MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000099 -- new2
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204350615591^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\130326miao_11_PTS_800.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=uniprot_ecoli_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_ecoli_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Phospho (D),Phospho (H),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.uniprot_ecoli_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M),Phospho (D),Phospho (H),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	D
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	H
MTD	variable_mod[6]-position	Anywhere
MTD	variable_mod[7]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[7]-site	N-term
MTD	variable_mod[7]-position	Protein N-term
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P0A953|FABB_ECOLI	3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) OX=83333 GN=fabB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	44.0	null	163-UNIMOD:4,169-UNIMOD:4	0.18	44.0	5	5	5
PRT	sp|P0A6E6|ATPE_ECOLI	ATP synthase epsilon chain OS=Escherichia coli (strain K12) OX=83333 GN=atpC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	3-UNIMOD:35	0.17	41.0	1	1	1
PRT	sp|P0CE47|EFTU1_ECOLI	Elongation factor Tu 1 OS=Escherichia coli (strain K12) OX=83333 GN=tufA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	82-UNIMOD:4,256-UNIMOD:4,261-UNIMOD:35,254-UNIMOD:21,369-UNIMOD:35,138-UNIMOD:4	0.36	39.0	32	11	8
PRT	sp|P36938|PGM_ECOLI	Phosphoglucomutase OS=Escherichia coli (strain K12) OX=83333 GN=pgm PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	38.0	null	146-UNIMOD:21,147-UNIMOD:21,144-UNIMOD:21	0.07	38.0	6	3	1
PRT	sp|P0ADB1|OSME_ECOLI	Osmotically-inducible putative lipoprotein OsmE OS=Escherichia coli (strain K12) OX=83333 GN=osmE PE=2 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	37.0	null	61-UNIMOD:35	0.28	37.0	4	2	0
PRT	sp|P63284|CLPB_ECOLI	Chaperone protein ClpB OS=Escherichia coli (strain K12) OX=83333 GN=clpB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	37.0	null	310-UNIMOD:4	0.08	37.0	6	5	4
PRT	sp|P0A763|NDK_ECOLI	Nucleoside diphosphate kinase OS=Escherichia coli (strain K12) OX=83333 GN=ndk PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	36.0	null	119-UNIMOD:21	0.17	36.0	2	1	0
PRT	sp|P68066|GRCA_ECOLI	Autonomous glycyl radical cofactor OS=Escherichia coli (strain K12) OX=83333 GN=grcA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	1-UNIMOD:35,109-UNIMOD:21	0.51	36.0	8	6	4
PRT	sp|P37188|PTKB_ECOLI	PTS system galactitol-specific EIIB component OS=Escherichia coli (strain K12) OX=83333 GN=gatB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	9-UNIMOD:4,55-UNIMOD:4,27-UNIMOD:4,39-UNIMOD:4,48-UNIMOD:35	0.60	36.0	11	3	0
PRT	sp|P0AES9|HDEA_ECOLI	Acid stress chaperone HdeA OS=Escherichia coli (strain K12) OX=83333 GN=hdeA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	87-UNIMOD:4	0.26	36.0	3	1	0
PRT	sp|P37330|MASZ_ECOLI	Malate synthase G OS=Escherichia coli (strain K12) OX=83333 GN=glcB PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P0AEE5|DGAL_ECOLI	D-galactose-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=mglB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0	null	40-UNIMOD:35,215-UNIMOD:35	0.15	35.0	4	4	4
PRT	sp|P21599|KPYK2_ECOLI	Pyruvate kinase II OS=Escherichia coli (strain K12) OX=83333 GN=pykA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P69828|PTKA_ECOLI	PTS system galactitol-specific EIIA component OS=Escherichia coli (strain K12) OX=83333 GN=gatA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	44-UNIMOD:27,52-UNIMOD:35,63-UNIMOD:4	0.29	34.0	3	3	3
PRT	sp|P37689|GPMI_ECOLI	2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Escherichia coli (strain K12) OX=83333 GN=gpmI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	61-UNIMOD:35,64-UNIMOD:21,424-UNIMOD:4,60-UNIMOD:28	0.08	33.0	13	3	2
PRT	sp|P0A910|OMPA_ECOLI	Outer membrane protein A OS=Escherichia coli (strain K12) OX=83333 GN=ompA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0	null	300-UNIMOD:35,311-UNIMOD:4,323-UNIMOD:4	0.15	33.0	4	4	4
PRT	sp|P39177|USPG_ECOLI	Universal stress protein UP12 OS=Escherichia coli (strain K12) OX=83333 GN=uspG PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.37	33.0	7	3	2
PRT	sp|P0AA25|THIO_ECOLI	Thioredoxin 1 OS=Escherichia coli (strain K12) OX=83333 GN=trxA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.27	33.0	2	2	2
PRT	sp|P52697|6PGL_ECOLI	6-phosphogluconolactonase OS=Escherichia coli (strain K12) OX=83333 GN=pgl PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	214-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|P0AFH8|OSMY_ECOLI	Osmotically-inducible protein Y OS=Escherichia coli (strain K12) OX=83333 GN=osmY PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null		0.34	32.0	13	5	4
PRT	sp|P68206|YJBJ_ECOLI	UPF0337 protein YjbJ OS=Escherichia coli (strain K12) OX=83333 GN=yjbJ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null		0.32	32.0	3	2	1
PRT	sp|P08839|PT1_ECOLI	Phosphoenolpyruvate-protein phosphotransferase OS=Escherichia coli (strain K12) OX=83333 GN=ptsI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	2	2
PRT	sp|P0A6K6|DEOB_ECOLI	Phosphopentomutase OS=Escherichia coli (strain K12) OX=83333 GN=deoB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	3	2	1
PRT	sp|P31658|HCHA_ECOLI	Protein/nucleic acid deglycase 1 OS=Escherichia coli (strain K12) OX=83333 GN=hchA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	null	207-UNIMOD:4,238-UNIMOD:35,240-UNIMOD:35	0.16	31.0	6	3	2
PRT	sp|P0ABB0|ATPA_ECOLI	ATP synthase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=atpA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	null	47-UNIMOD:4	0.10	31.0	4	4	4
PRT	sp|P0ACF8|HNS_ECOLI	DNA-binding protein H-NS OS=Escherichia coli (strain K12) OX=83333 GN=hns PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null	45-UNIMOD:21,129-UNIMOD:21	0.29	30.0	8	5	3
PRT	sp|P0AF12|MTNN_ECOLI	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase OS=Escherichia coli (strain K12) OX=83333 GN=mtnN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P0ADU5|YGIW_ECOLI	Protein YgiW OS=Escherichia coli (strain K12) OX=83333 GN=ygiW PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null	72-UNIMOD:21	0.17	30.0	10	2	0
PRT	sp|P69441|KAD_ECOLI	Adenylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=adk PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.13	30.0	2	2	2
PRT	sp|P0ACD4|ISCU_ECOLI	Iron-sulfur cluster assembly scaffold protein IscU OS=Escherichia coli (strain K12) OX=83333 GN=iscU PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P0A6Y8|DNAK_ECOLI	Chaperone protein DnaK OS=Escherichia coli (strain K12) OX=83333 GN=dnaK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null	332-UNIMOD:21,87-UNIMOD:21	0.26	30.0	17	16	15
PRT	sp|P0A799|PGK_ECOLI	Phosphoglycerate kinase OS=Escherichia coli (strain K12) OX=83333 GN=pgk PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	380-UNIMOD:35,199-UNIMOD:21,6-UNIMOD:35	0.25	30.0	12	7	4
PRT	sp|P0ACF0|DBHA_ECOLI	DNA-binding protein HU-alpha OS=Escherichia coli (strain K12) OX=83333 GN=hupA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	null	4-UNIMOD:21	0.28	30.0	3	2	1
PRT	sp|P0A870|TALB_ECOLI	Transaldolase B OS=Escherichia coli (strain K12) OX=83333 GN=talB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	215-UNIMOD:27,223-UNIMOD:35,226-UNIMOD:21	0.28	29.0	9	8	7
PRT	sp|P0A6M8|EFG_ECOLI	Elongation factor G OS=Escherichia coli (strain K12) OX=83333 GN=fusA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.03	29.0	2	2	2
PRT	sp|P0A7R1|RL9_ECOLI	50S ribosomal protein L9 OS=Escherichia coli (strain K12) OX=83333 GN=rplI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1-UNIMOD:35	0.21	29.0	6	4	2
PRT	sp|P0A7N4|RL32_ECOLI	50S ribosomal protein L32 OS=Escherichia coli (strain K12) OX=83333 GN=rpmF PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.49	29.0	2	2	2
PRT	sp|P61316|LOLA_ECOLI	Outer-membrane lipoprotein carrier protein OS=Escherichia coli (strain K12) OX=83333 GN=lolA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.14	29.0	2	2	2
PRT	sp|P23857|PSPE_ECOLI	Thiosulfate sulfurtransferase PspE OS=Escherichia coli (strain K12) OX=83333 GN=pspE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.18	29.0	1	1	1
PRT	sp|P45523|FKBA_ECOLI	FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli (strain K12) OX=83333 GN=fkpA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.21	29.0	4	4	4
PRT	sp|P0A9B2|G3P1_ECOLI	Glyceraldehyde-3-phosphate dehydrogenase A OS=Escherichia coli (strain K12) OX=83333 GN=gapA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.16	29.0	4	4	4
PRT	sp|P0A9L3|FKBB_ECOLI	FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase OS=Escherichia coli (strain K12) OX=83333 GN=fklB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P69908|DCEA_ECOLI	Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) OX=83333 GN=gadA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	null	130-UNIMOD:4,462-UNIMOD:21,76-UNIMOD:35	0.13	28.0	8	5	2
PRT	sp|P0ADE6|KBP_ECOLI	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.29	28.0	4	4	4
PRT	sp|P0A817|METK_ECOLI	S-adenosylmethionine synthase OS=Escherichia coli (strain K12) OX=83333 GN=metK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	2	2	2
PRT	sp|P0A8N5|SYK2_ECOLI	Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) OX=83333 GN=lysU PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	133-UNIMOD:21,140-UNIMOD:4	0.12	28.0	4	4	4
PRT	sp|P08331|CPDB_ECOLI	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P0A912|PAL_ECOLI	Peptidoglycan-associated lipoprotein OS=Escherichia coli (strain K12) OX=83333 GN=pal PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	43-UNIMOD:35,52-UNIMOD:35,36-UNIMOD:35	0.29	28.0	8	2	1
PRT	sp|P0A6P9|ENO_ECOLI	Enolase OS=Escherichia coli (strain K12) OX=83333 GN=eno PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null	185-UNIMOD:35	0.15	27.0	7	5	3
PRT	sp|P0A901|BLC_ECOLI	Outer membrane lipoprotein Blc OS=Escherichia coli (strain K12) OX=83333 GN=blc PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P0A6P1|EFTS_ECOLI	Elongation factor Ts OS=Escherichia coli (strain K12) OX=83333 GN=tsf PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	7-UNIMOD:21	0.15	27.0	6	4	3
PRT	sp|P30749|MOAE_ECOLI	Molybdopterin synthase catalytic subunit OS=Escherichia coli (strain K12) OX=83333 GN=moaE PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P62768|YAEH_ECOLI	UPF0325 protein YaeH OS=Escherichia coli (strain K12) OX=83333 GN=yaeH PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.16	27.0	2	2	2
PRT	sp|P09551|ARGT_ECOLI	Lysine/arginine/ornithine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=argT PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P0A850|TIG_ECOLI	Trigger factor OS=Escherichia coli (strain K12) OX=83333 GN=tig PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null	288-UNIMOD:21	0.11	27.0	5	4	3
PRT	sp|P0AG86|SECB_ECOLI	Protein-export protein SecB OS=Escherichia coli (strain K12) OX=83333 GN=secB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	2	2	2
PRT	sp|P0AFK9|POTD_ECOLI	Spermidine/putrescine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=potD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null		0.22	27.0	7	5	4
PRT	sp|P08200|IDH_ECOLI	Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) OX=83333 GN=icd PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null	113-UNIMOD:21	0.05	27.0	8	2	1
PRT	sp|P0C8J6|GATY_ECOLI	D-tagatose-1,6-bisphosphate aldolase subunit GatY OS=Escherichia coli (strain K12) OX=83333 GN=gatY PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	72-UNIMOD:28,278-UNIMOD:4,280-UNIMOD:4,233-UNIMOD:21	0.27	27.0	8	7	6
PRT	sp|P0A955|ALKH_ECOLI	KHG/KDPG aldolase OS=Escherichia coli (strain K12) OX=83333 GN=eda PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null	159-UNIMOD:4,52-UNIMOD:4	0.23	27.0	4	4	4
PRT	sp|P0A7S9|RS13_ECOLI	30S ribosomal protein S13 OS=Escherichia coli (strain K12) OX=83333 GN=rpsM PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	2	2	2
PRT	sp|P21513|RNE_ECOLI	Ribonuclease E OS=Escherichia coli (strain K12) OX=83333 GN=rne PE=1 SV=6	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P64581|YQJD_ECOLI	Uncharacterized protein YqjD OS=Escherichia coli (strain K12) OX=83333 GN=yqjD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P62707|GPMA_ECOLI	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) OX=83333 GN=gpmA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null	91-UNIMOD:21	0.12	26.0	5	3	1
PRT	sp|P75691|YAHK_ECOLI	Aldehyde reductase YahK OS=Escherichia coli (strain K12) OX=83333 GN=yahK PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	2	2	2
PRT	sp|P0A8E7|YAJQ_ECOLI	UPF0234 protein YajQ OS=Escherichia coli (strain K12) OX=83333 GN=yajQ PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P02359|RS7_ECOLI	30S ribosomal protein S7 OS=Escherichia coli (strain K12) OX=83333 GN=rpsG PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.18	26.0	3	3	3
PRT	sp|P77774|BAMB_ECOLI	Outer membrane protein assembly factor BamB OS=Escherichia coli (strain K12) OX=83333 GN=bamB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P0AF36|ZAPB_ECOLI	Cell division protein ZapB OS=Escherichia coli (strain K12) OX=83333 GN=zapB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.20	26.0	1	1	1
PRT	sp|P06959|ODP2_ECOLI	Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) OX=83333 GN=aceF PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.09	26.0	5	5	5
PRT	sp|P0A9S3|GATD_ECOLI	Galactitol 1-phosphate 5-dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=gatD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null	187-UNIMOD:21,195-UNIMOD:21	0.12	26.0	6	4	3
PRT	sp|P46130|YBHC_ECOLI	Putative acyl-CoA thioester hydrolase YbhC OS=Escherichia coli (strain K12) OX=83333 GN=ybhC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P0A9P0|DLDH_ECOLI	Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=lpdA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	26.0	null	392-UNIMOD:4	0.08	26.0	3	3	3
PRT	sp|P0AFF6|NUSA_ECOLI	Transcription termination/antitermination protein NusA OS=Escherichia coli (strain K12) OX=83333 GN=nusA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P21367|YCAC_ECOLI	Probable hydrolase YcaC OS=Escherichia coli (strain K12) OX=83333 GN=ycaC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P0AG48|RL21_ECOLI	50S ribosomal protein L21 OS=Escherichia coli (strain K12) OX=83333 GN=rplU PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1-UNIMOD:35	0.43	26.0	3	3	3
PRT	sp|P0A7U7|RS20_ECOLI	30S ribosomal protein S20 OS=Escherichia coli (strain K12) OX=83333 GN=rpsT PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.24	25.0	2	2	2
PRT	sp|P37759|RMLB1_ECOLI	dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfbB PE=3 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	2	2	2
PRT	sp|P0AEM9|FLIY_ECOLI	L-cystine-binding protein FliY OS=Escherichia coli (strain K12) OX=83333 GN=fliY PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P12758|UDP_ECOLI	Uridine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=udp PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	2	2	2
PRT	sp|P60422|RL2_ECOLI	50S ribosomal protein L2 OS=Escherichia coli (strain K12) OX=83333 GN=rplB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.19	25.0	5	4	3
PRT	sp|P0A998|FTNA_ECOLI	Bacterial non-heme ferritin OS=Escherichia coli (strain K12) OX=83333 GN=ftnA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P00946|MANA_ECOLI	Mannose-6-phosphate isomerase OS=Escherichia coli (strain K12) OX=83333 GN=manA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P0ADZ7|YAJC_ECOLI	Sec translocon accessory complex subunit YajC OS=Escherichia coli (strain K12) OX=83333 GN=yajC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|P0ABS1|DKSA_ECOLI	RNA polymerase-binding transcription factor DksA OS=Escherichia coli (strain K12) OX=83333 GN=dksA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null	135-UNIMOD:4,138-UNIMOD:4	0.23	25.0	3	3	3
PRT	sp|P23827|ECOT_ECOLI	Ecotin OS=Escherichia coli (strain K12) OX=83333 GN=eco PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|P0C8J8|GATZ_ECOLI	D-tagatose-1,6-bisphosphate aldolase subunit GatZ OS=Escherichia coli (strain K12) OX=83333 GN=gatZ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null	265-UNIMOD:21,351-UNIMOD:21	0.13	25.0	6	6	6
PRT	sp|P39187|YTFJ_ECOLI	Uncharacterized protein YtfJ OS=Escherichia coli (strain K12) OX=83333 GN=ytfJ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|P60723|RL4_ECOLI	50S ribosomal protein L4 OS=Escherichia coli (strain K12) OX=83333 GN=rplD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	3	3	3
PRT	sp|P0ABA0|ATPF_ECOLI	ATP synthase subunit b OS=Escherichia coli (strain K12) OX=83333 GN=atpF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	2	1	0
PRT	sp|P0A8G6|NQOR_ECOLI	NAD(P)H dehydrogenase (quinone) OS=Escherichia coli (strain K12) OX=83333 GN=wrbA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	83-UNIMOD:35	0.10	24.0	3	2	1
PRT	sp|P0A7V8|RS4_ECOLI	30S ribosomal protein S4 OS=Escherichia coli (strain K12) OX=83333 GN=rpsD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	2	2	2
PRT	sp|P0A6F5|CH60_ECOLI	60 kDa chaperonin OS=Escherichia coli (strain K12) OX=83333 GN=groL PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	3	3	3
PRT	sp|P0AB71|ALF_ECOLI	Fructose-bisphosphate aldolase class 2 OS=Escherichia coli (strain K12) OX=83333 GN=fbaA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	2	2	2
PRT	sp|P0ABH9|CLPA_ECOLI	ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli (strain K12) OX=83333 GN=clpA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	2	2	2
PRT	sp|P25516|ACNA_ECOLI	Aconitate hydratase A OS=Escherichia coli (strain K12) OX=83333 GN=acnA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	3	3	3
