSGKDKK	101	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=1877	11.863	2	1944.7837	1944.7837	K	K	250	267
PSM	KKSPNELVDDLFK	102	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=13835	91.605	2	1611.7909	1611.7909	R	G	112	125
PSM	KRPSLPSSPSPGLPK	103	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:21	ms_run[2]:scan=7284	47.123	2	1626.8495	1626.8495	K	A	117	132
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIKK	104	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=10323	67.147	3	2985.5576	2985.5576	K	Q	69	100
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	105	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=13028	85.886	3	3064.4437	3064.4437	R	S	119	147
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	106	sp|O60256-4|KPRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	23-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=13563	89.663	3	3064.4437	3064.4437	R	S	119	147
PSM	PGPRPPAGELGSIGDHER	107	sp|P17676-2|CEBPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:21	ms_run[2]:scan=7865	50.841	3	1920.8843	1920.8843	R	A	31	49
PSM	SPFLSTPPLPPMPPGGTPPPQPPAK	108	sp|Q9C0K0-2|BC11B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=14329	95.154	3	2600.275	2600.2750	K	S	330	355
PSM	VERPPSPFSMAPQASLPPVPPR	109	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=13252	87.506	3	2452.1974	2452.1974	K	L	478	500
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	110	sp|Q7Z422|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=14313	95.03775166666667	3	2716.422535	2715.436068	K	I	37	62
PSM	DADDAVYELNGK	111	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8316	53.729	2	1308.5834	1308.5834	R	E	47	59
PSM	ESEDKPEIEDVGSDEEEEK	112	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:21	ms_run[2]:scan=6859	44.268	2	2271.8792	2271.8792	K	K	251	270
PSM	FASDDEHDEHDENGATGPVKR	113	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=3373	21.411	3	2404.9557	2404.9557	K	A	364	385
PSM	FPPEDFRHSPEDFR	114	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=10853	70.763	2	1854.7727	1854.7727	R	R	567	581
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	115	sp|Q93074-3|MED12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:21	ms_run[2]:scan=13413	88.62	3	2781.2072	2781.2072	R	E	622	648
PSM	HARPPDPPASAPPDSSSNSASQDTK	116	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=3117	19.759	3	2596.1191	2596.1191	R	E	430	455
PSM	HEHPPNPPVSPGK	117	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=2537	16.103	2	1471.6609	1471.6609	R	T	663	676
PSM	HERPAGPGTPPPDSGPLAK	118	sp|Q9P2K8-2|E2AK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=4536	28.856	3	1959.9204	1959.9204	R	D	659	678
PSM	HLHSGQEAASPGPAPSLAPGAVVPTSVIAR	119	sp|Q5JTD0-4|TJAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=12794	84.252	3	2953.4811	2953.4811	K	V	130	160
PSM	HTFMGVVSLGSPSGEVSHPR	120	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=10114	65.731	3	2175.9773	2175.9773	R	K	318	338
PSM	IYHLPDAESDEDEDFKEQTR	121	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=10617	69.187	3	2516.0381	2516.0381	K	L	210	230
PSM	KDDSHSAEDSEDEKEDHK	122	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=515	4.9683	3	2179.8179	2179.8179	K	N	30	48
PSM	KIPIPETPPQTPPQVLDSPHQR	123	sp|Q969H4-2|CNKR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:21	ms_run[2]:scan=11408	74.529	3	2554.2945	2554.2945	K	S	276	298
PSM	KQSLGELIGTLNAAK	124	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=15257	101.78	2	1621.844	1621.8440	R	V	19	34
PSM	LSSESHHGGSPIHWVLPAGMSAK	125	sp|Q96MU7-2|YTDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:21	ms_run[2]:scan=12734	83.81	3	2464.1359	2464.1359	R	M	397	420
PSM	PRPGPELGPQLGLDGGPGDGDR	126	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11021	71.893	3	2156.061	2156.0610	R	H	402	424