PRT	sp|P0ABU5|ELBB_ECOLI	Glyoxalase ElbB OS=Escherichia coli (strain K12) OX=83333 GN=elbB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	38-UNIMOD:4	0.10	24.0	2	2	2
PRT	sp|P0A8M3|SYT_ECOLI	Threonine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=thrS PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P63020|NFUA_ECOLI	Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12) OX=83333 GN=nfuA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.18	24.0	3	3	3
PRT	sp|P0AFD6|NUOI_ECOLI	NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain K12) OX=83333 GN=nuoI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|P60624|RL24_ECOLI	50S ribosomal protein L24 OS=Escherichia coli (strain K12) OX=83333 GN=rplX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.28	24.0	2	2	2
PRT	sp|P09169|OMPT_ECOLI	Protease 7 OS=Escherichia coli (strain K12) OX=83333 GN=ompT PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P09373|PFLB_ECOLI	Formate acetyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=pflB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	651-UNIMOD:21	0.04	24.0	4	3	2
PRT	sp|P36683|ACNB_ECOLI	Aconitate hydratase B OS=Escherichia coli (strain K12) OX=83333 GN=acnB PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	3	3	3
PRT	sp|P60438|RL3_ECOLI	50S ribosomal protein L3 OS=Escherichia coli (strain K12) OX=83333 GN=rplC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null		0.16	24.0	2	2	2
PRT	sp|P0ADE8|YGFZ_ECOLI	tRNA-modifying protein YgfZ OS=Escherichia coli (strain K12) OX=83333 GN=ygfZ PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	3	2	1
PRT	sp|P0AC92|GNSA_ECOLI	Protein GnsA OS=Escherichia coli (strain K12) OX=83333 GN=gnsA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.19	24.0	1	1	1
PRT	sp|P08997|MASY_ECOLI	Malate synthase A OS=Escherichia coli (strain K12) OX=83333 GN=aceB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	409-UNIMOD:4,274-UNIMOD:4,165-UNIMOD:4	0.22	24.0	13	10	7
PRT	sp|P0A6F9|CH10_ECOLI	10 kDa chaperonin OS=Escherichia coli (strain K12) OX=83333 GN=groS PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	28-UNIMOD:21	0.40	24.0	3	3	3
PRT	sp|P0A805|RRF_ECOLI	Ribosome-recycling factor OS=Escherichia coli (strain K12) OX=83333 GN=frr PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	56-UNIMOD:21,62-UNIMOD:21	0.18	24.0	5	3	2
PRT	sp|P0AEP3|GALU_ECOLI	UTP--glucose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=galU PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	2	2	2
PRT	sp|P0AG51|RL30_ECOLI	50S ribosomal protein L30 OS=Escherichia coli (strain K12) OX=83333 GN=rpmD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.37	24.0	2	2	2
PRT	sp|P0A6A8|ACP_ECOLI	Acyl carrier protein OS=Escherichia coli (strain K12) OX=83333 GN=acpP PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.36	24.0	3	3	3
PRT	sp|P0AA04|PTHP_ECOLI	Phosphocarrier protein HPr OS=Escherichia coli (strain K12) OX=83333 GN=ptsH PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.28	24.0	1	1	1
PRT	sp|P76402|YEGP_ECOLI	UPF0339 protein YegP OS=Escherichia coli (strain K12) OX=83333 GN=yegP PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.15	24.0	1	1	1
PRT	sp|P0AC38|ASPA_ECOLI	Aspartate ammonia-lyase OS=Escherichia coli (strain K12) OX=83333 GN=aspA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.08	24.0	3	3	3
PRT	sp|P0C0L2|OSMC_ECOLI	Peroxiredoxin OsmC OS=Escherichia coli (strain K12) OX=83333 GN=osmC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	125-UNIMOD:4	0.22	24.0	3	3	3
PRT	sp|P0AE88|CPXR_ECOLI	Transcriptional regulatory protein CpxR OS=Escherichia coli (strain K12) OX=83333 GN=cpxR PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|P37666|GHRB_ECOLI	Glyoxylate/hydroxypyruvate reductase B OS=Escherichia coli (strain K12) OX=83333 GN=ghrB PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P0A7K2|RL7_ECOLI	50S ribosomal protein L7/L12 OS=Escherichia coli (strain K12) OX=83333 GN=rplL PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	null	53-UNIMOD:21	0.36	24.0	4	3	2
PRT	sp|P39180|AG43_ECOLI	Antigen 43 OS=Escherichia coli (strain K12) OX=83333 GN=flu PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	3	3	3
PRT	sp|P02358|RS6_ECOLI	30S ribosomal protein S6 OS=Escherichia coli (strain K12) OX=83333 GN=rpsF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.24	23.0	3	3	3
PRT	sp|P23538|PPSA_ECOLI	Phosphoenolpyruvate synthase OS=Escherichia coli (strain K12) OX=83333 GN=ppsA PE=1 SV=5	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	419-UNIMOD:21,420-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P07003|POXB_ECOLI	Pyruvate dehydrogenase [ubiquinone] OS=Escherichia coli (strain K12) OX=83333 GN=poxB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P02413|RL15_ECOLI	50S ribosomal protein L15 OS=Escherichia coli (strain K12) OX=83333 GN=rplO PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|P0A7D4|PURA_ECOLI	Adenylosuccinate synthetase OS=Escherichia coli (strain K12) OX=83333 GN=purA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.09	23.0	4	3	2
PRT	sp|P04825|AMPN_ECOLI	Aminopeptidase N OS=Escherichia coli (strain K12) OX=83333 GN=pepN PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	732-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|P00448|SODM_ECOLI	Superoxide dismutase [Mn] OS=Escherichia coli (strain K12) OX=83333 GN=sodA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null		0.15	23.0	2	2	2
PRT	sp|P75818|YBJP_ECOLI	Uncharacterized lipoprotein YbjP OS=Escherichia coli (strain K12) OX=83333 GN=ybjP PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P0A9K9|SLYD_ECOLI	FKBP-type peptidyl-prolyl cis-trans isomerase SlyD OS=Escherichia coli (strain K12) OX=83333 GN=slyD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P69783|PTGA_ECOLI	PTS system glucose-specific EIIA component OS=Escherichia coli (strain K12) OX=83333 GN=crr PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.14	23.0	2	2	2
PRT	sp|P00509|AAT_ECOLI	Aspartate aminotransferase OS=Escherichia coli (strain K12) OX=83333 GN=aspC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	139-UNIMOD:21	0.08	23.0	3	3	3
PRT	sp|P0A8V6|FADR_ECOLI	Fatty acid metabolism regulator protein OS=Escherichia coli (strain K12) OX=83333 GN=fadR PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	187-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P0A7J3|RL10_ECOLI	50S ribosomal protein L10 OS=Escherichia coli (strain K12) OX=83333 GN=rplJ PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	24-UNIMOD:21,71-UNIMOD:4	0.15	23.0	2	2	2
PRT	sp|P0A853|TNAA_ECOLI	Tryptophanase OS=Escherichia coli (strain K12) OX=83333 GN=tnaA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	148-UNIMOD:4,226-UNIMOD:35,263-UNIMOD:35	0.21	23.0	10	8	6
PRT	sp|P0A6I0|KCY_ECOLI	Cytidylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=cmk PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P0AD61|KPYK1_ECOLI	Pyruvate kinase I OS=Escherichia coli (strain K12) OX=83333 GN=pykF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	2	2
PRT	sp|P0A7L0|RL1_ECOLI	50S ribosomal protein L1 OS=Escherichia coli (strain K12) OX=83333 GN=rplA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	2	2	2
PRT	sp|P39176|ERFK_ECOLI	Probable L,D-transpeptidase ErfK/SrfK OS=Escherichia coli (strain K12) OX=83333 GN=erfK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	2	2	2
PRT	sp|P02943|LAMB_ECOLI	Maltoporin OS=Escherichia coli (strain K12) OX=83333 GN=lamB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P0A9G6|ACEA_ECOLI	Isocitrate lyase OS=Escherichia coli (strain K12) OX=83333 GN=aceA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.16	23.0	6	6	6
PRT	sp|P0A6X7|IHFA_ECOLI	Integration host factor subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ihfA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.22	23.0	2	2	2
PRT	sp|P0A6A3|ACKA_ECOLI	Acetate kinase OS=Escherichia coli (strain K12) OX=83333 GN=ackA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	11-UNIMOD:4	0.09	23.0	2	2	2
PRT	sp|P60546|KGUA_ECOLI	Guanylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=gmk PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	18-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P0A7M2|RL28_ECOLI	50S ribosomal protein L28 OS=Escherichia coli (strain K12) OX=83333 GN=rpmB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null	66-UNIMOD:21	0.14	23.0	2	1	0
PRT	sp|P66948|BEPA_ECOLI	Beta-barrel assembly-enhancing protease OS=Escherichia coli (strain K12) OX=83333 GN=bepA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P37903|USPF_ECOLI	Universal stress protein F OS=Escherichia coli (strain K12) OX=83333 GN=uspF PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	70-UNIMOD:21	0.15	22.0	4	3	2
PRT	sp|P68191|SRA_ECOLI	Stationary-phase-induced ribosome-associated protein OS=Escherichia coli (strain K12) OX=83333 GN=sra PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.20	22.0	1	1	1
PRT	sp|P31063|YEDD_ECOLI	Uncharacterized lipoprotein YedD OS=Escherichia coli (strain K12) OX=83333 GN=yedD PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	123-UNIMOD:4	0.11	22.0	1	1	1
PRT	sp|P0ABT2|DPS_ECOLI	DNA protection during starvation protein OS=Escherichia coli (strain K12) OX=83333 GN=dps PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.31	22.0	6	6	6
PRT	sp|P23843|OPPA_ECOLI	Periplasmic oligopeptide-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=oppA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.19	22.0	15	11	8
PRT	sp|P0AE08|AHPC_ECOLI	Alkyl hydroperoxide reductase C OS=Escherichia coli (strain K12) OX=83333 GN=ahpC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	166-UNIMOD:4,111-UNIMOD:35,146-UNIMOD:21,84-UNIMOD:21	0.34	22.0	12	6	2
PRT	sp|P0A7J7|RL11_ECOLI	50S ribosomal protein L11 OS=Escherichia coli (strain K12) OX=83333 GN=rplK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.20	22.0	3	3	3
PRT	sp|P0AC41|SDHA_ECOLI	Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) OX=83333 GN=sdhA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P0A9Y6|CSPC_ECOLI	Cold shock-like protein CspC OS=Escherichia coli (strain K12) OX=83333 GN=cspC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.39	22.0	3	2	1
PRT	sp|P0A8R0|RRAA_ECOLI	Regulator of ribonuclease activity A OS=Escherichia coli (strain K12) OX=83333 GN=rraA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P0A7A9|IPYR_ECOLI	Inorganic pyrophosphatase OS=Escherichia coli (strain K12) OX=83333 GN=ppa PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.18	22.0	3	3	3
PRT	sp|P0AF93|RIDA_ECOLI	2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=ridA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.16	22.0	2	2	2
PRT	sp|P75874|YCCU_ECOLI	Uncharacterized protein YccU OS=Escherichia coli (strain K12) OX=83333 GN=yccU PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	122-UNIMOD:35	0.08	22.0	2	1	0
PRT	sp|P27248|GCST_ECOLI	Aminomethyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=gcvT PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	219-UNIMOD:4	0.07	22.0	2	2	2
PRT	sp|P0A7W1|RS5_ECOLI	30S ribosomal protein S5 OS=Escherichia coli (strain K12) OX=83333 GN=rpsE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	2	2	2
PRT	sp|P0ACG1|STPA_ECOLI	DNA-binding protein StpA OS=Escherichia coli (strain K12) OX=83333 GN=stpA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	4-UNIMOD:35	0.09	22.0	1	1	1
PRT	sp|P00805|ASPG2_ECOLI	L-asparaginase 2 OS=Escherichia coli (strain K12) OX=83333 GN=ansB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	3	3	3
PRT	sp|P0A855|TOLB_ECOLI	Tol-Pal system protein TolB OS=Escherichia coli (strain K12) OX=83333 GN=tolB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P0AF50|YJBR_ECOLI	Uncharacterized protein YjbR OS=Escherichia coli (strain K12) OX=83333 GN=yjbR PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	null	52-UNIMOD:21	0.19	22.0	2	2	2
PRT	sp|P68679|RS21_ECOLI	30S ribosomal protein S21 OS=Escherichia coli (strain K12) OX=83333 GN=rpsU PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.28	21.0	2	2	2
PRT	sp|P0AAT9|YBEL_ECOLI	Uncharacterized protein YbeL OS=Escherichia coli (strain K12) OX=83333 GN=ybeL PE=4 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null	79-UNIMOD:35	0.23	21.0	4	4	4
PRT	sp|P0AG55|RL6_ECOLI	50S ribosomal protein L6 OS=Escherichia coli (strain K12) OX=83333 GN=rplF PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.12	21.0	2	2	2
PRT	sp|P13029|KATG_ECOLI	Catalase-peroxidase OS=Escherichia coli (strain K12) OX=83333 GN=katG PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null	16-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P0A7M9|RL31_ECOLI	50S ribosomal protein L31 OS=Escherichia coli (strain K12) OX=83333 GN=rpmE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null	40-UNIMOD:4,16-UNIMOD:4,18-UNIMOD:4,22-UNIMOD:35	0.49	21.0	3	3	3
PRT	sp|P0AEH5|ELAB_ECOLI	Protein ElaB OS=Escherichia coli (strain K12) OX=83333 GN=elaB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|P61889|MDH_ECOLI	Malate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=mdh PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null	154-UNIMOD:21,227-UNIMOD:35,251-UNIMOD:4	0.22	21.0	6	5	4
PRT	sp|P02925|RBSB_ECOLI	Ribose import binding protein RbsB OS=Escherichia coli (strain K12) OX=83333 GN=rbsB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P28635|METQ_ECOLI	D-methionine-binding lipoprotein MetQ OS=Escherichia coli (strain K12) OX=83333 GN=metQ PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P19926|AGP_ECOLI	Glucose-1-phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=agp PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|P0A905|SLYB_ECOLI	Outer membrane lipoprotein SlyB OS=Escherichia coli (strain K12) OX=83333 GN=slyB PE=2 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	2	2	2
PRT	sp|P65294|YGDR_ECOLI	Uncharacterized lipoprotein YgdR OS=Escherichia coli (strain K12) OX=83333 GN=ygdR PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.14	21.0	1	1	1
PRT	sp|P0AFX0|HPF_ECOLI	Ribosome hibernation promoting factor OS=Escherichia coli (strain K12) OX=83333 GN=hpf PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	1	1	1
PRT	sp|P0A972|CSPE_ECOLI	Cold shock-like protein CspE OS=Escherichia coli (strain K12) OX=83333 GN=cspE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.16	21.0	2	1	0
PRT	sp|P0A6N4|EFP_ECOLI	Elongation factor P OS=Escherichia coli (strain K12) OX=83333 GN=efp PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	3-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P0A7R5|RS10_ECOLI	30S ribosomal protein S10 OS=Escherichia coli (strain K12) OX=83333 GN=rpsJ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	2	1	0
PRT	sp|P0A6D7|AROK_ECOLI	Shikimate kinase 1 OS=Escherichia coli (strain K12) OX=83333 GN=aroK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|P26646|ACUI_ECOLI	Probable acrylyl-CoA reductase AcuI OS=Escherichia coli (strain K12) OX=83333 GN=acuI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	2	2	2
PRT	sp|P77247|HXPB_ECOLI	Hexitol phosphatase B OS=Escherichia coli (strain K12) OX=83333 GN=hxpB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P0A9A6|FTSZ_ECOLI	Cell division protein FtsZ OS=Escherichia coli (strain K12) OX=83333 GN=ftsZ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	2	2	2
PRT	sp|P07118|SYV_ECOLI	Valine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=valS PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P0A6H1|CLPX_ECOLI	ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) OX=83333 GN=clpX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P0ADA5|YAJG_ECOLI	Uncharacterized lipoprotein YajG OS=Escherichia coli (strain K12) OX=83333 GN=yajG PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.19	21.0	3	3	3
PRT	sp|P0A7T3|RS16_ECOLI	30S ribosomal protein S16 OS=Escherichia coli (strain K12) OX=83333 GN=rpsP PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.17	21.0	1	1	1
PRT	sp|P22259|PCKA_ECOLI	Phosphoenolpyruvate carboxykinase (ATP) OS=Escherichia coli (strain K12) OX=83333 GN=pckA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	4	3	2
PRT	sp|P36659|CBPA_ECOLI	Curved DNA-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=cbpA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P34209|YDCF_ECOLI	Protein YdcF OS=Escherichia coli (strain K12) OX=83333 GN=ydcF PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P0A8A8|RIMP_ECOLI	Ribosome maturation factor RimP OS=Escherichia coli (strain K12) OX=83333 GN=rimP PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|P0AFG8|ODP1_ECOLI	Pyruvate dehydrogenase E1 component OS=Escherichia coli (strain K12) OX=83333 GN=aceE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	5	5	5
PRT	sp|P06996|OMPC_ECOLI	Outer membrane porin C OS=Escherichia coli (strain K12) OX=83333 GN=ompC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P0A6Q3|FABA_ECOLI	3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=fabA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.23	20.0	4	4	4
PRT	sp|P0A6T1|G6PI_ECOLI	Glucose-6-phosphate isomerase OS=Escherichia coli (strain K12) OX=83333 GN=pgi PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	212-UNIMOD:21	0.08	20.0	4	4	4
PRT	sp|P0C018|RL18_ECOLI	50S ribosomal protein L18 OS=Escherichia coli (strain K12) OX=83333 GN=rplR PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P0AEX9|MALE_ECOLI	Maltose/maltodextrin-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=malE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	4	4	4
PRT	sp|P0AGD3|SODF_ECOLI	Superoxide dismutase [Fe] OS=Escherichia coli (strain K12) OX=83333 GN=sodB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:21	0.09	20.0	2	2	2
PRT	sp|P0A8A2|YEEN_ECOLI	Probable transcriptional regulatory protein YeeN OS=Escherichia coli (strain K12) OX=83333 GN=yeeN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P64463|YDFZ_ECOLI	Putative selenoprotein YdfZ OS=Escherichia coli (strain K12) OX=83333 GN=ydfZ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:4	0.16	20.0	1	1	1
PRT	sp|P0A867|TALA_ECOLI	Transaldolase A OS=Escherichia coli (strain K12) OX=83333 GN=talA PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	73-UNIMOD:4	0.09	20.0	3	2	1