PSM	PYHPPPLFPPSPQPPDSTPR	127	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:21	ms_run[2]:scan=12388	81.352	3	2303.0776	2303.0776	R	Q	158	178
PSM	RASAPHGPLDMAPFAR	128	sp|Q8N4B1-2|SESQ1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9582	62.067	2	1788.8131	1788.8131	R	L	88	104
PSM	RGSLGEEGSEPPPPPPLPLAR	129	sp|Q14934-18|NFAC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=12153	79.691	3	2232.094	2232.0940	R	D	217	238
PSM	RHDEDEDDSLK	130	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1033	7.2997	2	1357.5746	1357.5746	R	D	1329	1340
PSM	RPSQLPSPSSQLPTEAQLPPTHPGTPK	131	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:21	ms_run[2]:scan=11173	72.946	3	2927.4542	2927.4542	K	P	4319	4346
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	132	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:21	ms_run[2]:scan=5332	34.051	3	2750.1933	2750.1933	R	T	13	39
PSM	RSSKEEAEMAYK	133	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1165	7.8975	2	1523.6327	1523.6327	K	D	733	745
PSM	SKEPHELVGSSPHR	134	sp|Q3T8J9-3|GON4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:21	ms_run[2]:scan=2071	13.161	3	1638.7515	1638.7515	K	E	1886	1900
PSM	TSNRYSPESQAQSVHHQR	135	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=2927	18.567	2	2190.9556	2190.9556	K	P	1994	2012
PSM	KNSSQSLMVPQSGSPEPESIRNTSR	136	sp|O75970|MPDZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=9092	58.83794833333333	3	2878.252696	2875.257268	K	S	1582	1607
PSM	AGIPQHHPPMAQNLQYPDDSDDEKK	137	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=6546	42.262	3	2926.2593	2926.2593	K	A	403	428
PSM	DADDAVYELDGK	138	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8059	52.077	2	1309.5674	1309.5674	R	E	49	61
PSM	DRDDFPVVLVGNK	139	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12137	79.588	2	1472.7623	1472.7623	K	A	131	144
PSM	ENHGQADHSPSMTATHFPR	140	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=3714	23.699	3	2214.8902	2214.8902	R	V	254	273
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	141	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:21	ms_run[2]:scan=13018	85.822	3	2892.3583	2892.3583	K	Q	178	204
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	142	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	21-UNIMOD:21	ms_run[2]:scan=13472	89.028	3	2892.3583	2892.3583	K	Q	178	204
PSM	HERPAGPGTPPPDSGPLAK	143	sp|Q9P2K8-2|E2AK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=4838	30.886	3	1959.9204	1959.9204	R	D	659	678
PSM	KHIKEEPLSEEEPCTSTAIASPEK	144	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=7804	50.449	3	2789.2831	2789.2831	K	K	494	518
PSM	KPSVLPAPPEGATPTSPVGHFAK	145	sp|P98177-2|FOXO4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:21	ms_run[2]:scan=11074	72.258	3	2364.1879	2364.1879	K	W	160	183
PSM	LHPPSPVPQGVCPAHR	146	sp|Q96F44-2|TRI11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7115	45.961	2	1827.8604	1827.8604	R	E	81	97
PSM	PYHPPPLFPPSPQPPDSTPR	147	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:21	ms_run[2]:scan=12669	83.369	3	2303.0776	2303.0776	R	Q	158	178
PSM	RAAEDDEDDDVDTKK	148	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=919	6.7609	3	1720.7388	1720.7388	K	Q	89	104
PSM	RGPSPACSDSSTLALIHSALHK	149	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=13365	88.288	3	2384.1308	2384.1308	R	R	509	531
PSM	RGSNTTSHLHQAVAK	150	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=1504	9.6406	2	1685.7999	1685.7999	K	A	301	316
PSM	RHPAGPPGEAQEGSAK	151	sp|Q6P1M3-2|L2GL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:21	ms_run[2]:scan=1019	7.2285	3	1667.7417	1667.7417	K	A	667	683
PSM	RHSSETFSSTTTVTPVSPSFAHNPK	152	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=9324	60.403	3	2781.2759	2781.2759	R	R	1146	1171
PSM	RKSQMEEVQDELIHR	153	sp|Q12929-2|EPS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=6387	41.298	3	1992.9088	1992.9088	R	L	423	438
PSM	RLSTSPDVIQGHQPR	154	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=6068	39.133	3	1769.8574	1769.8574	R	D	264	279
PSM	RPGQSFHVNSEVNSVLSPR	155	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	17-UNIMOD:21	ms_run[2]:scan=10641	69.347	3	2189.0379	2189.0379	R	S	193	212
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	156	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:21	ms_run[2]:scan=5177	33.014	3	2750.1933	2750.1933	R	T	13	39
PSM	RTSYEPFHPGPSPVDHDSLESK	157	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:21	ms_run[2]:scan=9293	60.199	3	2561.1224	2561.1224	R	R	86	108
PSM	SRSPLDKDTYPPSASVVGASVGGHR	158	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=8956	57.932	3	2619.2442	2619.2442	R	H	213	238
PSM	STTPPPAEPVSLPQEPPKPR	159	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=9439	61.136	3	2204.0878	2204.0878	K	V	225	245
PSM	SVSMPAETAHISSPHHELR	160	sp|Q96CC6|RHDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=5456	34.827	2	2180.9674	2180.9674	R	R	49	68
PSM	TKPTQAAGPSSPQKPPTPEETK	161	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=3429	21.754	3	2436.0975	2436.0975	K	A	437	459
PSM	TQAHSGSPTYLQLPPRPPGTR	162	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=10178	66.181	3	2340.1376	2340.1376	R	A	323	344
PSM	VGTTPVSSPSQTPRPQPGPIPPHTQVR	163	sp|Q6ZNJ1-2|NBEL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=7841	50.696	3	2897.4549	2897.4549	K	N	1822	1849
PSM	VKDRDDFPVVLVGNK	164	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10200	66.32	2	1699.9257	1699.9257	R	A	129	144
PSM	SPPDQPAVPHPPPSTPIKLEEGDGCAR	165	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=10172	66.13728666666667	3	2929.349163	2928.347724	K	E	600	627
PSM	SKPSNGLPPSPTPAAPPPLPSTPAPPVTR	166	sp|P78524|DEN2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=11863	77.65478	3	2908.472938	2907.489560	K	R	404	433
PSM	KIDTHPSPSHSSTVK	167	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1275	8.414383333333333	2	1699.792457	1699.793065	R	D	1411	1426
PSM	AIFDGASTPTHHLSLHSDDSSTK	168	sp|Q9BSQ5-4|CCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:21	ms_run[2]:scan=9430	61.087	2	2503.1017	2503.1017	R	V	174	197
PSM	ALPAAHIPAPPHEGSPR	169	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:21	ms_run[2]:scan=8283	53.528	2	1796.8723	1796.8723	R	D	194	211
PSM	ALVLIAFAQYLQQCPFEDHVK	170	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=21788	151.4	3	2489.2777	2489.2777	K	L	45	66
PSM	ARPFPDGLAEDIDKGEVSAR	171	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12547	82.486	3	2142.0705	2142.0705	K	Q	606	626
PSM	ARSPPQPLGELKR	172	sp|Q96FF7|MISP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=7082	45.747	3	1527.7923	1527.7923	R	F	89	102
PSM	AVPALGKSPPHHSGFQQYQQADASK	173	sp|Q92540-2|SMG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:21	ms_run[2]:scan=7541	48.757	3	2728.2759	2728.2759	K	Q	728	753
PSM	DMESPTKLDVTLAK	174	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=9442	61.151	2	1642.7525	1642.7525	K	D	277	291
PSM	FPPEDFRHSPEDFR	175	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=10749	70.073	2	1854.7727	1854.7727	R	R	567	581
PSM	GRPPKPLGGGTPK	176	sp|Q9NTI5-5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21	ms_run[2]:scan=1953	12.371	2	1340.6966	1340.6966	R	E	61	74
PSM	HGYIGEFEIIDDHR	177	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11742	76.839	3	1699.7954	1699.7954	K	A	44	58
PSM	HQLLEADISAHEDR	178	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6983	45.118	3	1632.7856	1632.7856	K	L	1680	1694
PSM	HRLTPQEGLQAPGGSLR	179	sp|Q03989-5|ARI5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=7739	50.052	3	1895.9367	1895.9367	R	E	242	259
PSM	HSSHGSDVSLSQILKPNR	180	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=10003	64.942	3	2040.9742	2040.9742	R	S	1484	1502