PRT	sp|P04805|SYE_ECOLI	Glutamate--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=gltX PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	138-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P0AG67|RS1_ECOLI	30S ribosomal protein S1 OS=Escherichia coli (strain K12) OX=83333 GN=rpsA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P0ADU2|YGIN_ECOLI	Probable quinol monooxygenase YgiN OS=Escherichia coli (strain K12) OX=83333 GN=ygiN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.19	20.0	2	2	2
PRT	sp|P0AC59|GLRX2_ECOLI	Glutaredoxin 2 OS=Escherichia coli (strain K12) OX=83333 GN=grxB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	9-UNIMOD:4,12-UNIMOD:4	0.10	20.0	2	2	2
PRT	sp|P0A836|SUCC_ECOLI	Succinate--CoA ligase [ADP-forming] subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=sucC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	211-UNIMOD:4	0.11	20.0	4	4	4
PRT	sp|P0C037|PPNP_ECOLI	Pyrimidine/purine nucleoside phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=ppnP PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	20-UNIMOD:21,1-UNIMOD:35,9-UNIMOD:21	0.26	20.0	3	2	1
PRT	sp|P0A6L4|NANA_ECOLI	N-acetylneuraminate lyase OS=Escherichia coli (strain K12) OX=83333 GN=nanA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P06610|BTUE_ECOLI	Thioredoxin/glutathione peroxidase BtuE OS=Escherichia coli (strain K12) OX=83333 GN=btuE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P0AF96|TABA_ECOLI	Toxin-antitoxin biofilm protein TabA OS=Escherichia coli (strain K12) OX=83333 GN=tabA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	132-UNIMOD:4	0.09	20.0	1	1	1
PRT	sp|P0A9Q7|ADHE_ECOLI	Aldehyde-alcohol dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=adhE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P69797|PTNAB_ECOLI	PTS system mannose-specific EIIAB component OS=Escherichia coli (strain K12) OX=83333 GN=manX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P07650|TYPH_ECOLI	Thymidine phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=deoA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	2	2	2
PRT	sp|P0ABP8|DEOD_ECOLI	Purine nucleoside phosphorylase DeoD-type OS=Escherichia coli (strain K12) OX=83333 GN=deoD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	111-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|P0AFR4|YCIO_ECOLI	Uncharacterized protein YciO OS=Escherichia coli (strain K12) OX=83333 GN=yciO PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P0AGL2|TDCF_ECOLI	Putative reactive intermediate deaminase TdcF OS=Escherichia coli (strain K12) OX=83333 GN=tdcF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|P0AFZ1|SSEB_ECOLI	Protein SseB OS=Escherichia coli (strain K12) OX=83333 GN=sseB PE=4 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P0A7L3|RL20_ECOLI	50S ribosomal protein L20 OS=Escherichia coli (strain K12) OX=83333 GN=rplT PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.17	20.0	2	2	2
PRT	sp|P0ABD5|ACCA_ECOLI	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=accA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P0AD49|YFIA_ECOLI	Ribosome-associated inhibitor A OS=Escherichia coli (strain K12) OX=83333 GN=raiA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	9-UNIMOD:28	0.26	20.0	3	3	3
PRT	sp|P0ACA3|SSPA_ECOLI	Stringent starvation protein A OS=Escherichia coli (strain K12) OX=83333 GN=sspA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null		0.15	20.0	2	2	2
PRT	sp|P75694|YAHO_ECOLI	Uncharacterized protein YahO OS=Escherichia coli (strain K12) OX=83333 GN=yahO PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null	46-UNIMOD:21	0.19	20.0	1	1	1
PRT	sp|P0ADV7|MLAC_ECOLI	Intermembrane phospholipid transport system binding protein MlaC OS=Escherichia coli (strain K12) OX=83333 GN=mlaC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|P77804|YDGA_ECOLI	Protein YdgA OS=Escherichia coli (strain K12) OX=83333 GN=ydgA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P0A7U3|RS19_ECOLI	30S ribosomal protein S19 OS=Escherichia coli (strain K12) OX=83333 GN=rpsS PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|P0ACD8|MBHL_ECOLI	Hydrogenase-1 large chain OS=Escherichia coli (strain K12) OX=83333 GN=hyaB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	3	3	3
PRT	sp|P0ABK5|CYSK_ECOLI	Cysteine synthase A OS=Escherichia coli (strain K12) OX=83333 GN=cysK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|P77318|YDEN_ECOLI	Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) OX=83333 GN=ydeN PE=3 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null	132-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|P65292|YGDI_ECOLI	Uncharacterized lipoprotein YgdI OS=Escherichia coli (strain K12) OX=83333 GN=ygdI PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null	70-UNIMOD:35	0.11	19.0	2	1	0
PRT	sp|P0AG63|RS17_ECOLI	30S ribosomal protein S17 OS=Escherichia coli (strain K12) OX=83333 GN=rpsQ PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.11	19.0	1	1	1
PRT	sp|P08244|PYRF_ECOLI	Orotidine 5'-phosphate decarboxylase OS=Escherichia coli (strain K12) OX=83333 GN=pyrF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P0AGD1|SODC_ECOLI	Superoxide dismutase [Cu-Zn] OS=Escherichia coli (strain K12) OX=83333 GN=sodC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P28904|TREC_ECOLI	Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=treC PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null	186-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P0AG44|RL17_ECOLI	50S ribosomal protein L17 OS=Escherichia coli (strain K12) OX=83333 GN=rplQ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.16	19.0	2	2	2
PRT	sp|P0A715|KDSA_ECOLI	2-dehydro-3-deoxyphosphooctonate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=kdsA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|P0A6N8|EFPL_ECOLI	Elongation factor P-like protein OS=Escherichia coli (strain K12) OX=83333 GN=yeiP PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P77695|GNSB_ECOLI	Protein GnsB OS=Escherichia coli (strain K12) OX=83333 GN=gnsB PE=3 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.19	19.0	1	1	1
PRT	sp|P0A6Y1|IHFB_ECOLI	Integration host factor subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=ihfB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	1	1	1
PRT	sp|P0A9Q1|ARCA_ECOLI	Aerobic respiration control protein ArcA OS=Escherichia coli (strain K12) OX=83333 GN=arcA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P67910|HLDD_ECOLI	ADP-L-glycero-D-manno-heptose-6-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=hldD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P0A7X3|RS9_ECOLI	30S ribosomal protein S9 OS=Escherichia coli (strain K12) OX=83333 GN=rpsI PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null	34-UNIMOD:21	0.17	19.0	2	2	2
PRT	sp|P21179|CATE_ECOLI	Catalase HPII OS=Escherichia coli (strain K12) OX=83333 GN=katE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P0AAI3|FTSH_ECOLI	ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) OX=83333 GN=ftsH PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	4	1	0
PRT	sp|P0AAI9|FABD_ECOLI	Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) OX=83333 GN=fabD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P0AB10|PQIC_ECOLI	Intermembrane transport lipoprotein PqiC OS=Escherichia coli (strain K12) OX=83333 GN=pqiC PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	1	1	1
PRT	sp|P0A7S3|RS12_ECOLI	30S ribosomal protein S12 OS=Escherichia coli (strain K12) OX=83333 GN=rpsL PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P0A7W7|RS8_ECOLI	30S ribosomal protein S8 OS=Escherichia coli (strain K12) OX=83333 GN=rpsH PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P0A8F0|UPP_ECOLI	Uracil phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=upp PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P37182|HYBD_ECOLI	Hydrogenase 2 maturation protease OS=Escherichia coli (strain K12) OX=83333 GN=hybD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P0A7V0|RS2_ECOLI	30S ribosomal protein S2 OS=Escherichia coli (strain K12) OX=83333 GN=rpsB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.14	18.0	3	3	3
PRT	sp|P0A800|RPOZ_ECOLI	DNA-directed RNA polymerase subunit omega OS=Escherichia coli (strain K12) OX=83333 GN=rpoZ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null	30-UNIMOD:35	0.31	18.0	2	2	2
PRT	sp|P25738|MSYB_ECOLI	Acidic protein MsyB OS=Escherichia coli (strain K12) OX=83333 GN=msyB PE=4 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P0A6W5|GREA_ECOLI	Transcription elongation factor GreA OS=Escherichia coli (strain K12) OX=83333 GN=greA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P69222|IF1_ECOLI	Translation initiation factor IF-1 OS=Escherichia coli (strain K12) OX=83333 GN=infA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.24	18.0	1	1	1
PRT	sp|P0A6Z3|HTPG_ECOLI	Chaperone protein HtpG OS=Escherichia coli (strain K12) OX=83333 GN=htpG PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P0DTT0|BIPA_ECOLI	50S ribosomal subunit assembly factor BipA OS=Escherichia coli (strain K12) OX=83333 GN=bipA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P0AA10|RL13_ECOLI	50S ribosomal protein L13 OS=Escherichia coli (strain K12) OX=83333 GN=rplM PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.24	18.0	4	4	4
PRT	sp|P23869|PPIB_ECOLI	Peptidyl-prolyl cis-trans isomerase B OS=Escherichia coli (strain K12) OX=83333 GN=ppiB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null	31-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|P77754|SPY_ECOLI	Periplasmic chaperone Spy OS=Escherichia coli (strain K12) OX=83333 GN=spy PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P00350|6PGD_ECOLI	6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli (strain K12) OX=83333 GN=gnd PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P0ABD8|BCCP_ECOLI	Biotin carboxyl carrier protein of acetyl-CoA carboxylase OS=Escherichia coli (strain K12) OX=83333 GN=accB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P29217|YCEH_ECOLI	UPF0502 protein YceH OS=Escherichia coli (strain K12) OX=83333 GN=yceH PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P0A8W5|YQGE_ECOLI	UPF0301 protein YqgE OS=Escherichia coli (strain K12) OX=83333 GN=yqgE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P69503|APT_ECOLI	Adenine phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=apt PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P0A7Z4|RPOA_ECOLI	DNA-directed RNA polymerase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=rpoA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|P31979|NUOF_ECOLI	NADH-quinone oxidoreductase subunit F OS=Escherichia coli (strain K12) OX=83333 GN=nuoF PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P05055|PNP_ECOLI	Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pnp PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	2	2	2
PRT	sp|P25745|MNMA_ECOLI	tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain K12) OX=83333 GN=mnmA PE=1 SV=4	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null	199-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|P0A908|MIPA_ECOLI	MltA-interacting protein OS=Escherichia coli (strain K12) OX=83333 GN=mipA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P0ADY3|RL14_ECOLI	50S ribosomal protein L14 OS=Escherichia coli (strain K12) OX=83333 GN=rplN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	2	2	2
PRT	sp|P0C0K3|SRKA_ECOLI	Stress response kinase A OS=Escherichia coli (strain K12) OX=83333 GN=srkA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P33590|NIKA_ECOLI	Nickel-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=nikA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P0AFJ1|YJDM_ECOLI	Protein YjdM OS=Escherichia coli (strain K12) OX=83333 GN=yjdM PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	1	1	1
PRT	sp|P0ADX7|YHHA_ECOLI	Uncharacterized protein YhhA OS=Escherichia coli (strain K12) OX=83333 GN=yhhA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.14	18.0	2	1	0
PRT	sp|Q46920|QUEF_ECOLI	NADPH-dependent 7-cyano-7-deazaguanine reductase OS=Escherichia coli (strain K12) OX=83333 GN=queF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	232-UNIMOD:4	0.05	17.0	2	1	0
PRT	sp|P0AGE9|SUCD_ECOLI	Succinate--CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=sucD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	245-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|P0A731|MGSA_ECOLI	Methylglyoxal synthase OS=Escherichia coli (strain K12) OX=83333 GN=mgsA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	22-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|P0A858|TPIS_ECOLI	Triosephosphate isomerase OS=Escherichia coli (strain K12) OX=83333 GN=tpiA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	2	2	2
PRT	sp|P0ADZ4|RS15_ECOLI	30S ribosomal protein S15 OS=Escherichia coli (strain K12) OX=83333 GN=rpsO PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P0ADC1|LPTE_ECOLI	LPS-assembly lipoprotein LptE OS=Escherichia coli (strain K12) OX=83333 GN=lptE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P23847|DPPA_ECOLI	Periplasmic dipeptide transport protein OS=Escherichia coli (strain K12) OX=83333 GN=dppA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P0A991|ALF1_ECOLI	Fructose-bisphosphate aldolase class 1 OS=Escherichia coli (strain K12) OX=83333 GN=fbaB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|P0A9Z1|GLNB_ECOLI	Nitrogen regulatory protein P-II 1 OS=Escherichia coli (strain K12) OX=83333 GN=glnB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.11	17.0	1	1	1
PRT	sp|P21888|SYC_ECOLI	Cysteine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=cysS PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P0ADG7|IMDH_ECOLI	Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=guaB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P76170|YNFB_ECOLI	UPF0482 protein YnfB OS=Escherichia coli (strain K12) OX=83333 GN=ynfB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.12	17.0	1	1	1
PRT	sp|P0A746|MSRB_ECOLI	Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) OX=83333 GN=msrB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P16659|SYP_ECOLI	Proline--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=proS PE=1 SV=4	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P61175|RL22_ECOLI	50S ribosomal protein L22 OS=Escherichia coli (strain K12) OX=83333 GN=rplV PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.17	17.0	2	2	2
PRT	sp|P68919|RL25_ECOLI	50S ribosomal protein L25 OS=Escherichia coli (strain K12) OX=83333 GN=rplY PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null	35-UNIMOD:27	0.24	17.0	3	3	3
PRT	sp|P0AFW2|RMF_ECOLI	Ribosome modulation factor OS=Escherichia coli (strain K12) OX=83333 GN=rmf PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	38-UNIMOD:21	0.16	17.0	2	1	0
PRT	sp|P0A7Z0|RPIA_ECOLI	Ribose-5-phosphate isomerase A OS=Escherichia coli (strain K12) OX=83333 GN=rpiA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	115-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P15288|PEPD_ECOLI	Cytosol non-specific dipeptidase OS=Escherichia coli (strain K12) OX=83333 GN=pepD PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P27298|OPDA_ECOLI	Oligopeptidase A OS=Escherichia coli (strain K12) OX=83333 GN=prlC PE=3 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P27302|TKT1_ECOLI	Transketolase 1 OS=Escherichia coli (strain K12) OX=83333 GN=tktA PE=1 SV=5	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	2	2	2
PRT	sp|P38489|NFSB_ECOLI	Oxygen-insensitive NAD(P)H nitroreductase OS=Escherichia coli (strain K12) OX=83333 GN=nfsB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.12	17.0	2	2	2
PRT	sp|P08622|DNAJ_ECOLI	Chaperone protein DnaJ OS=Escherichia coli (strain K12) OX=83333 GN=dnaJ PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P76440|PRET_ECOLI	NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) OX=83333 GN=preT PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	277-UNIMOD:4,282-UNIMOD:4	0.06	17.0	2	2	2
PRT	sp|P10908|UGPQ_ECOLI	Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P0A8P3|FETP_ECOLI	Probable Fe(2+)-trafficking protein OS=Escherichia coli (strain K12) OX=83333 GN=yggX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null	7-UNIMOD:4	0.11	17.0	1	1	1
PRT	sp|P04036|DAPB_ECOLI	4-hydroxy-tetrahydrodipicolinate reductase OS=Escherichia coli (strain K12) OX=83333 GN=dapB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P0A734|MINE_ECOLI	Cell division topological specificity factor OS=Escherichia coli (strain K12) OX=83333 GN=minE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.11	17.0	1	1	1
PRT	sp|P0AB61|YCIN_ECOLI	Protein YciN OS=Escherichia coli (strain K12) OX=83333 GN=yciN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.27	17.0	1	1	1
PRT	sp|P0A8T7|RPOC_ECOLI	DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain K12) OX=83333 GN=rpoC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1049-UNIMOD:28	0.01	17.0	1	1	1
PRT	sp|P0ADN2|YIFE_ECOLI	UPF0438 protein YifE OS=Escherichia coli (strain K12) OX=83333 GN=yifE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P0ADP9|YIHD_ECOLI	Protein YihD OS=Escherichia coli (strain K12) OX=83333 GN=yihD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P0A9D8|DAPD_ECOLI	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=dapD PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P0AB52|YCHN_ECOLI	Protein YchN OS=Escherichia coli (strain K12) OX=83333 GN=ychN PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P00961|SYGB_ECOLI	Glycine--tRNA ligase beta subunit OS=Escherichia coli (strain K12) OX=83333 GN=glyS PE=1 SV=4	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null	98-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P0AF70|YJEI_ECOLI	Uncharacterized protein YjeI OS=Escherichia coli (strain K12) OX=83333 GN=yjeI PE=3 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null	68-UNIMOD:35	0.15	16.0	1	1	1