PSM	HSSSPLSPGGPTHLTKPTTTSSSER	181	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:21	ms_run[2]:scan=6556	42.323	3	2628.2181	2628.2181	R	E	1755	1780
PSM	HSTPSNSSNPSGPPSPNSPHR	182	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	15-UNIMOD:21	ms_run[2]:scan=1435	9.2609	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IGHHSTSDDSSAYR	183	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=1288	8.474	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	184	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=1299	8.5209	3	1611.6315	1611.6315	R	S	333	347
PSM	KFNHDGEEEEEDDDYGSR	185	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3120	19.776	3	2169.8359	2169.8359	K	T	270	288
PSM	KGSPYHTGQLHPAVR	186	sp|Q92729-3|PTPRU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=3894	24.856	3	1726.8305	1726.8305	R	V	851	866
PSM	KRPSLPSSPSPGLPK	187	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=7808	50.476	2	1626.8495	1626.8495	K	A	117	132
PSM	RDQALTEEHAR	188	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=1138	7.7693	2	1324.6484	1324.6484	R	Q	614	625
PSM	SRSPGPPQVDGTPTMSLERPPR	189	sp|Q6ZUJ8-3|BCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=7825	50.584	3	2457.1472	2457.1472	R	V	356	378
PSM	TPGLHGDCDDDKYR	190	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=3157	20.012	3	1647.6947	1647.6947	R	R	223	237
PSM	TQAHSGSPTYLQLPPRPPGTR	191	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:21	ms_run[2]:scan=10624	69.229	3	2340.1376	2340.1376	R	A	323	344
PSM	VKDRDDFPVVLVGNK	192	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10342	67.274	3	1699.9257	1699.9257	R	A	129	144
PSM	VNVDEVGGEALGR	193	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9316	60.348	2	1313.6575	1313.6575	K	L	19	32
PSM	VPVPTGAFDGPLHSPPPPPPR	194	sp|Q07890-2|SOS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:21	ms_run[2]:scan=12626	83.057	3	2211.0878	2211.0878	R	D	1156	1177
PSM	YYHSPTNTVHMYPPEMAPSSAPPSTPPTHK	195	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35,16-UNIMOD:35,24-UNIMOD:21	ms_run[2]:scan=6879	44.408	3	3433.4785	3433.4785	R	A	562	592
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	196	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=9487	61.425369999999994	3	2895.336747	2894.342244	R	-	100	127
PSM	GTSLSSESILSLEGSSSTAGGSKR	197	sp|Q5T1R4|ZEP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,11-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1699	10.714838333333333	3	2618.003967	2616.999987	K	V	1407	1431
PSM	AGLTIVTPERRFVLTCPSEK	198	sp|Q9NPF8-2|ADAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=7412	47.926	3	2513.1192	2513.1192	K	E	327	347
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	199	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	26-UNIMOD:21	ms_run[2]:scan=8411	54.322	3	3407.6452	3407.6452	R	N	215	246
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	200	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	28-UNIMOD:21	ms_run[2]:scan=9166	59.347	3	3407.6452	3407.6452	R	N	215	246
PSM	APTVPPPLPPTPPQPAR	201	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:21	ms_run[2]:scan=10823	70.561	2	1811.9335	1811.9335	R	R	616	633
PSM	DADDAVYELDGK	202	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9373	60.716	2	1309.5674	1309.5674	R	E	49	61
PSM	DGDDVIIIGVFK	203	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17098	115.07	2	1289.6867	1289.6867	K	G	302	314
PSM	DTLLALHQHGHSGPFESK	204	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:21	ms_run[2]:scan=9581	62.063	3	2052.9419	2052.9419	R	F	307	325
PSM	EEEDKDDEEKPK	205	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=553	5.1336	2	1489.642	1489.6420	K	I	238	250
PSM	ESEDKPEIEDVGSDEEEEKK	206	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:21	ms_run[2]:scan=5880	37.781	3	2399.9741	2399.9741	K	D	251	271