PRT	sp|P64461|LSRG_ECOLI	(4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase OS=Escherichia coli (strain K12) OX=83333 GN=lsrG PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.16	16.0	1	1	1
PRT	sp|P0AC53|G6PD_ECOLI	Glucose-6-phosphate 1-dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=zwf PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P0A862|TPX_ECOLI	Thiol peroxidase OS=Escherichia coli (strain K12) OX=83333 GN=tpx PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P0A9H7|CFA_ECOLI	Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) OX=83333 GN=cfa PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P0AEK2|FABG_ECOLI	3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) OX=83333 GN=fabG PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P0A9W6|IBAG_ECOLI	Acid stress protein IbaG OS=Escherichia coli (strain K12) OX=83333 GN=ibaG PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.12	16.0	1	1	1
PRT	sp|P0A705|IF2_ECOLI	Translation initiation factor IF-2 OS=Escherichia coli (strain K12) OX=83333 GN=infB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	2	2	2
PRT	sp|P0A780|NUSB_ECOLI	Transcription antitermination protein NusB OS=Escherichia coli (strain K12) OX=83333 GN=nusB PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P0ABB4|ATPB_ECOLI	ATP synthase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=atpD PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null	138-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P00954|SYW_ECOLI	Tryptophan--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=trpS PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P15770|AROE_ECOLI	Shikimate dehydrogenase (NADP(+)) OS=Escherichia coli (strain K12) OX=83333 GN=aroE PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null	226-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|P0AEQ3|GLNH_ECOLI	Glutamine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=glnH PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P37744|RMLA1_ECOLI	Glucose-1-phosphate thymidylyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfbA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P0A8A0|YEBC_ECOLI	Probable transcriptional regulatory protein YebC OS=Escherichia coli (strain K12) OX=83333 GN=yebC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P0AGJ5|YFIF_ECOLI	Uncharacterized tRNA/rRNA methyltransferase YfiF OS=Escherichia coli (strain K12) OX=83333 GN=yfiF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|P0ACN4|ALLR_ECOLI	HTH-type transcriptional repressor AllR OS=Escherichia coli (strain K12) OX=83333 GN=allR PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null	135-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|P0ABC7|HFLK_ECOLI	Modulator of FtsH protease HflK OS=Escherichia coli (strain K12) OX=83333 GN=hflK PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P0A9C5|GLN1B_ECOLI	Glutamine synthetase OS=Escherichia coli (strain K12) OX=83333 GN=glnA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P76347|YEEJ_ECOLI	Uncharacterized protein YeeJ OS=Escherichia coli (strain K12) OX=83333 GN=yeeJ PE=3 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P0A7L8|RL27_ECOLI	50S ribosomal protein L27 OS=Escherichia coli (strain K12) OX=83333 GN=rpmA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|P0ACW6|YDCH_ECOLI	Uncharacterized protein YdcH OS=Escherichia coli (strain K12) OX=83333 GN=ydcH PE=4 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.12	15.0	1	1	1
PRT	sp|P0AF28|NARL_ECOLI	Nitrate/nitrite response regulator protein NarL OS=Escherichia coli (strain K12) OX=83333 GN=narL PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q46868|UBIK_ECOLI	Ubiquinone biosynthesis accessory factor UbiK OS=Escherichia coli (strain K12) OX=83333 GN=ubiK PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|P0C0V0|DEGP_ECOLI	Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) OX=83333 GN=degP PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P0AB55|YCII_ECOLI	Protein YciI OS=Escherichia coli (strain K12) OX=83333 GN=yciI PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.10	15.0	1	1	1
PRT	sp|Q46845|YGHU_ECOLI	Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) OX=83333 GN=yghU PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P0ABZ6|SURA_ECOLI	Chaperone SurA OS=Escherichia coli (strain K12) OX=83333 GN=surA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P76536|YFEX_ECOLI	Dye-decolorizing peroxidase YfeX OS=Escherichia coli (strain K12) OX=83333 GN=yfeX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P0A6Y5|HSLO_ECOLI	33 kDa chaperonin OS=Escherichia coli (strain K12) OX=83333 GN=hslO PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P0A9D2|GSTA_ECOLI	Glutathione S-transferase GstA OS=Escherichia coli (strain K12) OX=83333 GN=gstA PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null	147-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|P0AC47|FRDB_ECOLI	Fumarate reductase iron-sulfur subunit OS=Escherichia coli (strain K12) OX=83333 GN=frdB PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P0AC19|FOLX_ECOLI	Dihydroneopterin triphosphate 2'-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=folX PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|P07395|SYFB_ECOLI	Phenylalanine--tRNA ligase beta subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheT PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P0A7K6|RL19_ECOLI	50S ribosomal protein L19 OS=Escherichia coli (strain K12) OX=83333 GN=rplS PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null	36-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|P0A9X9|CSPA_ECOLI	Cold shock protein CspA OS=Escherichia coli (strain K12) OX=83333 GN=cspA PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.16	15.0	1	1	1
PRT	sp|P0A6C1|END4_ECOLI	Endonuclease 4 OS=Escherichia coli (strain K12) OX=83333 GN=nfo PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P62399|RL5_ECOLI	50S ribosomal protein L5 OS=Escherichia coli (strain K12) OX=83333 GN=rplE PE=1 SV=2	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|P0A9C3|GALM_ECOLI	Aldose 1-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=galM PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.03	15.0	1	1	1
PRT	sp|P0ABF6|CDD_ECOLI	Cytidine deaminase OS=Escherichia coli (strain K12) OX=83333 GN=cdd PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P0AG30|RHO_ECOLI	Transcription termination factor Rho OS=Escherichia coli (strain K12) OX=83333 GN=rho PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P09152|NARG_ECOLI	Respiratory nitrate reductase 1 alpha chain OS=Escherichia coli (strain K12) OX=83333 GN=narG PE=1 SV=4	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|P21362|YCIF_ECOLI	Protein YciF OS=Escherichia coli (strain K12) OX=83333 GN=yciF PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.11	15.0	1	1	1
PRT	sp|P33937|NAPA_ECOLI	Periplasmic nitrate reductase OS=Escherichia coli (strain K12) OX=83333 GN=napA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|P37194|SLP_ECOLI	Outer membrane protein Slp OS=Escherichia coli (strain K12) OX=83333 GN=slp PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.11	15.0	1	1	1
PRT	sp|P69856|NANC_ECOLI	Probable N-acetylneuraminic acid outer membrane channel protein NanC OS=Escherichia coli (strain K12) OX=83333 GN=nanC PE=1 SV=1	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	null	77-UNIMOD:21,84-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|P00363|FRDA_ECOLI	Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) OX=83333 GN=frdA PE=1 SV=3	null	null	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	589-UNIMOD:21	0.03	15.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	IHGVNYSISSACATSAHCIGNAVEQIQLGK	1	sp|P0A953|FABB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	12-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.2270.6	44.36503	4	3186.5882	3184.5392	K	Q	152	182
PSM	AMTYHLDVVSAEQQMFSGLVEK	2	sp|P0A6E6|ATPE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	2-UNIMOD:35	ms_run[1]:scan=1.1.2611.4	53.21017	3	2499.2032	2498.1812	M	I	2	24
PSM	HYAHVDCPGHADYVK	3	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1234.2	18.216	4	1767.788094	1767.778738	R	N	76	91
PSM	TKPHVNVGTIGHVDHGK	4	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.1216.2	17.76042	4	1795.959694	1794.948915	R	T	9	26
PSM	HYAHVDCPGHADYVK	5	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1242.3	18.41823	4	1767.788094	1767.778738	R	N	76	91
PSM	TKPHVNVGTIGHVDHGK	6	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.1224.5	17.9681	3	1794.966671	1794.948915	R	T	9	26
PSM	KGGPLADGIVITPSHNPPEDGGIK	7	sp|P36938|PGM_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=1.1.1917.3	35.43843	4	2449.225694	2448.205005	K	Y	133	157
PSM	AQVAQIAGKPSSEVSMIHAR	8	sp|P0ADB1|OSME_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:35	ms_run[1]:scan=1.1.1481.3	24.35782	4	2095.104094	2095.084423	R	G	46	66
PSM	NTVVIMTSNLGSDLIQER	9	sp|P63284|CLPB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.2411.3	47.9854	3	1990.043171	1989.020091	R	F	711	729
PSM	TKPHVNVGTIGHVDHGK	10	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.1240.2	18.36488	4	1794.958894	1794.948915	R	T	9	26
PSM	ADYADSLTENGTHGSDSVESAAR	11	sp|P0A763|NDK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:21	ms_run[1]:scan=1.1.1696.3	29.9155	4	2432.000494	2431.976522	R	E	105	128
PSM	AGYAEDEVVAVSK	12	sp|P68066|GRCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	36.0		ms_run[1]:scan=1.1.1607.3	27.62825	2	1337.6692	1336.6502	K	L	36	49
PSM	IIVACGGAVATSTMAAEEIK	13	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:4	ms_run[1]:scan=1.1.1781.3	32.01713	3	1991.019371	1991.006749	K	E	5	25
PSM	DKPEDAVLDVQGIATVTPAIVQACTQDK	14	sp|P0AES9|HDEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	24-UNIMOD:4	ms_run[1]:scan=1.1.2714.3	55.90393	4	2983.5442	2981.5012	K	Q	64	92
PSM	HYTAADGSEISLHGR	15	sp|P37330|MASZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.1351.3	21.1478	3	1612.770071	1612.759383	R	S	318	333
PSM	SGALAGTVLNDANNQAK	16	sp|P0AEE5|DGAL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.1694.2	29.86308	3	1642.839371	1642.827462	K	A	270	287
PSM	LGGGLSAEALTEK	17	sp|P21599|KPYK2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.1738.2	30.98097	2	1244.673047	1244.661232	K	D	165	178
PSM	VNEIETYMDGVHLICTTAK	18	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	15-UNIMOD:4	ms_run[1]:scan=1.1.2376.2	47.1264	3	2195.0782	2193.0442	R	V	41	60
PSM	VNEIETYMDGVHLICTTAK	19	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	15-UNIMOD:4	ms_run[1]:scan=1.1.2386.3	47.3455	3	2195.0782	2193.0442	R	V	41	60
PSM	EAEFPTGIMLEQHAIAIPHCEAIHAK	20	sp|P69828|PTKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:27,9-UNIMOD:35,20-UNIMOD:4	ms_run[1]:scan=1.1.2228.3	43.25057	5	2912.4602	2910.4152	R	S	44	70
PSM	QMGNSEVGHVNLGAGR	21	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.1458.2	23.78763	4	1720.732094	1720.735233	R	I	60	76
PSM	GMGESNPVTGNTCDNVK	22	sp|P0A910|OMPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,13-UNIMOD:4	ms_run[1]:scan=1.1.1302.5	19.87497	3	1794.765971	1794.751263	R	Q	299	316
PSM	NPSISTHLLGSNASSVIR	23	sp|P39177|USPG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.1847.4	33.64558	3	1851.998171	1851.980275	R	H	115	133
PSM	IIHLTDDSFDTDVLK	24	sp|P0AA25|THIO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.2205.2	42.64392	3	1730.889671	1730.872681	K	A	5	20
PSM	DPHGNIECVQTLDMMPENFSDTR	25	sp|P52697|6PGL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2318.5	45.6121	4	2707.1912	2705.1512	K	W	207	230
PSM	AQVAQIAGKPSSEVSMIHAR	26	sp|P0ADB1|OSME_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:35	ms_run[1]:scan=1.1.1468.3	24.02217	4	2095.100094	2095.084423	R	G	46	66
PSM	GYAGDTATTSEIK	27	sp|P0AFH8|OSMY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.1332.7	20.65982	2	1312.627447	1312.614676	K	A	131	144
PSM	NTVVIMTSNLGSDLIQER	28	sp|P63284|CLPB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.2403.3	47.77455	3	1990.043171	1989.020091	R	F	711	729
PSM	ELCQNHNIPVELIQCR	29	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.1932.5	35.8377	3	2024.0052	2021.9772	K	V	25	41
PSM	LTDDDMTIIEGK	30	sp|P68206|YJBJ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	32.0		ms_run[1]:scan=1.1.1897.3	34.92	2	1350.6592	1349.6382	K	R	24	36
PSM	DKPEDAVLDVQGIATVTPAIVQACTQDK	31	sp|P0AES9|HDEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	24-UNIMOD:4	ms_run[1]:scan=1.1.2722.4	56.11598	4	2983.5442	2981.5012	K	Q	64	92
PSM	PHVNVGTIGHVDHGK	32	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.1257.3	18.80368	3	1565.815871	1565.806273	K	T	11	26
PSM	ISADQVDQEVER	33	sp|P08839|PT1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.1572.6	26.7258	2	1387.671447	1387.657937	K	F	31	43
PSM	TGNRHDLAVEPPAPTVLQK	34	sp|P0A6K6|DEOB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.1631.4	28.2142	4	2042.105694	2042.090888	R	L	227	246
PSM	HGDNPLNGYSICAFPDAADK	35	sp|P31658|HCHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4	ms_run[1]:scan=1.1.2116.2	40.5711	4	2160.971294	2160.953468	R	Q	196	216
PSM	IHGLADCMQGEMISLPGNR	36	sp|P0ABB0|ATPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2137.5	41.12652	3	2097.995171	2097.975800	R	Y	41	60
PSM	REEESAAAAEVEER	37	sp|P0ACF8|HNS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1398.3	22.22603	3	1654.698371	1654.683574	R	T	41	55
PSM	VGDIVVSDEAR	38	sp|P0AF12|MTNN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.1491.6	24.62655	2	1158.597447	1158.588067	K	Y	86	97
PSM	DTVEIQGEVDK	39	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.1474.4	24.17798	2	1231.605447	1231.593212	K	D	103	114
PSM	VEGKDDVTGEELTTR	40	sp|P69441|KAD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.1370.2	21.51378	3	1647.808871	1647.795159	K	K	142	157
PSM	VNDEGIIEDAR	41	sp|P0ACD4|ISCU_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.1586.2	27.079	2	1229.600647	1229.588795	K	F	47	58
PSM	TFEVLATNGDTHLGGEDFDSR	42	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2173.6	42.0043	3	2281.051571	2280.029469	K	L	215	236
PSM	HYAHVDCPGHADYVK	43	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1250.2	18.62325	4	1769.786894	1767.778738	R	N	76	91
PSM	VLPAVAMLEER	44	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	7-UNIMOD:35	ms_run[1]:scan=1.1.1958.5	36.50085	2	1243.6792	1242.6632	K	A	374	385
PSM	HGDNPLNGYSICAFPDAADK	45	sp|P31658|HCHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:4	ms_run[1]:scan=1.1.2133.3	41.01515	3	2161.973471	2160.953468	R	Q	196	216
PSM	IAAANVPAFVSGK	46	sp|P0ACF0|DBHA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.1862.5	34.03697	2	1244.708047	1243.692472	K	A	71	84
PSM	LYNDAGISNDR	47	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1376.5	21.6715	2	1236.585247	1236.573479	K	I	118	129
PSM	RFEEHLQHEAQER	48	sp|P39177|USPG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1248.2	18.57133	4	1707.815294	1707.807730	R	L	57	70
PSM	HYAHVDCPGHADYVK	49	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1280.2	19.29323	4	1767.785294	1767.778738	R	N	76	91
PSM	HYAHVDCPGHADYVK	50	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1258.3	18.83023	4	1767.788894	1767.778738	R	N	76	91
PSM	AGDIAAAIGLK	51	sp|P0A6M8|EFG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2016.2	37.96363	2	998.582647	998.576046	R	D	379	390
PSM	LAEVLAAANAR	52	sp|P0A7R1|RL9_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1625.2	28.06435	2	1097.629447	1097.619307	K	A	58	69
PSM	RSHDALTAVTSLSVDK	53	sp|P0A7N4|RL32_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1716.3	30.43867	3	1698.905471	1698.890063	R	T	17	33
PSM	DGTIHQFSAVEQDDQR	54	sp|P61316|LOLA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1558.4	26.36848	3	1844.847371	1844.828919	R	S	155	171
PSM	EILSEMGYTHVENAGGLK	55	sp|P23857|PSPE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.1944.6	36.1439	3	1946.958671	1946.940778	K	D	78	96
PSM	DQLIAGVQDAFADK	56	sp|P45523|FKBA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2321.2	45.68453	3	1489.750871	1489.741273	K	S	77	91
PSM	WDEVGVDVVAEATGLFLTDETAR	57	sp|P0A9B2|G3P1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3514.4	76.83293	3	2492.231171	2492.207099	K	K	85	108
PSM	VLPAVAMLEER	58	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=1.1.2317.3	45.58064	2	1227.6862	1226.6692	K	A	374	385
PSM	VLPAVAMLEER	59	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=1.1.2309.5	45.37488	2	1227.6862	1226.6692	K	A	374	385
PSM	HGDNPLNGYSICAFPDAADK	60	sp|P31658|HCHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4	ms_run[1]:scan=1.1.2125.6	40.81455	3	2161.973471	2160.953468	R	Q	196	216
PSM	DKPEDAVLDVQGIATVTPAIVQACTQDK	61	sp|P0AES9|HDEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	24-UNIMOD:4	ms_run[1]:scan=1.1.2590.2	52.69643	5	2983.5452	2981.5012	K	Q	64	92
PSM	HYAHVDCPGHADYVK	62	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1299.3	19.79163	4	1767.785294	1767.778738	R	N	76	91
PSM	VINQGEGAIPAR	63	sp|P0A9L3|FKBB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1356.7	21.28858	2	1223.673247	1223.662235	R	T	108	120
PSM	LQGIAQQNSFK	64	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1484.3	24.43585	2	1232.663047	1232.651336	K	H	454	465
PSM	ATVTGDGLSQEAK	65	sp|P0ADE6|KBP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1303.7	19.90583	2	1275.642847	1275.630660	K	E	55	68
PSM	ASSGLNEDEIQK	66	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1326.7	20.50293	2	1289.620847	1289.609925	K	M	503	515
PSM	HLFTSESVSEGHPDK	67	sp|P0A817|METK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1330.2	20.5955	3	1668.788471	1668.774364	K	I	4	19
PSM	DHTSDQLHEEFDAK	68	sp|P0A8N5|SYK2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1468.5	24.02693	3	1670.732471	1670.717243	R	D	43	57
PSM	TKPHVNVGTIGHVDHGK	69	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1235.4	18.24687	4	1794.957694	1794.948915	R	T	9	26
PSM	TKPHVNVGTIGHVDHGK	70	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1240.3	18.36727	3	1794.966371	1794.948915	R	T	9	26
PSM	GELHCVGATTLDEYR	71	sp|P63284|CLPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:4	ms_run[1]:scan=1.1.1666.4	29.1323	3	1719.797471	1719.788634	R	Q	306	321
PSM	FAGTGDSHIAFASPDENR	72	sp|P08331|CPDB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.1681.7	29.53508	3	1890.868571	1890.849654	K	S	551	569
PSM	QMGNSEVGHVNLGAGR	73	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1655.5	28.84465	3	1705.740671	1704.740318	R	I	60	76
PSM	QMGNSEVGHVNLGAGR	74	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1647.4	28.63253	3	1705.740971	1704.740318	R	I	60	76
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	75	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	17-UNIMOD:35	ms_run[1]:scan=1.1.1627.6	28.11823	4	3202.3002	3201.2622	K	L	27	60
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	76	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:35	ms_run[1]:scan=1.1.1636.8	28.35397	4	3202.297294	3201.262946	K	L	27	60
PSM	HYAHVDCPGHADYVK	77	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1318.2	20.28168	4	1767.790494	1767.778738	R	N	76	91
PSM	VGLIAGSGGGSPR	78	sp|P0A953|FABB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1424.2	22.89832	2	1126.618047	1126.609471	R	F	99	112
PSM	ELAESEGAIER	79	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1381.3	21.79287	2	1202.587447	1202.577896	K	K	251	262
PSM	DTVEIQGEVDK	80	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1490.4	24.5956	2	1231.605447	1231.593212	K	D	103	114
PSM	HHITADGYYR	81	sp|P0A7N4|RL32_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1237.3	18.29553	2	1231.583647	1231.573420	R	G	41	51
PSM	MGSEVFHHLAK	82	sp|P0A6P9|ENO_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1270.4	19.14553	2	1270.621447	1270.612842	R	V	185	196
PSM	AGENVGVLLR	83	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1735.3	30.90072	2	1026.591447	1026.582194	R	G	271	281
PSM	DDGGLNVINK	84	sp|P0A901|BLC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1561.3	26.44465	2	1043.533447	1043.524738	R	G	68	78
PSM	DAGFQAFADK	85	sp|P0A6P1|EFTS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1782.2	32.0394	2	1068.496447	1068.487624	K	V	86	96
PSM	DAGFQAFADK	86	sp|P0A6P1|EFTS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1792.2	32.26362	2	1068.496447	1068.487624	K	V	86	96
PSM	ALAEIVDEAR	87	sp|P30749|MOAE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1768.3	31.68132	2	1085.579247	1085.571688	K	N	62	72
PSM	ISEIEADLEK	88	sp|P62768|YAEH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1696.2	29.91312	2	1145.591647	1145.581585	K	L	115	125
PSM	DDAELTAAFNK	89	sp|P09551|ARGT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1848.2	33.66603	2	1193.567447	1193.556432	K	A	224	235
PSM	ASDFVLAMGQGR	90	sp|P0A850|TIG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1973.4	36.89483	2	1250.620247	1250.607756	K	M	182	194
PSM	AFDQIDNAPEEK	91	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1513.2	25.19333	3	1375.635371	1375.625575	R	A	46	58
PSM	VEGGQHLNVNVLR	92	sp|P68066|GRCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1574.2	26.76848	3	1433.782871	1433.773911	R	R	67	80
PSM	DISFEAPNAPHVFQK	93	sp|P0AG86|SECB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2030.3	38.33312	3	1698.852071	1698.836570	K	D	20	35
PSM	VIYSTYESNETMYAK	94	sp|P0AFK9|POTD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.1729.3	30.77403	2	1797.830847	1797.813118	K	L	54	69
PSM	GPLTTPVGGGIRSLNVALR	95	sp|P08200|IDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2245.2	43.69803	4	1957.065294	1957.051011	K	Q	101	120
PSM	DEVNELAEELGADVVVIGSR	96	sp|P39177|USPG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3147.2	67.30898	3	2113.033271	2113.053893	R	N	95	115
PSM	SVMIDASHLPFAQNISR	97	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2290.3	44.88382	3	1885.968671	1884.951617	R	V	100	117
PSM	VVTLSGFVESQAQAEEAVK	98	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2321.3	45.68692	3	1992.041771	1991.021137	K	V	86	105
PSM	VNEIETYMDGVHLICTTAK	99	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	8-UNIMOD:35,15-UNIMOD:4	ms_run[1]:scan=1.1.2090.5	39.89465	3	2211.0762	2209.0392	R	V	41	60
PSM	FCPTGGISPANYR	100	sp|P0A955|ALKH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4	ms_run[1]:scan=1.1.1733.2	30.84755	2	1439.673847	1438.666334	R	D	158	171
PSM	AILAAAGIAEDVK	101	sp|P0A7S9|RS13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=1.1.1966.6	36.71463	2	1241.7202	1240.7022	K	I	32	45
PSM	LPSGGSIVIDSTEALTAIDINSAR	102	sp|P21513|RNE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2792.6	57.974	3	2401.257071	2399.254384	R	A	285	309
PSM	LGETGDAIAK	103	sp|P64581|YQJD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1281.3	19.32148	2	973.513447	973.508026	R	Q	54	64
PSM	HYGALQGLNK	104	sp|P62707|GPMA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1341.2	20.8837	2	1099.584847	1099.577443	R	A	91	101
PSM	ADQINEAYER	105	sp|P75691|YAHK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1326.5	20.49817	2	1207.556647	1207.546930	R	M	321	331
PSM	DTVEIQGEVDK	106	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1482.6	24.3913	2	1231.605447	1231.593212	K	D	103	114
PSM	VQAQIQGDEIR	107	sp|P0A8E7|YAJQ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1410.7	22.54737	2	1255.664047	1255.652064	K	V	121	132
PSM	LANELSDAAENK	108	sp|P02359|RS7_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1417.5	22.72547	2	1273.626647	1273.615010	R	G	120	132
PSM	ISQATGSTEIDR	109	sp|P77774|BAMB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1253.5	18.70883	2	1276.636047	1276.625909	R	L	232	244
PSM	NNSLSQEVQNAQHQR	110	sp|P0AF36|ZAPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1417.3	22.7207	3	1751.844671	1751.829922	K	E	36	51
PSM	LIDDAVAWAK	111	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1990.3	37.32052	2	1100.595647	1100.586610	K	Q	51	61
PSM	TQLIDVIAEK	112	sp|P0ACF0|DBHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2022.3	38.12372	2	1128.646047	1128.639040	K	A	4	14
PSM	AVAAALEQMPR	113	sp|P06959|ODP2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1694.3	29.86547	2	1155.617047	1155.607028	K	F	466	477
PSM	GSFESFAQAVR	114	sp|P0A9S3|GATD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1939.2	36.00857	2	1197.588647	1197.577836	R	D	321	332
PSM	DSAINEGFNTAK	115	sp|P46130|YBHC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.1518.3	25.32702	2	1265.600247	1265.588795	R	P	361	373
PSM	TQLIDVIAEK	116	sp|P0ACF0|DBHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2231.3	43.33008	2	1208.617047	1208.605371	K	A	4	14
PSM	IWDSTDALELK	117	sp|P0A9P0|DLDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1000663, ProteinPilot, ]	26.0		ms_run[1]:scan=1.1.2130.4	40.94102	2	1289.6632470956602	1289.65033237197	R	E	162	173
PSM	EILAVVEAVSNEK	118	sp|P0AFF6|NUSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2304.4	45.24272	2	1399.768647	1399.755861	K	A	4	17
PSM	NDAAVLLVDHQAGLLSLVR	119	sp|P21367|YCAC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2573.3	52.25217	3	2003.133071	2003.116374	K	D	11	30
PSM	LDIATGETVEFAEVLMIANGEEVK	120	sp|P0AG48|RL21_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3527.4	77.1315	3	2577.290471	2577.288386	K	I	25	49
PSM	HYAHVDCPGHADYVK	121	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1307.2	19.999	4	1767.785294	1767.778738	R	N	76	91
PSM	HYAHVDCPGHADYVK	122	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1291.3	19.58202	4	1767.785294	1767.778738	R	N	76	91
PSM	VYAAIEAGDK	123	sp|P0A7U7|RS20_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1378.4	21.7199	2	1035.530247	1035.523676	K	A	35	45
PSM	GVEGVTSVSDK	124	sp|P0AFH8|OSMY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1296.4	19.71533	2	1076.541647	1076.534969	K	L	108	119
PSM	HIINNTQDSVVNVDK	125	sp|P37759|RMLB1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1450.5	23.58397	3	1694.874071	1694.858763	R	L	19	34
PSM	ESLADVSDSER	126	sp|P37759|RMLB1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1442.5	23.37427	2	1206.547047	1206.536425	R	Y	41	52
PSM	DTVEIQGEVDK	127	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1498.4	24.80543	2	1231.605447	1231.593212	K	D	103	114
PSM	MGSEVFHHLAK	128	sp|P0A6P9|ENO_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1418.7	22.75673	2	1254.627847	1254.617927	R	V	185	196
PSM	NQGDHLLHSTR	129	sp|P0A6Y8|DNAK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1172.6	16.63027	2	1276.636047	1276.627246	R	K	537	548
PSM	TKPHVNVGTIGHVDHGK	130	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1248.3	18.57372	4	1794.958894	1794.948915	R	T	9	26
PSM	TKPHVNVGTIGHVDHGK	131	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1248.5	18.57848	3	1794.966371	1794.948915	R	T	9	26
PSM	DGTLQALSEK	132	sp|P0AEM9|FLIY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1565.2	26.54153	2	1060.549847	1060.540054	K	W	249	259
PSM	AGMVAGVIVNR	133	sp|P12758|UDP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1678.3	29.4463	2	1085.611647	1085.601549	R	T	213	224
PSM	SANIALVLYK	134	sp|P60422|RL2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2016.3	37.96603	2	1090.649447	1090.638646	R	D	88	98
PSM	SGEGLYFIDK	135	sp|P0A998|FTNA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1974.4	36.92108	2	1127.558047	1127.549890	K	E	147	157
PSM	SAGTYVQIVAR	136	sp|P60422|RL2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1662.2	29.02217	2	1163.640247	1163.629872	R	D	157	168
PSM	LSYDTEASIAK	137	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1537.3	25.82567	2	1196.604047	1196.592484	R	A	101	112
PSM	VQNAAGDIVSLR	138	sp|P00946|MANA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1717.4	30.4671	2	1241.683247	1241.672800	R	D	48	60
PSM	GDEVLTNGGLVGR	139	sp|P0ADZ7|YAJC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1714.4	30.38892	2	1285.673847	1285.662629	K	V	59	72
PSM	AAQEEEFSLELR	140	sp|P0ABS1|DKSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2024.4	38.179	2	1420.696047	1420.683424	R	N	76	88
PSM	RQVIQLTPQEDESTLK	141	sp|P23827|ECOT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.1662.5	29.02932	3	1884.013871	1883.995256	K	V	42	58
PSM	VGPALTFALR	142	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2125.2	40.80502	2	1043.619047	1043.612765	K	E	280	290
PSM	ISYISTGGGAFLEFVEGK	143	sp|P0A799|PGK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2980.2	62.90568	3	1873.958471	1873.946181	K	V	356	374
PSM	EHGYETVVMGASFR	144	sp|P0A870|TALB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:27,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.1957.2	36.46737	3	1661.7082	1659.6752	K	N	215	229
PSM	VLPAVAMLEER	145	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=1.1.2301.3	45.16162	2	1227.6862	1226.6692	K	A	374	385
PSM	IIVACGGAVATSTMAAEEIK	146	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3165.5	67.75595	3	1992.0332	1991.0062	K	E	5	25
PSM	DGALTPEEVQQVMDLLQK	147	sp|P39187|YTFJ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3019.2	63.93507	3	2013.998771	2013.008857	K	L	164	182
PSM	GTAMNPVDHPHGGGEGR	148	sp|P60422|RL2_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1172.3	16.6231	4	1687.756494	1687.748500	R	N	222	239
PSM	SGGVTFAAR	149	sp|P60723|RL4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1349.2	21.09305	2	864.447647	864.445366	R	P	80	89
PSM	SVDEAANSDIVDK	150	sp|P0ABA0|ATPF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1385.4	21.89617	3	1361.641271	1361.631054	R	L	139	152
PSM	VDGAEVVVK	151	sp|P0A8G6|NQOR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1350.3	21.12153	2	914.511847	914.507297	K	R	29	38
PSM	SGDTLSAISK	152	sp|P0ADE6|KBP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1396.2	22.17162	2	977.507247	977.502940	K	Q	103	113
PSM	AALELAEQR	153	sp|P0A7V8|RS4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1485.3	24.46155	2	999.542047	999.534909	K	E	157	166
PSM	VGAATEVEMK	154	sp|P0A6F5|CH60_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1324.2	20.4387	2	1033.516647	1033.511396	K	E	381	391
PSM	PGVITGDDVQK	155	sp|P0AB71|ALF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1342.4	20.91453	2	1127.587847	1127.582253	K	V	10	21
PSM	GVSLEVSQEAR	156	sp|P0ABH9|CLPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1495.3	24.72417	2	1173.605247	1173.598966	K	N	677	688
PSM	SEDQVELVEK	157	sp|P25516|ACNA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1453.4	23.66055	2	1174.581247	1174.571748	R	Y	333	343
PSM	SGAQAVCFAPDK	158	sp|P0ABU5|ELBB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1487.6	24.52117	2	1249.588447	1249.576122	R	Q	32	44
PSM	DAMFTTSSENR	159	sp|P0A8M3|SYT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1461.4	23.86638	2	1257.542047	1257.529566	K	E	315	326
PSM	LLANQEEGTQIR	160	sp|P63020|NFUA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1428.6	23.0105	2	1370.727847	1370.715393	K	V	15	27
PSM	DKGEAENEAKPIDVK	161	sp|P0AFD6|NUOI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1222.2	17.9109	3	1641.832271	1641.820980	K	S	162	177
PSM	HQKPVPALNQPGGIVEK	162	sp|P60624|RL24_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1416.6	22.7017	3	1811.022371	1811.005367	K	E	45	62
PSM	GNTSLYDHNNNTSDYSK	163	sp|P09169|OMPT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1267.5	19.06927	3	1928.828471	1928.813663	K	N	281	298
PSM	GAVASLTSVAK	164	sp|P09373|PFLB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1527.2	25.56098	2	1002.576847	1002.570960	K	L	644	655
PSM	LSDYGVQLR	165	sp|P0A7V8|RS4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1672.3	29.28807	2	1049.556647	1049.550559	R	E	48	57
PSM	TDVLIDEVR	166	sp|P36683|ACNB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1794.4	32.31868	2	1058.570647	1058.560789	K	A	332	341
PSM	SGITFSQELK	167	sp|P0A953|FABB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1743.5	31.10077	2	1108.586647	1108.576440	R	D	31	41
PSM	VTVQSLDVVR	168	sp|P60438|RL3_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1770.2	31.73078	2	1114.645047	1114.634623	R	V	170	180
PSM	VLLGVAGFQAR	169	sp|P0ADE8|YGFZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2055.2	38.98813	2	1129.668447	1129.660778	R	A	116	127
PSM	MTGLESYDVK	170	sp|P0AC92|GNSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1644.2	28.54965	2	1141.542647	1141.532526	K	I	44	54
PSM	MVINALNANVK	171	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1773.4	31.8115	2	1185.665047	1185.653978	K	V	102	113
PSM	FGEIEEVELGR	172	sp|P06959|ODP2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2021.4	38.09993	2	1276.642047	1276.629932	K	I	397	408
PSM	SAGGIVLTGSAAAK	173	sp|P0A6F9|CH10_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1596.5	27.3364	2	1281.645047	1281.632983	K	S	21	35
PSM	QLASVTVEDSR	174	sp|P0A805|RRF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.1600.5	27.44153	2	1283.587447	1283.575862	R	T	53	64
PSM	ADVAPSNLAIVGR	175	sp|P0AEP3|GALU_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.1823.3	33.05253	2	1281.716247	1281.704100	K	Y	205	218
PSM	ATLLGLGLR	176	sp|P0AG51|RL30_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2128.2	40.88435	2	912.577047	912.575652	K	R	22	31
PSM	SLDDFLIKQ	177	sp|P0ACF8|HNS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2258.2	44.04042	2	1077.579847	1077.570626	K	-	129	138
PSM	SLDDFLIKQ	178	sp|P0ACF8|HNS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2266.2	44.25067	2	1077.579847	1077.570626	K	-	129	138
PSM	ITTVQAAIDYINGHQA	179	sp|P0A6A8|ACP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2488.2	50.02343	3	1713.885671	1713.868599	K	-	63	79
PSM	LQTLGLTQGTVVTISAEGEDEQK	180	sp|P0AA04|PTHP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2489.7	50.06199	3	2416.245971	2416.233314	K	A	50	73
PSM	AGNGETILTSELYTSK	181	sp|P76402|YEGP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2198.4	42.48468	2	1682.840247	1682.836296	K	T	21	37
PSM	TQLQDAVPMTLGQEFR	182	sp|P0AC38|ASPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2348.4	46.39322	3	1832.926271	1832.909084	R	A	190	206
PSM	EHGYETVVMGASFR	183	sp|P0A870|TALB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:27,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.1965.2	36.67877	3	1661.7082	1659.6752	K	N	215	229
PSM	QYHHPLAIHLDHHTK	184	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=1.1.1428.2	23.00095	4	1828.9222	1828.9112	K	F	72	87
PSM	AEITLDYQLK	185	sp|P0C0L2|OSMC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=1.1.1981.2	37.09762	2	1193.6482	1192.6332	K	S	133	143
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	186	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=1.1.1798.7	32.43072	4	3186.3042	3185.2672	K	L	27	60
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	187	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	17-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=1.1.1518.8	25.33893	4	3218.2952	3217.2572	K	L	27	60
PSM	SHWSEQQQNNDNGSPTLEVDALVLNPGR	188	sp|P0AE88|CPXR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=1.1.2339.5	46.16035	4	3105.4892	3104.4542	R	Q	118	146
PSM	ATSTISVGYDNFDVDALTAR	189	sp|P37666|GHRB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=1.1.2425.3	48.3515	3	2116.0362	2115.0112	R	K	69	89
PSM	FGVSAAAAVAVAAGPVEAAEEK	190	sp|P0A7K2|RL7_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2436.3	48.64283	3	2014.057271	2014.037121	K	T	31	53
PSM	ANLTAQINK	191	sp|P0A7U7|RS20_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1321.2	20.36023	2	971.545847	971.539994	K	L	77	86
PSM	VDDGGTLDVR	192	sp|P39180|AG43_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1395.7	22.15737	2	1045.511447	1045.504003	R	N	362	372
PSM	YTAAITGAEGK	193	sp|P02358|RS6_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1316.3	20.23145	2	1080.552247	1080.545139	R	I	25	36
PSM	TCHAAIIAR	194	sp|P23538|PPSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.1280.6	19.30277	2	1091.503047	1091.494715	R	E	419	428
PSM	ASEVDEALQR	195	sp|P07003|POXB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1429.2	23.0271	2	1116.548647	1116.541117	K	A	504	514
PSM	VIADCGCEGR	196	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.1186.7	16.99948	2	1135.485447	1135.475028	K	A	274	284
PSM	AAIEAAGGKIEE	197	sp|P02413|RL15_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1429.3	23.02948	2	1157.603047	1157.592818	R	-	133	145