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	207	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:21	ms_run[2]:scan=12730	83.788	3	2892.3583	2892.3583	K	Q	178	204
PSM	FPPEDFRHSPEDFR	208	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=10358	67.388	3	1854.7727	1854.7727	R	R	567	581
PSM	GTHSPPLTPEVAGLHGPRPL	209	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=12329	80.932	3	2112.0517	2112.0517	K	-	1067	1087
PSM	GVTIPYRPKPSSSPVIFAGGQDR	210	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:21	ms_run[2]:scan=11834	77.455	3	2508.2526	2508.2526	K	Y	173	196
PSM	KAPSSPPPPPPPLR	211	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:21	ms_run[2]:scan=6514	42.076	2	1516.7803	1516.7803	K	S	309	323
PSM	KEEDSHTTLHETPTTGNHYPSNHQP	212	sp|O14494|PLPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:21	ms_run[2]:scan=4085	26.05	3	2936.2363	2936.2363	R	-	260	285
PSM	KGAGDGSDEEVDGK	213	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:21	ms_run[2]:scan=978	7.0396	2	1442.5562	1442.5562	R	A	1359	1373
PSM	KKPAPLPPSSSPGPPSQDSR	214	sp|Q8N3F8|MILK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:21	ms_run[2]:scan=3745	23.921	3	2109.0256	2109.0256	K	Q	381	401
PSM	KQDFDEDDILK	215	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9179	59.442	2	1364.646	1364.6460	K	E	50	61
PSM	NKPGPNIESGNEDDDASFK	216	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=6945	44.868	3	2112.8637	2112.8637	K	I	206	225
PSM	NMVDLVNTHHLHSSSDDEDDR	217	sp|Q9UPN7|PP6R1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5863	37.676	3	2531.002	2531.0020	K	L	517	538
PSM	PAAPPRPLDRESPGVENK	218	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:21	ms_run[2]:scan=5017	32.019	2	2008.9732	2008.9732	K	L	267	285
PSM	PGAEGAPLLPPPLPPPSPPGSGR	219	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:21	ms_run[2]:scan=14599	97.088	3	2237.1246	2237.1246	R	G	27	50
PSM	QRDEDDEAYGKPVK	220	sp|Q53GD3-4|CTL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1664	10.524	2	1648.7693	1648.7693	K	Y	5	19
PSM	RESPSPAPKPR	221	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=803	6.2133	2	1300.6289	1300.6289	K	K	448	459
PSM	RFDEDDDKSFR	222	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4011	25.614	3	1428.627	1428.6270	R	R	1125	1136
PSM	RISGLIYEETR	223	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=11137	72.696	2	1415.681	1415.6810	K	G	46	57
PSM	RPHTPTPGIYMGR	224	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8329	53.818	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	225	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8792	56.843	3	1577.7174	1577.7174	K	P	98	111
PSM	RQPPVSPLTLSPGPEAHQGFSR	226	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:21	ms_run[2]:scan=10699	69.734	3	2437.1904	2437.1904	R	Q	386	408
PSM	RSSVVSPSHPPPAPPLGSPPGPK	227	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=9088	58.814	3	2404.1342	2404.1342	K	P	291	314
PSM	SGGGGGGGLGSGGSIR	228	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3269	20.773	2	1231.5905	1231.5905	R	S	14	30
PSM	SKDQDDQKPGPSER	229	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=625	5.4388	2	1585.7332	1585.7332	K	S	467	481
PSM	SKEPHELVGSSPHR	230	sp|Q3T8J9-3|GON4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:21	ms_run[2]:scan=1942	12.314	2	1638.7515	1638.7515	K	E	1886	1900
PSM	SPSPPLPTHIPPEPPR	231	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=11067	72.211	3	1797.8815	1797.8815	R	T	326	342
PSM	TLEHSLPPSPRPLPR	232	sp|Q8TE67-3|ES8L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=7750	50.121	2	1775.9084	1775.9084	R	H	198	213
PSM	TPGHPPPPEIPSELGACDFEKPESPR	233	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	17-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=12571	82.653	3	2920.3103	2920.3103	R	A	1746	1772
PSM	TSNRYSPESQAQSVHHQR	234	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:21	ms_run[2]:scan=2836	18.064	3	2190.9556	2190.9556	K	P	1994	2012