PSM	QGNEFGATTGR	198	sp|P0A7D4|PURA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1313.4	20.15507	2	1216.499047	1216.487381	K	R	294	305
PSM	FNSLTPEQQR	199	sp|P68066|GRCA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1389.4	22.00108	2	1218.610647	1218.599300	R	D	107	117
PSM	DALMQEYDDK	200	sp|P04825|AMPN_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:35	ms_run[1]:scan=1.1.1397.5	22.20485	2	1242.518247	1242.507434	R	W	729	739
PSM	LNIDQNPGTAPK	201	sp|P0AA25|THIO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1404.4	22.3845	2	1266.668447	1266.656815	K	Y	59	71
PSM	ILVIAADER	202	sp|P31658|HCHA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1658.2	28.91643	2	998.582047	998.576046	K	Y	51	60
PSM	IILLGAPGAGK	203	sp|P69441|KAD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1861.2	34.00382	2	1008.638247	1008.633167	R	G	3	14
PSM	SQAIEGLVK	204	sp|P0A850|TIG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1742.2	31.06732	2	1023.507447	1023.500177	K	A	288	297
PSM	DFGSVDNFK	205	sp|P00448|SODM_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1796.2	32.36603	2	1027.468047	1027.461075	R	A	106	115
PSM	LATLLSDASR	206	sp|P75818|YBJP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1702.2	30.06933	2	1045.584647	1045.576774	K	D	71	81
PSM	FNVEVVAIR	207	sp|P0A9K9|SLYD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2020.2	38.06898	2	1045.598047	1045.592030	K	E	132	141
PSM	VIVEGINLVK	208	sp|P60624|RL24_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1996.2	37.47626	2	1082.680247	1082.669946	K	K	34	44
PSM	MVAPVDGTIGK	209	sp|P69783|PTGA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1562.3	26.4706	2	1086.584047	1086.574331	K	I	60	71
PSM	GLEEDAEGLR	210	sp|P00509|AAT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1646.3	28.60405	2	1087.524047	1087.514568	R	A	220	230
PSM	ISDDLYVFK	211	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2054.2	38.96148	2	1098.568847	1098.559727	R	D	71	80
PSM	SLALGFYHK	212	sp|P0A8V6|FADR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1967.3	36.73395	2	1114.531047	1114.521247	R	L	187	196
PSM	GALSAVVADSR	213	sp|P0A7J3|RL10_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2016.4	37.96842	2	1124.532247	1124.522704	K	G	21	32
PSM	SYYALAESVK	214	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1740.3	31.01862	2	1129.575847	1129.565540	R	N	79	89
PSM	TLAQEVLGTTK	215	sp|P0A8N5|SYK2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1866.4	34.13848	2	1159.655447	1159.644853	R	V	300	311
PSM	IFLDASSEER	216	sp|P0A6I0|KCY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1684.2	29.60232	2	1165.571847	1165.561518	K	A	145	155
PSM	PTADLCIDCK	217	sp|P0ABS1|DKSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.1515.7	25.25768	2	1191.537447	1191.526395	R	T	130	140
PSM	AGQTFTFTTDK	218	sp|P0AD61|KPYK1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1646.5	28.60882	2	1215.588647	1215.577168	K	S	87	98
PSM	VGTVTPNVAEAVK	219	sp|P0A7L0|RL1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1583.3	27.0033	2	1283.720647	1283.708516	K	N	142	155
PSM	AFINGQEVDVNR	220	sp|P39176|ERFK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1654.6	28.82097	2	1360.683447	1360.673528	R	A	276	288
PSM	GLSQGSGVAFDNEK	221	sp|P02943|LAMB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1505.7	24.9964	2	1407.675447	1407.663023	K	F	270	284
PSM	AVEALDHCVEEVAK	222	sp|P37689|GPMI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4	ms_run[1]:scan=1.1.1666.2	29.12753	3	1568.763971	1568.750458	K	A	417	431
PSM	WEGITRPYSAEDVVK	223	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1839.3	33.44178	3	1748.885171	1748.873350	R	L	20	35
PSM	TGWLDTVAVR	224	sp|P0A7D4|PURA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2115.2	40.54472	2	1116.598047	1116.592758	R	R	308	318
PSM	LSGFGNFDLR	225	sp|P0A6X7|IHFA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2167.2	41.83645	2	1124.571847	1124.561458	K	D	46	56
PSM	DAASFAPLHNPAHLIGIEEALK	226	sp|P0A6A3|ACKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2394.2	47.53338	4	2313.231694	2313.211731	K	S	115	137
PSM	SYTLPSLPYAYDALEPHFDK	227	sp|P00448|SODM_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0		ms_run[1]:scan=1.1.2609.4	53.15628	3	2326.1163706434904	2326.1157645267294	M	Q	2	22
PSM	SSLIQALLK	228	sp|P60546|KGUA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2766.2	57.2768	2	1051.576047	1051.567863	K	T	18	27
PSM	STCTGVEMFR	229	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4	ms_run[1]:scan=1.1.1654.4	28.8162	2	1187.522847	1186.511079	K	K	254	264
PSM	VVTLSGFVESQAQAEEAVK	230	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2313.4	45.47753	3	1992.041771	1991.021137	K	V	86	105
PSM	GIDTVLAELR	231	sp|P0A7M2|RL28_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2400.2	47.69273	2	1085.616647	1085.608074	K	A	63	73
PSM	DDSNGWDLLAQAEAALNNR	232	sp|P66948|BEPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3303.4	71.39529	3	2072.973671	2071.955910	K	D	408	427
PSM	DTVEIQGEVDK	233	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.1484.3	24.43585	2	1231.605447	1231.593212	K	D	103	114
PSM	NQGDHLLHSTR	234	sp|P0A6Y8|DNAK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1172.2	16.62072	4	1276.627294	1276.627246	R	K	537	548
PSM	VHVHVEEGSPK	235	sp|P37903|USPF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1158.2	16.25213	3	1216.622771	1216.620036	R	D	86	97
PSM	HILGLDHK	236	sp|P68191|SRA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1278.2	19.24132	2	931.527847	931.523950	R	I	9	17
PSM	VDRPTAECAAALDK	237	sp|P31063|YEDD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.1360.2	21.38202	3	1515.749171	1515.735142	R	A	116	130
PSM	YAIVANDVR	238	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1500.3	24.856	2	1019.546647	1019.539994	R	K	125	134
PSM	SPTYWNNAK	239	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1395.8	22.15975	2	1079.512647	1079.503609	R	T	233	242
PSM	AAQYVASHPGEVCPAK	240	sp|P0AE08|AHPC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:4	ms_run[1]:scan=1.1.1279.5	19.27418	3	1683.818171	1683.803890	K	W	154	170
PSM	AQLQEIAQTK	241	sp|P0A7J7|RL11_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1401.4	22.3067	2	1128.621247	1128.613888	R	A	104	114
PSM	DSDTVVVNYK	242	sp|P45523|FKBA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1492.3	24.64587	2	1138.561047	1138.550619	K	G	163	173
PSM	MQELAQVSQK	243	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1369.2	21.49148	2	1160.596847	1160.585958	K	L	588	598
PSM	HYGALQGLNK	244	sp|P62707|GPMA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1357.5	21.31017	2	1179.554447	1179.543774	R	A	91	101
PSM	SVDEAANSDIVDK	245	sp|P0ABA0|ATPF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1382.8	21.82982	2	1361.642247	1361.631054	R	L	139	152
PSM	LDDTSSEFNTQR	246	sp|P0AC41|SDHA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1417.7	22.73023	2	1411.633847	1411.621552	R	V	499	511
PSM	TKPHVNVGTIGHVDHGK	247	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1265.4	19.01485	3	1794.965771	1794.948915	R	T	9	26
PSM	GPAAVNVTAI	248	sp|P0A9Y6|CSPC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1904.2	35.09597	2	911.513047	911.507632	K	-	60	70
PSM	ALVDAELAR	249	sp|P0A8R0|RRAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1646.2	28.60167	2	956.529647	956.529095	R	L	72	81
PSM	ESGALFVDR	250	sp|P0A7A9|IPYR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1621.2	27.95937	2	992.501047	992.492710	K	F	36	45
PSM	IEIEAIAVR	251	sp|P0AF93|RIDA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1921.2	35.54095	2	1012.597847	1012.591696	K	R	119	128
PSM	MITGIQITK	252	sp|P68066|GRCA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1578.2	26.87212	2	1019.572847	1019.568518	-	A	1	10
PSM	VIDGQINLR	253	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1611.2	27.71377	2	1026.588647	1026.582194	K	D	129	138
PSM	YAIALNLER	254	sp|P0ABB0|ATPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1967.2	36.73157	2	1061.594647	1061.586945	R	D	60	69
PSM	GIVVNVAEMR	255	sp|P39176|ERFK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1855.4	33.85212	2	1086.595047	1086.585564	K	L	97	107
PSM	DAGLNVVMDR	256	sp|P75874|YCCU_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1830.2	33.2333	2	1088.536047	1088.528443	R	C	115	125
PSM	AATLFNDAQR	257	sp|P27248|GCST_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1533.3	25.72072	2	1105.556647	1105.551622	K	Q	156	166
PSM	IVGLQTEAPLK	258	sp|P09373|PFLB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1761.2	31.49568	2	1167.697447	1167.686324	K	R	97	108
PSM	AYGSTNPINVVR	259	sp|P0A7W1|RS5_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1638.4	28.39657	2	1289.685447	1289.672800	K	A	127	139
PSM	SVMLQSLNNIR	260	sp|P0ACG1|STPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	3-UNIMOD:35	ms_run[1]:scan=1.1.1763.4	31.55312	2	1289.6882	1289.6752	M	T	2	13
PSM	YGFVASGTLNPQK	261	sp|P00805|ASPG2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1765.5	31.60767	2	1380.716447	1380.703765	K	A	311	324
PSM	ILENGEVKPLDVK	262	sp|P0A6F9|CH10_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1623.2	28.00967	3	1452.828971	1452.818795	R	V	48	61
PSM	MGMNIINDDITGR	263	sp|P31658|HCHA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,3-UNIMOD:35	ms_run[1]:scan=1.1.1700.7	30.02827	2	1480.672447	1480.665014	K	V	238	251
PSM	VSDYDGYNQFVVHR	264	sp|P0A855|TOLB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1777.6	31.91942	3	1697.794571	1697.779784	R	S	184	198
PSM	LTVLDSLSK	265	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2106.2	40.30675	2	1054.541647	1054.531143	K	I	198	207
PSM	LAIAASSLWK	266	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2093.2	39.96478	2	1058.620647	1058.612431	K	K	400	410
PSM	VEDVLFAMVK	267	sp|P0AF50|YJBR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2368.2	46.91762	2	1149.621847	1149.610382	K	E	31	41
PSM	DGDGFAWIER	268	sp|P0ADE8|YGFZ_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2273.2	44.43398	2	1164.530447	1164.519987	R	R	78	88
PSM	ISDDLYVFK	269	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2333.2	46.0033	2	1178.537047	1178.526058	R	D	71	80
PSM	GMINAVSFMVK	270	sp|P0AG51|RL30_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2263.2	44.17162	2	1195.621047	1195.609336	R	V	46	57
PSM	VALQDAGLSVSDIDDVILVGGQTR	271	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3096.2	65.97507	4	2520.268894	2520.247264	K	M	322	346
PSM	NNGSEVQSLDPHKIEGVPESNISR	272	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1817.4	32.89755	4	2606.294094	2605.273222	R	D	44	68
PSM	VVTLSGFVESQAQAEEAVK	273	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2809.2	58.42095	3	1991.035271	1991.021137	K	V	86	105
PSM	NGQAVGTNTIGSSEACMLGGMAMK	274	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:4	ms_run[1]:scan=1.1.2416.2	48.11518	3	2385.085571	2384.059272	K	W	115	139
PSM	NFDNMREDEGLADR	275	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35	ms_run[1]:scan=1.1.1402.2	22.32783	3	1698.732071	1696.711112	R	A	107	121
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	276	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	17-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=1.1.1507.8	25.05028	4	3218.2942	3217.2572	K	L	27	60
PSM	NNGSEVQSLDPHK	277	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.1388.3	21.97232	3	1424.660771	1423.669171	R	I	44	57
PSM	AGVLAEVR	278	sp|P68679|RS21_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1457.2	23.7611	2	813.470447	813.470852	K	R	26	34
PSM	AIVEAAGLK	279	sp|P0AF93|RIDA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1486.2	24.48553	2	870.518647	870.517468	K	V	59	68
PSM	NDPLAMQR	280	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1404.2	22.37972	2	943.460447	943.454550	R	L	254	262
PSM	YVLAGEGNK	281	sp|P0A6P9|ENO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1304.2	19.92015	2	949.492247	949.486896	K	A	258	267
PSM	TEVDELTR	282	sp|P0AAT9|YBEL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1399.3	22.2522	2	961.476447	961.471640	R	A	46	54
PSM	TLNDAVEVK	283	sp|P0AG55|RL6_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1393.3	22.09708	2	987.528847	987.523676	R	H	36	45
PSM	CPFHQGGHDQSAGAGTTTR	284	sp|P13029|KATG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.1151.3	16.07158	4	1983.874894	1983.860570	K	D	16	35
PSM	CHPFFTGK	285	sp|P0A7M9|RL31_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.1376.3	21.66673	2	992.459847	992.453822	K	Q	40	48
PSM	AGNVAADGVIK	286	sp|P0A6P1|EFTS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1343.2	20.93598	2	1013.556847	1013.550559	K	T	53	64
PSM	TGEDIPITAR	287	sp|P0A6X7|IHFA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1498.3	24.80303	2	1071.563247	1071.556038	K	R	67	77
PSM	DPLDNTYTR	288	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1493.5	24.67657	2	1093.511847	1093.504003	K	N	528	537
PSM	LLAEAGYTADK	289	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1479.2	24.3029	2	1150.594847	1150.587004	K	P	373	384
PSM	AWHSSSETIAK	290	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1219.2	17.83638	2	1215.599247	1215.588401	K	I	81	92
PSM	HADNTLTFGPR	291	sp|P0AG55|RL6_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1478.2	24.27673	2	1227.610047	1227.599635	K	D	45	56
PSM	VSQASDSYYYR	292	sp|P0AEH5|ELAB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1398.5	22.2308	2	1337.601447	1337.588795	R	A	54	65
PSM	LSASYVGEDNER	293	sp|P0A8M3|SYT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1389.5	22.00347	2	1338.614847	1338.605173	R	K	493	505
PSM	AGGGSATLSMGQAAAR	294	sp|P61889|MDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1417.6	22.72785	2	1404.690847	1404.677961	K	F	218	234
PSM	ERGEGFQQAVAAHK	295	sp|P02925|RBSB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1253.2	18.70168	3	1526.763671	1526.758989	R	F	165	179
PSM	YEEITASCSCGNVMK	296	sp|P0A7M9|RL31_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,10-UNIMOD:4,14-UNIMOD:35	ms_run[1]:scan=1.1.1394.3	22.1222	3	1763.732771	1763.716458	K	I	9	24
PSM	TKPHVNVGTIGHVDHGK	297	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1257.5	18.80845	3	1794.965771	1794.948915	R	T	9	26
PSM	DGIFVEDK	298	sp|P28635|METQ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1670.2	29.233	2	921.449847	921.444363	K	E	216	224
PSM	IGENINIR	299	sp|P0A6P1|EFTS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1513.3	25.19572	2	927.518247	927.513780	K	R	126	134
PSM	FVVEGDLR	300	sp|P0A7S9|RS13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1661.3	28.99802	2	933.497447	933.491982	K	R	63	71
PSM	PLVSYIDK	301	sp|P19926|AGP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1669.3	29.20915	2	933.522447	933.517134	K	A	286	294
PSM	MQVILLDK	302	sp|P0A7R1|RL9_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1928.2	35.72528	2	958.558847	958.552139	-	V	1	9
PSM	MTDLDLAGK	303	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1610.2	27.68928	2	962.482847	962.474283	K	R	6	15
PSM	ELVASLSER	304	sp|P0AAT9|YBEL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1590.2	27.17265	2	1002.537847	1002.534575	R	L	10	19
PSM	LDTTGLIDR	305	sp|P0A953|FABB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1709.4	30.2587	2	1002.540447	1002.534575	K	K	54	63
PSM	LGAFSVVEGK	306	sp|P39180|AG43_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1797.2	32.39247	2	1005.558047	1005.549496	R	A	328	338
PSM	SQLEEIIK	307	sp|P37903|USPF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1859.2	33.95175	2	1038.509647	1038.499843	K	K	70	78
PSM	TQGVELEIR	308	sp|P0A905|SLYB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1642.3	28.49953	2	1043.568847	1043.561124	K	K	109	118
PSM	VVIAESFER	309	sp|P25516|ACNA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1693.2	29.83795	2	1048.558047	1048.555310	R	I	792	801
PSM	SAYALGASLGR	310	sp|P45523|FKBA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1686.4	29.65978	2	1064.570047	1064.561458	K	Y	48	59
PSM	DDVSQIIER	311	sp|P65294|YGDR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1773.2	31.80673	2	1073.545247	1073.535303	R	-	64	73
PSM	INQVYVVLK	312	sp|P0AFX0|HPF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1800.2	32.47165	2	1074.653247	1074.643731	R	V	34	43
PSM	GAVASLTSVAK	313	sp|P09373|PFLB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1674.3	29.34075	2	1082.544447	1082.537291	K	L	644	655
PSM	SNTFVAELK	314	sp|P61889|MDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1956.3	36.44328	2	1087.505447	1087.495092	R	G	154	163
PSM	GYLADVELSK	315	sp|P0ABB0|ATPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1849.2	33.69125	2	1093.573447	1093.565540	R	I	454	464
PSM	VEFEITNGAK	316	sp|P0A972|CSPE_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1650.3	28.70915	2	1106.570647	1106.560789	R	G	50	60
PSM	ATYYSNDFR	317	sp|P0A6N4|EFP_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0		ms_run[1]:scan=1.1.1509.5	25.09497	2	1135.5027	1135.4929	M	A	2	11
PSM	LVDIVEPTEK	318	sp|P0A7R5|RS10_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1683.3	29.57827	2	1141.632447	1141.623055	R	T	73	83
PSM	EVLEALANER	319	sp|P0A6D7|AROK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1797.4	32.39723	2	1142.602847	1142.593152	R	N	131	141
PSM	LGYQVVAVSGR	320	sp|P26646|ACUI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1679.3	29.47265	2	1147.643247	1147.634957	K	E	170	181
PSM	DSFDALASAEK	321	sp|P77247|HXPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1794.5	32.32107	2	1152.540447	1152.529883	R	L	133	144
PSM	VTVVATGIGMDK	322	sp|P0A9A6|FTSZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1700.3	30.01873	2	1189.645647	1189.637660	R	R	308	320
PSM	DALMQEYDDK	323	sp|P04825|AMPN_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1620.5	27.94407	2	1226.523847	1226.512519	R	W	729	739
PSM	TAISDLEVENR	324	sp|P07118|SYV_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1690.4	29.7652	2	1245.628247	1245.620095	R	E	181	192
PSM	EELTNGGYNIGR	325	sp|P0A6K6|DEOB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1562.4	26.47298	2	1321.638047	1321.626243	R	V	199	211
PSM	DVSGEGVQQALLK	326	sp|P0A6H1|CLPX_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1879.5	34.4816	2	1342.720447	1342.709245	R	L	201	214
PSM	ADIAIIATAQNGNK	327	sp|P0ADA5|YAJG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1739.5	30.99847	2	1398.757247	1398.746693	K	M	127	141
PSM	KRPFYQVVVADSR	328	sp|P0A7T3|RS16_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1613.3	27.76312	3	1563.865571	1563.852161	K	N	13	26
PSM	SLDDFLIK	329	sp|P0ACF8|HNS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2584.2	52.54072	2	1029.486447	1029.478379	K	Q	129	137
PSM	DTFWWADK	330	sp|P22259|PCKA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2348.2	46.38845	2	1067.479647	1067.471246	R	G	80	88
PSM	EVAEAWEVLSDEQR	331	sp|P36659|CBPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2242.3	43.62058	3	1659.788771	1659.774030	K	R	48	62
PSM	TAYWELVR	332	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2286.2	44.77568	2	1116.509447	1116.500512	R	D	265	273
PSM	FVNILMVDGK	333	sp|P02359|RS7_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2224.2	43.14215	2	1134.618847	1134.610717	K	K	26	36
PSM	YLSLLTGELPR	334	sp|P34209|YDCF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2333.3	46.00568	2	1260.712847	1260.707788	R	L	208	219
PSM	DEVFALSNIQK	335	sp|P0A8A8|RIMP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2081.4	39.65513	2	1262.662047	1262.650667	K	A	133	144
PSM	VVTLSGFVESQAQAEEAVK	336	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2539.4	51.37195	3	1991.036771	1991.021137	K	V	86	105
PSM	KYDIPVVMDSAR	337	sp|P0A853|TNAA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0		ms_run[1]:scan=1.1.1827.4	33.16	2	1393.7242	1392.7062	K	F	219	231
PSM	NGQAVGTNTIGSSEACMLGGMAMK	338	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:4	ms_run[1]:scan=1.1.2408.6	47.91353	3	2385.085571	2384.059272	K	W	115	139
PSM	NEQDGGDLVYFQGHISPGVYAR	339	sp|P0AFG8|ODP1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2148.5	41.41155	3	2423.154971	2421.134938	R	A	130	152
PSM	IIVACGGAVATSTMAAEEIK	340	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3553.2	77.79169	3	1992.0332	1991.0062	K	E	5	25
PSM	IIVACGGAVATSTMAAEEIK	341	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3377.3	73.33058	3	1992.0342	1991.0062	K	E	5	25
PSM	QMGNSEVGHVNLGAGR	342	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.1985.2	37.2089	2	1688.7232	1687.7132	R	I	60	76
PSM	DVFVHFSAIQGNGFK	343	sp|P0A9Y6|CSPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2351.8	46.48314	2	1665.844047	1664.831091	K	T	28	43
PSM	NGNPSGEGFTSGVTNNGR	344	sp|P06996|OMPC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.1567.8	26.60493	2	1764.790247	1763.782303	K	D	174	192
PSM	ADLNVPVK	345	sp|P0A799|PGK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1466.2	23.96718	2	854.490447	854.486168	R	D	20	28
PSM	EDLLASGR	346	sp|P0A6Q3|FABA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1422.2	22.84922	2	859.444647	859.439946	K	G	11	19
PSM	SREVVEQEYR	347	sp|P0A6T1|G6PI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1217.2	17.78753	3	1293.630071	1293.631329	K	D	436	446
PSM	NLVQQVAK	348	sp|P61889|MDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1395.3	22.14783	2	898.527047	898.523616	K	T	100	108
PSM	SGFQYHGR	349	sp|P0C018|RL18_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1203.4	17.43543	2	950.443247	950.435864	R	V	95	103
PSM	VNIQIADGK	350	sp|P0ADE6|KBP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1481.2	24.35543	2	956.533447	956.529095	K	A	46	55
PSM	TAVINAASGR	351	sp|P0AEX9|MALE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1248.4	18.5761	2	958.525247	958.519593	R	Q	371	381
PSM	AQFTDAAIK	352	sp|P0AGD3|SODF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1453.2	23.65578	2	963.507847	963.502546	K	N	109	118
PSM	MTDLDLAGK	353	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1453.3	23.65817	2	978.473647	978.469198	K	R	6	15
PSM	DENDEFVK	354	sp|P37689|GPMI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1378.3	21.71752	2	994.432047	994.424356	R	A	230	238
PSM	HNTLGTEFK	355	sp|P0AEP3|GALU_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1302.4	19.87257	2	1045.522847	1045.519259	R	A	283	292
PSM	KIIGEQLGVK	356	sp|P0A6A8|ACP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1431.4	23.08418	2	1083.671047	1083.665195	K	Q	10	20
PSM	GLGAGANPEVGR	357	sp|P0A9A6|FTSZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1326.3	20.49338	2	1096.565647	1096.562521	K	N	67	79
PSM	GGGDETFVQGR	358	sp|P0A8A2|YEEN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1332.4	20.65267	2	1121.520447	1121.510151	K	Y	73	84
PSM	ALGADEVVNSR	359	sp|P75691|YAHK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1439.6	23.29742	2	1129.579847	1129.572751	K	N	216	227
PSM	TVVVEGCEEK	360	sp|P64463|YDFZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1239.4	18.3448	2	1148.548047	1148.538340	K	L	46	56
PSM	TFTTQETMTNAHSAR	361	sp|P0A6T1|G6PI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.1398.4	22.22842	3	1774.750871	1774.734564	K	D	209	224
PSM	DAGYTAVISHR	362	sp|P0A6P9|ENO_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1471.3	24.10005	2	1188.599247	1188.588736	K	S	361	372
PSM	STCTGVEMFR	363	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=1.1.1411.5	22.56873	2	1202.514647	1202.505994	K	K	254	264
PSM	VEGWENAEAAK	364	sp|P0A7A9|IPYR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1438.5	23.26903	2	1202.566447	1202.556767	K	A	153	164
PSM	QLASVTVEDSR	365	sp|P0A805|RRF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1430.5	23.06042	2	1203.620447	1203.609531	R	T	53	64
PSM	AIASDCADGMTK	366	sp|P0A9P0|DLDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1278.3	19.2437	2	1238.539047	1238.527123	R	L	387	399
PSM	EGVSKDDAEALK	367	sp|P0A7K2|RL7_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1242.2	18.41585	3	1260.623471	1260.619761	K	K	97	109
PSM	VADGATVVSTSTR	368	sp|P36683|ACNB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1313.5	20.15745	2	1262.656247	1262.646644	R	N	779	792
PSM	TQEQQVVAACDK	369	sp|P0A867|TALA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:4	ms_run[1]:scan=1.1.1230.7	18.12533	2	1375.650647	1375.640179	K	L	64	76
PSM	QEAAPAAAPAPAAGVK	370	sp|P06959|ODP2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1321.8	20.37455	2	1418.763647	1418.751778	K	E	192	208
PSM	EISSHDSSTNGLINR	371	sp|P0A6T1|G6PI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1356.6	21.2862	3	1628.778071	1628.775427	K	Y	529	544
PSM	NFDNMREDEGLADR	372	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1252.3	18.67823	3	1680.726371	1680.716197	R	A	107	121
PSM	RFEEHLQHEAQER	373	sp|P39177|USPG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1258.7	18.83977	3	1707.819971	1707.807730	R	L	57	70
PSM	RFEEHLQHEAQER	374	sp|P39177|USPG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1249.5	18.60463	3	1707.822371	1707.807730	R	L	57	70
PSM	HYGALQGLNKAETAEK	375	sp|P62707|GPMA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1400.4	22.28055	3	1728.894071	1728.879498	R	Y	91	107
PSM	HSHEHHADDEPCVVR	376	sp|P04805|SYE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4	ms_run[1]:scan=1.1.1167.2	16.48878	4	1823.785694	1823.775778	R	F	127	142
PSM	FGSELLAK	377	sp|P02359|RS7_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1642.2	28.49715	2	863.477247	863.475269	K	F	18	26
PSM	SVEEILGK	378	sp|P0A7W1|RS5_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1630.3	28.18608	2	873.484047	873.480748	K	-	160	168
PSM	SGISFVDR	379	sp|P69828|PTKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1615.3	27.81342	2	879.450447	879.445031	R	S	8	16
PSM	PWVGGYTGK	380	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1537.2	25.82328	2	963.487047	963.481417	K	D	519	528
PSM	TEFDVILK	381	sp|P0A7K2|RL7_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2037.2	38.51665	2	963.532647	963.527698	K	A	53	61
PSM	MITGIQITK	382	sp|P68066|GRCA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1723.4	30.6249	2	1003.578247	1003.573603	-	A	1	10
PSM	AEIVASFER	383	sp|P0A7A9|IPYR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1686.2	29.65502	2	1020.530247	1020.524010	K	A	164	173
PSM	NIEFFEAR	384	sp|P0A7R1|RL9_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1974.2	36.91632	2	1024.504847	1024.497795	K	R	43	51
PSM	DVVLVDAGLK	385	sp|P0AG67|RS1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1969.2	36.78483	2	1027.599647	1027.591361	K	S	34	44
PSM	GDVLEMNIR	386	sp|P0ADU2|YGIN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1854.2	33.8209	2	1045.530047	1045.522630	K	I	90	99
PSM	DQFVQPVVK	387	sp|P0ADB1|OSME_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1614.3	27.78813	2	1058.585247	1058.576046	K	D	29	38
PSM	GYEFINDIK	388	sp|P0A6M8|EFG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1974.3	36.9187	2	1097.547247	1097.539326	K	G	533	542
PSM	LYIYDHCPYCLK	389	sp|P0AC59|GLRX2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1872.2	34.2907	3	1643.760971	1643.747621	K	A	3	15
PSM	YADMLAMSAK	390	sp|P0A853|TNAA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1768.4	31.6837	2	1099.513247	1099.504203	K	K	260	270
PSM	DAGLNVVMDR	391	sp|P75874|YCCU_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:35	ms_run[1]:scan=1.1.1549.6	26.13733	2	1104.533647	1104.523358	R	C	115	125
PSM	VLDLIAHISK	392	sp|P0A9B2|G3P1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1940.3	36.0358	2	1107.674647	1107.665195	K	-	322	332
PSM	SDVFHLGLTK	393	sp|P12758|UDP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1914.3	35.3594	2	1115.608447	1115.597509	K	N	4	14
PSM	QGDLICLDGK	394	sp|P0A836|SUCC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1762.3	31.52438	2	1117.553847	1117.543759	K	L	206	216
PSM	ELYLGAVVDR	395	sp|P0A836|SUCC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2018.3	38.01853	2	1133.617847	1133.608074	K	S	107	117
PSM	SIGFSSSSTGR	396	sp|P0C037|PPNP_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.1544.3	26.00388	2	1164.491447	1164.481233	K	A	14	25
PSM	VVNTLGAPIDGK	397	sp|P0ABB0|ATPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1578.3	26.8745	2	1182.670647	1182.660838	R	G	107	119
PSM	ALAQQLMQER	398	sp|P0A6L4|NANA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1716.4	30.44105	2	1186.623247	1186.612842	K	G	287	297
PSM	DNQIVTLTASR	399	sp|P0ADA5|YAJG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1718.5	30.49577	2	1216.652247	1216.641165	R	D	64	75
PSM	DIDGEVTTLEK	400	sp|P06610|BTUE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1832.3	33.28697	2	1218.609447	1218.597963	K	F	12	23
PSM	VLVPTQEAIQK	401	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1590.5	27.1798	2	1224.719247	1224.707788	K	L	202	213
PSM	SVTAIDISSEK	402	sp|P0A9S3|GATD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1717.2	30.46233	2	1228.570447	1228.558815	K	L	187	198
PSM	PLCAVGAPAQVR	403	sp|P0AF96|TABA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4	ms_run[1]:scan=1.1.1518.2	25.32463	2	1237.670847	1237.660127	K	K	130	142
PSM	QILLDTYYGR	404	sp|P0A9Q7|ADHE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2009.3	37.78248	2	1240.656247	1240.645188	K	D	856	866
PSM	ITSVNVGGMAFR	405	sp|P69797|PTNAB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1935.2	35.90952	2	1250.656247	1250.644142	K	Q	260	272
PSM	STCTGVEMFR	406	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,3-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=1.1.1577.4	26.8511	2	1282.483647	1282.472325	K	K	254	264
PSM	EAVQFLTGEYR	407	sp|P07650|TYPH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1972.2	36.86386	2	1311.658847	1311.645916	R	N	258	269
PSM	LQGIAQQNSFK	408	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.1587.5	27.10572	2	1312.628247	1312.617667	K	H	454	465
PSM	DVVIGMGACTDSK	409	sp|P0ABP8|DEOD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4	ms_run[1]:scan=1.1.1691.4	29.7914	2	1351.624647	1351.611187	R	V	103	116
PSM	NNTPGNYTFILK	410	sp|P0AFR4|YCIO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1989.6	37.30237	2	1380.717247	1380.703765	K	G	91	103
PSM	EPARPMVAIVGGSK	411	sp|P0A799|PGK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1552.2	26.20592	3	1410.772571	1410.765320	K	V	180	194
PSM	QFFDEHQATYPTR	412	sp|P0AGL2|TDCF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1642.5	28.50432	3	1638.758471	1638.742670	K	S	93	106
PSM	SLDDFLIK	413	sp|P0ACF8|HNS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2276.2	44.51323	2	949.517447	949.512048	K	Q	129	137
PSM	SLDDFLIK	414	sp|P0ACF8|HNS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2576.2	52.32897	2	1029.486447	1029.478379	K	Q	129	137
PSM	VGLFQDTSAF	415	sp|P0A6Q3|FABA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2539.2	51.36718	2	1083.533847	1083.523676	K	-	163	173
PSM	NELEDLLEK	416	sp|P0AFZ1|SSEB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2236.2	43.46053	2	1101.564447	1101.555370	K	A	6	15
PSM	ILADIAVFDK	417	sp|P0A7L3|RL20_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2248.3	43.77991	2	1103.633247	1103.622661	K	V	94	104
PSM	VVTLSGFVESQAQAEEAVK	418	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2346.4	46.34072	3	1991.040371	1991.021137	K	V	86	105
PSM	ALSHTLLMFDNFYDVEEK	419	sp|P36683|ACNB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2565.5	52.05455	3	2171.045471	2171.024507	K	A	118	136
PSM	SLNFLDFEQPIAELEAK	420	sp|P0ABD5|ACCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=1.1.2957.2	62.3168	3	1963.0072	1962.9932	M	I	2	19
PSM	MVAFSNYFFDTTQGHSQINGCTVR	421	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	21-UNIMOD:4	ms_run[1]:scan=1.1.2419.5	48.19965	4	2780.275294	2779.248270	K	N	128	152
PSM	NNGSEVQSLDPHK	422	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1350.7	21.13108	2	1424.672447	1423.669171	R	I	44	57
PSM	VVTLSGFVESQAQAEEAVK	423	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2329.3	45.89897	3	1991.036171	1991.021137	K	V	86	105
PSM	NGEWQNDVGAASSIYEEYYQK	424	sp|P0AFK9|POTD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=1.1.2638.4	53.9119	3	2451.0982	2450.0662	K	L	323	344
PSM	EIGNGFSELNDAEDQAER	425	sp|P0A8N5|SYK2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=1.1.2107.8	40.34753	2	1993.8922	1992.8652	R	F	422	440
PSM	NFDNMREDEGLADR	426	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:35	ms_run[1]:scan=1.1.1394.2	22.11982	3	1698.732071	1696.711112	R	A	107	121
PSM	IIVACGGAVATSTMAAEEIK	427	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	5-UNIMOD:4	ms_run[1]:scan=1.1.2827.3	58.88445	3	1992.0342	1991.0062	K	E	5	25
PSM	ELCQNHNIPVELIQCR	428	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2034.4	38.44207	3	2022.996971	2021.977515	K	V	25	41
PSM	QMGNSEVGHVNLGAGR	429	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1308.5	20.03248	3	1704.754271	1704.740318	R	I	60	76
PSM	DANFVEEVEEE	430	sp|P0AD49|YFIA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2423.3	48.29835	2	1309.540047	1308.535757	K	-	103	114
PSM	NIEFFEAR	431	sp|P0A7R1|RL9_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1982.2	37.12193	2	1024.504847	1024.497795	K	R	43	51
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	432	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	26-UNIMOD:35	ms_run[1]:scan=1.1.1689.7	29.74592	4	3202.2992	3201.2622	K	L	27	60
PSM	DWYTLMNTIINGSASEADAAR	433	sp|P0ACA3|SSPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=1.1.3166.4	67.7798	3	2299.0882	2298.0582	K	K	109	130
PSM	IGDISTSNEMSTADAK	434	sp|P75694|YAHO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.1695.8	29.90233	2	1718.717647	1718.707012	K	E	40	56
PSM	NSQTGNWQAYDMIAEGVSMITTK	435	sp|P0ADV7|MLAC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3341.4	72.402	3	2545.185071	2544.162474	K	Q	155	178
PSM	TDGSSTLASFGER	436	sp|P77804|YDGA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.1693.4	29.84272	2	1327.620047	1326.605173	K	V	219	232
PSM	NAFSQALK	437	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1493.2	24.66942	2	877.470047	877.465767	K	N	237	245
PSM	LGEFAPTR	438	sp|P0A7U3|RS19_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1468.2	24.01978	2	889.469647	889.465767	K	T	71	79
PSM	FDGTVEVK	439	sp|P0A9B2|G3P1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1395.2	22.14545	2	893.451647	893.449448	R	D	54	62
PSM	HQGTFDVAR	440	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1249.2	18.59748	2	1029.505647	1029.499192	R	A	431	440
PSM	KATVELLNR	441	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1395.6	22.15498	2	1042.619247	1042.613494	K	Q	27	36
PSM	FQDEEVQR	442	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1239.2	18.34003	2	1049.483247	1049.477788	R	D	77	85
PSM	DPLDNTYTR	443	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1485.4	24.46393	2	1093.511847	1093.504003	K	N	528	537
PSM	TNTTDVATFK	444	sp|P00805|ASPG2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1396.4	22.17638	2	1096.547447	1096.540054	K	S	185	195
PSM	TQQIEELQK	445	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1326.4	20.49577	2	1115.589247	1115.582253	R	E	5	14
PSM	GDAATVESVDR	446	sp|P0ACD8|MBHL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1261.3	18.90813	2	1118.528047	1118.520381	K	M	423	434
PSM	QGNEFGATTGR	447	sp|P0A7D4|PURA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1260.5	18.88703	2	1136.529847	1136.521050	K	R	294	305
PSM	VLNNGDLGENK	448	sp|P0AD61|KPYK1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1287.4	19.4801	2	1171.591847	1171.583316	K	G	146	157
PSM	DAGYTAVISHR	449	sp|P0A6P9|ENO_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1479.4	24.30768	2	1188.599247	1188.588736	K	S	361	372
PSM	LQEDESFTNK	450	sp|P0ABK5|CYSK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1342.6	20.9193	2	1209.561047	1209.551347	K	N	284	294
PSM	DNLAAANPQVVK	451	sp|P77318|YDEN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1475.6	24.2082	2	1238.672047	1238.661900	K	E	513	525
PSM	DGHALSDEEIR	452	sp|P07650|TYPH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1332.5	20.65505	2	1240.579647	1240.568394	R	F	13	24
PSM	KDDGNTIMVVQK	453	sp|P0A905|SLYB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1377.5	21.69698	2	1346.698247	1346.686401	R	Q	118	130
PSM	AGGGSATLSMGQAAAR	454	sp|P61889|MDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=1.1.1216.8	17.77473	2	1420.685647	1420.672876	K	F	218	234