PSM	VERPPSPFSMAPQASLPPVPPR	235	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=12947	85.321	3	2452.1974	2452.1974	K	L	478	500
PSM	VRPSSDLNNSTGQSPHHK	236	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1226	8.164695	3	2041.921893	2039.917431	K	V	387	405
PSM	HITDKDDFANNR	237	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2666	16.95857	3	1445.662282	1444.669505	R	E	592	604
PSM	YSPSQNSPIHHIPSR	238	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=6757	43.608945	2	1798.815794	1798.815197	R	R	284	299
PSM	KRPASPSHNGSSGGGYGASK	239	sp|Q6PI98|IN80C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=752	5.985856666666667	2	1980.879605	1980.880317	K	K	22	42
PSM	LQNSVEATRISRTDSS	240	sp|Q8WU49|CG033_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=5193	33.115285	2	2084.746651	2082.746279	K	-	162	178
PSM	ALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPK	241	sp|P48436|SOX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35,31-UNIMOD:21	ms_run[2]:scan=5937	38.205	3	3802.653	3802.6530	K	T	206	243
PSM	APEPHVEEDDDDELDSK	242	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5798	37.232	3	1938.7967	1938.7967	K	L	5	22
PSM	APTVPPPLPPTPPQPAR	243	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:21	ms_run[2]:scan=10669	69.536	2	1811.9335	1811.9335	R	R	616	633
PSM	AVSREDSARPGAHAK	244	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=724	5.8714	2	1630.7577	1630.7577	R	V	82	97
PSM	DKEVSDDEAEEK	245	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:21	ms_run[2]:scan=1087	7.5414	2	1472.5556	1472.5556	R	E	227	239
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	246	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	23-UNIMOD:21	ms_run[2]:scan=12872	84.812	3	2892.3583	2892.3583	K	Q	178	204
PSM	HRDYETATLSDIK	247	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6821	44.014	2	1547.758	1547.7580	K	A	219	232
PSM	HRPSPPATPPPK	248	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=1896	11.982	3	1360.6653	1360.6653	R	T	399	411
PSM	HRPSPPATPPPK	249	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=2454	15.593	3	1360.6653	1360.6653	R	T	399	411
PSM	IEDVGSDEEDDSGK	250	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:21	ms_run[2]:scan=3336	21.191	2	1573.5669	1573.5669	K	D	250	264
PSM	KHEFMSDTNLSEHAAIPLK	251	sp|Q92608|DOCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=9543	61.793	3	2263.0344	2263.0344	R	A	1726	1745
PSM	KKDSLHGSTGAVNATR	252	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:21	ms_run[2]:scan=1357	8.7855	3	1720.8258	1720.8258	K	P	371	387
PSM	KKPAPLPPSSSPGPPSQDSR	253	sp|Q8N3F8|MILK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	16-UNIMOD:21	ms_run[2]:scan=3907	24.929	3	2109.0256	2109.0256	K	Q	381	401
PSM	KKPAPLPPSSSPGPPSQDSR	254	sp|Q8N3F8|MILK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:21	ms_run[2]:scan=4495	28.604	3	2109.0256	2109.0256	K	Q	381	401
PSM	KVVVSHSTHR	255	sp|Q7L2H7-2|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:21	ms_run[2]:scan=654	5.577	2	1228.6078	1228.6078	R	T	199	209
PSM	LKDLFDYSPPLHK	256	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:21	ms_run[2]:scan=13370	88.323	2	1651.8011	1651.8011	K	N	505	518
PSM	LSSESHHGGSPIHWVLPAGMSAK	257	sp|Q96MU7-2|YTDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:21,20-UNIMOD:35	ms_run[2]:scan=10645	69.374	3	2480.1308	2480.1308	R	M	397	420
PSM	RATSPSSSVSGDFDDGHHSVSTPGPSR	258	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=6782	43.769	3	2806.1944	2806.1944	R	K	7	34
PSM	RGESLDNLDSPR	259	sp|Q8WWI1-4|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=6185	39.93	2	1437.6249	1437.6249	R	S	1507	1519
PSM	RHDEDEDDSLK	260	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1034	7.3032	3	1357.5746	1357.5746	R	D	1329	1340
PSM	RHDSVENSDSHVEK	261	sp|Q9H9J4-2|UBP42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=758	6.0128	3	1717.7057	1717.7057	R	K	1163	1177
PSM	RHPPDDDLSQDSPEQEASKSPR	262	sp|Q9P0K8-2|FOXJ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:21	ms_run[2]:scan=4398	27.986	3	2570.1035	2570.1035	R	G	153	175
PSM	RHSVDTSPGYHESDSK	263	sp|Q86XR7|TCAM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=1256	8.3253	3	1880.769	1880.7690	K	K	20	36
PSM	RKTPEASAIGLHQDPELGDAALR	264	sp|Q13615-3|MTMR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=10267	66.786	3	2524.2435	2524.2435	R	S	729	752
PSM	RPGHGSLTNISR	265	sp|Q7Z6B7-2|SRGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:21	ms_run[2]:scan=3104	19.674	2	1373.6565	1373.6565	R	H	889	901
PSM	RPHTPTPGIYMGR	266	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5579	35.666	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	267	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=6594	42.559	2	1561.7225	1561.7225	K	P	98	111
PSM	RRPLLPPTPDSGPEGESSE	268	sp|Q8NBR0|P5I13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	18-UNIMOD:21	ms_run[2]:scan=9361	60.638	3	2099.9525	2099.9525	R	-	375	394
PSM	TQAHSGSPTYLQLPPRPPGTR	269	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:21	ms_run[2]:scan=10948	71.386	3	2340.1376	2340.1376	R	A	323	344
PSM	VKDRDDFPVVLVGNK	270	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10192	66.265	3	1699.9257	1699.9257	R	A	129	144
PSM	VREEEIEVDSR	271	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4274	27.251	2	1359.663	1359.6630	R	V	628	639
PSM	YHGHSMSDPGVSYR	272	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=2918	18.52	3	1687.645	1687.6450	R	T	258	272
PSM	APTVPPPLPPTPPQPAR	273	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=10372	67.49629166666666	2	1812.935024	1811.933522	R	R	616	633
PSM	SETAPAETATPAPVEK	274	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=6659	42.97139333333333	2	1719.7596	1719.7599	M	S	2	18
PSM	GPPSPPAPVMHSPSR	275	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=4399	27.989738333333335	2	1608.707465	1608.711978	R	K	221	236
PSM	RTLSDPPSPLPHGPPNK	276	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=7537	48.73383666666666	2	1888.918209	1888.919663	K	G	836	853
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	277	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	26-UNIMOD:21	ms_run[1]:scan=9182	59.45648666666667	3	2826.304844	2826.304613	R	F	52	81
t_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=6594	42.559245000000004	2	1561.721844	1561.722483	K	P	198	211
PSM	GPPSPPAPVMHSPSR	272	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=4399	27.989738333333335	2	1608.707465	1608.711978	R	K	221	236
PSM	AVSREDSARPGAHAK	273	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=724	5.87143	2	1630.757050	1630.757683	R	V	82	97
PSM	RHDSVENSDSHVEK	274	sp|Q9H9J4|UBP42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=758	6.012783333333333	3	1717.704108	1717.705707	R	K	1163	1177
PSM	RTLSDPPSPLPHGPPNK	275	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=7537	48.73383666666666	2	1888.918209	1888.919663	K	G	836	853
PSM	AIFDGASTPTHHLSLHSDDSSTK	276	sp|Q9BSQ5|CCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:21	ms_run[1]:scan=9430	61.08739333333334	2	2503.100501	2503.101662	R	V	232	255
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	277	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	26-UNIMOD:21	ms_run[1]:scan=9182	59.45648666666667	3	2826.304844	2826.304613	R	F	52	81
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	278	sp|O60256|KPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=13563	89.66315166666668	3	3064.442152	3064.443749	R	S	205	233
PSM	ALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPK	279	sp|P48436|SOX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35,31-UNIMOD:21	ms_run[1]:scan=5937	38.205128333333334	3	3802.650065	3802.653027	K	T	206	243