PSM	QVEEAGDKLPADDK	455	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1243.4	18.44672	3	1513.734971	1513.726017	K	T	549	563
PSM	SDVLFNFNK	456	sp|P0A910|OMPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2058.2	39.06733	2	1082.548047	1082.539660	K	A	219	228
PSM	EMVELDQ	457	sp|P65292|YGDI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1685.2	29.62893	2	862.377647	862.374234	K	-	69	76
PSM	SIVVAIER	458	sp|P0AG63|RS17_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1641.2	28.47072	2	885.532647	885.528367	K	F	20	28
PSM	TPPAAVLLK	459	sp|P0A7J7|RL11_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1654.2	28.81143	2	908.573447	908.569504	K	K	73	82
PSM	DNLAEFSK	460	sp|P0AEE5|DGAL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1519.2	25.35057	2	922.444047	922.439612	K	K	324	332
PSM	GIANSILIK	461	sp|P0A6P9|ENO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1803.2	32.5499	2	927.581647	927.575317	K	F	334	343
PSM	LMDLSINK	462	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1776.3	31.88608	2	932.505247	932.500103	K	N	75	83
PSM	INVATELK	463	sp|P0C8J6|GATY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1754.2	31.37937	2	966.482247	966.478714	K	N	229	237
PSM	MQVILLDK	464	sp|P0A7R1|RL9_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1655.2	28.8375	2	974.551047	974.547054	-	V	1	9
PSM	DDALAFVDK	465	sp|P08244|PYRF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1964.2	36.65217	2	992.489247	992.481476	R	I	27	36
PSM	GLEFSPDLK	466	sp|P0AGD1|SODC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1914.2	35.35702	2	1004.524047	1004.517862	K	A	49	58
PSM	QAVLDQFAK	467	sp|P0ADU2|YGIN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1685.3	29.63132	2	1018.550047	1018.544745	R	I	18	27
PSM	FEELVQTR	468	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1549.5	26.13495	2	1020.533047	1020.524010	K	N	529	537
PSM	LVDAINQLR	469	sp|P0AC38|ASPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1748.2	31.22347	2	1040.602047	1040.597844	K	E	163	172
PSM	IEEDLLGTR	470	sp|P0AC38|ASPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1712.2	30.33132	2	1044.552247	1044.545139	R	E	7	16
PSM	ATLEDLGQAK	471	sp|P0A6F5|CH60_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1522.4	25.43403	2	1044.552847	1044.545139	K	R	312	322
PSM	YDAVLVAIGR	472	sp|P0A9P0|DLDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2047.2	38.77647	2	1075.611247	1075.602595	R	V	264	274
PSM	VCEFWADR	473	sp|P28904|TREC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=1.1.1839.2	33.4394	2	1081.475247	1081.465115	K	G	185	193
PSM	VVEPLITLAK	474	sp|P0AG44|RL17_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2028.2	38.27862	2	1081.682647	1081.674697	R	T	47	57
PSM	LLADDIVPSR	475	sp|P0AFH8|OSMY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1874.3	34.34578	2	1097.618647	1097.608074	K	H	146	156
PSM	QTDLVEAMAK	476	sp|P0A715|KDSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1673.3	29.31442	2	1104.555447	1104.548510	R	T	121	131
PSM	DIDIQSPTAR	477	sp|P0A6N8|EFPL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1573.2	26.74243	2	1114.571847	1114.561852	K	G	24	34
PSM	VADDAPLMER	478	sp|P63020|NFUA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1513.5	25.20048	2	1115.525647	1115.528109	K	V	101	111
PSM	DALLENVTVR	479	sp|P22259|PCKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1921.3	35.54333	2	1128.620247	1128.613888	R	E	307	317
PSM	LVDIVEPTEK	480	sp|P0A7R5|RS10_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1675.4	29.36952	2	1141.632447	1141.623055	R	T	73	83
PSM	TQTGELSIHCTELR	481	sp|P0A8N5|SYK2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.1685.4	29.6337	3	1723.773371	1723.760051	K	L	131	145
PSM	EVTSIQFTAR	482	sp|P77695|GNSB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1685.5	29.63608	2	1150.608047	1150.598238	K	E	32	42
PSM	KNIEFFEAR	483	sp|P0A7R1|RL9_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1641.3	28.4731	2	1152.602047	1152.592758	K	R	42	51
PSM	GFGSFSLHYR	484	sp|P0A6Y1|IHFB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1847.3	33.6432	2	1169.569647	1169.561792	R	A	47	57
PSM	HYHPQDATTNPSLLLK	485	sp|P0A867|TALA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1646.6	28.6112	3	1833.955271	1833.937347	R	A	25	41
PSM	TMNLGTVSEER	486	sp|P0A9Q1|ARCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1548.2	26.10152	2	1235.593647	1235.581601	R	R	121	132
PSM	QNGDDFVLTPK	487	sp|P61316|LOLA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1716.5	30.44343	2	1232.614847	1232.603717	K	A	129	140
PSM	LVLVLNCGSSSLK	488	sp|P0A6A3|ACKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2015.5	37.94444	2	1388.782847	1388.769737	K	F	5	18
PSM	YQAFTQADLTNLR	489	sp|P67910|HLDD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2053.7	38.94717	2	1539.775247	1539.768157	R	A	272	285
PSM	EFKFFPAEANGGVK	490	sp|P0A955|ALKH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1963.2	36.62582	3	1539.781271	1539.772179	K	A	131	145
PSM	TEFDVILK	491	sp|P0A7K2|RL7_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2221.3	43.06585	2	1043.501847	1043.494029	K	A	53	61
PSM	DTFWWADK	492	sp|P22259|PCKA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2356.2	46.60137	2	1067.479647	1067.471246	R	G	80	88
PSM	EFVFTIADK	493	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2146.2	41.35233	2	1068.558047	1068.549162	R	V	66	75
PSM	SLEQYFGR	494	sp|P0A7X3|RS9_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2107.2	40.33323	2	1078.458447	1078.448476	R	E	34	42
PSM	SVFDTLATAAK	495	sp|P00805|ASPG2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2130.2	40.93623	2	1122.601647	1122.592090	K	T	274	285
PSM	FFSQPLLLGK	496	sp|P61889|MDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2223.2	43.116	2	1148.670047	1148.659381	R	N	263	273
PSM	MVVTLIHPIAMDDGLR	497	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:35	ms_run[1]:scan=1.1.2101.4	40.17862	3	1795.942571	1795.932462	K	F	359	375
PSM	GPTLLEDFILR	498	sp|P21179|CATE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2761.2	57.14428	2	1272.719847	1272.707788	R	E	101	112
PSM	NNGSEVQSLDPHKIEGVPESNISR	499	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1860.3	33.98015	4	2606.297294	2605.273222	R	D	44	68
PSM	EQDAPITADQLLAPCDGER	500	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:4	ms_run[1]:scan=1.1.2261.6	44.12948	3	2097.973271	2097.963698	R	T	395	414
PSM	ADEQILDIGDASAQELAEILK	501	sp|P0A799|PGK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=1.1.3198.6	68.63002	3	2242.1642	2241.1372	K	N	279	300
PSM	ATNLLYTR	502	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1523.3	25.45783	2	950.523647	950.518531	K	N	11	19
PSM	NGEFIEITEK	503	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2037.3	38.51903	2	1179.579647	1178.581919	K	D	18	28
PSM	HGDNPLNGYSICAFPDAADK	504	sp|P31658|HCHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4	ms_run[1]:scan=1.1.2228.7	43.26012	3	2161.968671	2160.953468	R	Q	196	216
PSM	KGGPLADGIVITPSHNPPEDGGIK	505	sp|P36938|PGM_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.1924.8	35.63437	3	2448.221471	2448.205005	K	Y	133	157
PSM	NASNDGSEGMLGAGTGMDANGGNGNMSSEEQAR	506	sp|P0A912|PAL_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35,17-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=1.1.1320.8	20.3482	4	3234.280094	3233.252776	K	L	27	60
PSM	DVRPPAGWEEPGASNNSGDNGSPK	507	sp|P0AAI3|FTSH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1700.8	30.03065	3	2438.109971	2437.089444	R	A	597	621
PSM	DVRPPAGWEEPGASNNSGDNGSPK	508	sp|P0AAI3|FTSH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1692.7	29.82437	3	2438.109971	2437.089444	R	A	597	621
PSM	TWQTQPALLTASVALYR	509	sp|P0AAI9|FABD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2519.2	50.84778	3	1918.028771	1918.031248	K	V	59	76
PSM	ADYADSLTENGTHGSDSVESAAR	510	sp|P0A763|NDK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1660.6	28.97862	3	2353.029971	2352.010191	R	E	105	128
PSM	NYYQLPVVQSGTQSTASQGNR	511	sp|P0AB10|PQIC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.1882.5	34.55703	3	2300.093471	2297.103637	K	L	24	45
PSM	FNDAVIR	512	sp|P02358|RS6_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1442.2	23.36712	2	833.439847	833.439552	R	S	80	87
PSM	EHILLGR	513	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1376.2	21.66435	2	836.487447	836.486837	R	Q	118	125
PSM	ATVNQLVR	514	sp|P0A7S3|RS12_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=1.1.1387.4	21.94818	2	899.5189	899.5183	M	K	2	10
PSM	AVVESIQR	515	sp|P0A7W7|RS8_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1293.2	19.63193	2	900.506847	900.502881	K	V	70	78
PSM	LVSNIDER	516	sp|P0A8F0|UPP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1296.2	19.71055	2	944.496447	944.492710	K	M	117	125
PSM	DSVSYGVVK	517	sp|P0AB71|ALF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1436.2	23.20995	2	952.492647	952.486562	K	M	277	286
PSM	IVEALEQR	518	sp|P37182|HYBD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1420.3	22.7999	2	956.534847	956.529095	R	Y	22	30
PSM	VHIINLEK	519	sp|P0A7V0|RS2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1482.3	24.38415	2	964.578047	964.570566	K	T	38	46
PSM	SYEEELAK	520	sp|P0AEX9|MALE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1357.2	21.30302	2	967.456447	967.449842	K	D	332	340
PSM	GEVLAVGNGR	521	sp|P0A6F9|CH10_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1378.2	21.71513	2	970.526047	970.519593	R	I	38	48
PSM	VTVQDAVEK	522	sp|P0A800|RPOZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1328.2	20.54345	2	987.527447	987.523676	R	I	4	13
PSM	DASDLLRK	523	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.1502.3	24.90858	2	996.469447	996.464126	R	I	144	152
PSM	TECAVDAIR	524	sp|P0A955|ALKH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4	ms_run[1]:scan=1.1.1384.6	21.8755	2	1033.496247	1033.486245	R	A	50	59
PSM	AAADEWDER	525	sp|P25738|MSYB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1383.5	21.84778	2	1061.448047	1061.441403	R	-	116	125
PSM	VQQPEFAAAK	526	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1386.5	21.9244	2	1087.572047	1087.566209	K	D	382	392
PSM	MTETGGNFDK	527	sp|P0A6Q3|FABA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1244.4	18.47262	2	1098.470847	1098.465174	K	G	43	53
PSM	VIASELGEER	528	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1441.2	23.3406	2	1101.575447	1101.566603	K	F	489	499
PSM	IVGDDEADFK	529	sp|P0A6W5|GREA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1497.3	24.77665	2	1107.518647	1107.508420	R	Q	107	117
PSM	VELENGHVVTAHISGK	530	sp|P69222|IF1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1440.2	23.3142	3	1688.898071	1688.884583	R	M	24	40
PSM	RFEEHLQHEAQER	531	sp|P39177|USPG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1241.4	18.39492	3	1707.822371	1707.807730	R	L	57	70
PSM	GQAHWEGDIK	532	sp|P0C0L2|OSMC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1306.6	19.98218	2	1139.546647	1139.535972	K	R	7	17
PSM	NQLRDEVDR	533	sp|P0ABS1|DKSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1223.5	17.94298	2	1143.572447	1143.563249	R	T	49	58
PSM	RVEITGPVER	534	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1344.4	20.9668	2	1154.649047	1154.640771	R	K	91	101
PSM	ISDAAQAHFAK	535	sp|P63020|NFUA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1244.5	18.475	2	1157.591247	1157.582922	R	L	4	15
PSM	THAGIEQAISR	536	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1313.3	20.15268	2	1181.623847	1181.615285	R	G	265	276
PSM	STCTGVEMFR	537	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=1.1.1403.3	22.35612	2	1202.517047	1202.505994	K	K	254	264
PSM	DTVEIQGEVDK	538	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1466.5	23.97433	2	1231.605447	1231.593212	K	D	103	114
PSM	ELISNASDAADK	539	sp|P0A6Z3|HTPG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1352.4	21.17635	2	1232.600047	1232.588461	R	L	34	46
PSM	LLQQSGTFDSR	540	sp|P0DTT0|BIPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1478.3	24.27912	2	1250.636447	1250.625515	K	A	25	36
PSM	VYYHHTGHIGGIK	541	sp|P0AA10|RL13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1221.4	17.89087	2	1480.772247	1480.757532	K	Q	73	86
PSM	HYAHVDCPGHADYVK	542	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1292.6	19.61547	3	1767.792071	1767.778738	R	N	76	91
PSM	SLNVALR	543	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1763.2	31.54835	2	851.429847	851.426618	R	Q	113	120
PSM	SLNVALR	544	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1752.2	31.3279	2	851.431647	851.426618	R	Q	113	120
PSM	SLNVALR	545	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1744.3	31.12192	2	851.431647	851.426618	R	Q	113	120
PSM	SLNVALR	546	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1777.2	31.90988	2	851.432047	851.426618	R	Q	113	120
PSM	GLTEALTR	547	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1521.2	25.40295	2	859.482447	859.476331	R	V	208	216
PSM	INVATELK	548	sp|P0C8J6|GATY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1512.2	25.16698	2	886.516247	886.512383	K	N	229	237
PSM	ATVELLNR	549	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1571.2	26.69075	2	914.521047	914.518531	K	Q	28	36
PSM	SLEEIIR	550	sp|P0AGD3|SODF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1960.2	36.54653	2	938.454047	938.447414	K	S	52	59
PSM	LTIAPALLK	551	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2025.2	38.20052	2	938.618047	938.616454	R	E	242	251
PSM	DGIPAVVER	552	sp|P60422|RL2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1637.2	28.36583	2	954.521447	954.513445	K	L	72	81
PSM	LTVLDSLSK	553	sp|P0A799|PGK_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1946.2	36.1856	2	974.568047	974.564812	K	I	198	207
PSM	YWDVELR	554	sp|P69908|DCEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1988.2	37.26785	2	979.483647	979.476331	R	E	172	179
PSM	NFLDYCR	555	sp|P23869|PPIB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1794.2	32.31392	2	986.435447	986.428001	K	E	26	33
PSM	EDEIVIDR	556	sp|P08839|PT1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1526.2	25.53457	2	987.493047	987.487290	K	K	21	29
PSM	DLNLTDAQK	557	sp|P77754|SPY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1512.4	25.17175	2	1016.518247	1016.513839	K	Q	54	63
PSM	NLALNIESR	558	sp|P00350|6PGD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1720.2	30.54167	2	1028.565647	1028.561458	R	G	17	26
PSM	ELTLWESR	559	sp|P0ACA3|SSPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1989.3	37.29522	2	1032.531647	1032.524010	R	I	66	74
PSM	SPMVGTFYR	560	sp|P0ABD8|BCCP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1712.3	30.3337	2	1056.516447	1056.506251	R	T	85	94
PSM	YQLTALEAR	561	sp|P29217|YCEH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1741.5	31.04865	2	1063.575847	1063.566209	K	V	3	12
PSM	DVLETLGTDK	562	sp|P0A8W5|YQGE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1866.2	34.13372	2	1089.565447	1089.555370	R	Q	110	120
PSM	DVTSLLEDPK	563	sp|P69503|APT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2052.2	38.90887	2	1115.580847	1115.571020	R	A	30	40
PSM	MQGSVTEFLK	564	sp|P0A7Z4|RPOA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1914.5	35.36417	2	1138.580447	1138.569246	-	P	1	11
PSM	SVTAIDISSEK	565	sp|P0A9S3|GATD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1551.4	26.18462	2	1148.600447	1148.592484	K	L	187	198
PSM	QPVWLDEYR	566	sp|P31979|NUOF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2008.2	37.75523	2	1204.599047	1204.587673	K	S	22	31
PSM	ATYYSNDFR	567	sp|P0A6N4|EFP_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.1661.5	29.0028	2	1215.4712	1215.4592	M	A	2	11
PSM	SVTAIDISSEK	568	sp|P0A9S3|GATD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.1669.6	29.2163	2	1228.569447	1228.558815	K	L	187	198
PSM	EIMQVALNQAK	569	sp|P05055|PNP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1766.5	31.6337	2	1243.671447	1243.659458	K	G	517	528
PSM	DSTGICFIGER	570	sp|P25745|MNMA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1978.3	37.02368	2	1253.583447	1253.571037	K	K	194	205
PSM	QLASVTVEDSR	571	sp|P0A805|RRF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.1512.5	25.17413	2	1283.588447	1283.575862	R	T	53	64
PSM	SQVTFQYDDGK	572	sp|P0A817|METK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1533.4	25.7231	2	1286.589847	1286.577896	K	I	167	178
PSM	NELTYGFQSAQK	573	sp|P0ABH9|CLPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1674.7	29.35028	2	1384.674047	1384.662294	K	H	740	752
PSM	LSDEVTDSPMVDK	574	sp|P0A908|MIPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1602.5	27.494	2	1434.668847	1434.654826	R	S	222	235
PSM	SILSELVR	575	sp|P60723|RL4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2214.2	42.87908	2	915.543247	915.538932	K	Q	107	115
PSM	IISLAPEVL	576	sp|P0ADY3|RL14_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2546.2	51.55298	2	953.584847	953.579734	K	-	115	124
PSM	LVIWINGDK	577	sp|P0AEX9|MALE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2060.2	39.11997	2	1056.603047	1056.596781	K	G	33	42
PSM	FLLQEVLEK	578	sp|P0ADA5|YAJG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2396.2	47.58648	2	1117.647847	1117.638311	R	Q	78	87
PSM	IDMSEFMEK	579	sp|P63284|CLPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2141.2	41.22488	2	1128.489447	1128.483133	R	H	632	641
PSM	DGDGFAWIER	580	sp|P0ADE8|YGFZ_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2281.2	44.64472	2	1164.530447	1164.519987	R	R	78	88
PSM	ISDDLYVFK	581	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2325.3	45.79247	2	1178.537047	1178.526058	R	D	71	80
PSM	GIDTVLAELR	582	sp|P0A7M2|RL28_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2943.2	61.94588	2	1165.584847	1165.574405	K	A	63	73
PSM	VVTLSGFVESQAQAEEAVK	583	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3520.2	76.95535	3	1991.039171	1991.021137	K	V	86	105
PSM	QMGNSEVGHVNLGAGR	584	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.1960.3	36.54892	3	1688.7362	1687.7132	R	I	60	76
PSM	SLNVALR	585	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1726.2	30.69353	2	851.431647	851.426618	R	Q	113	120
PSM	SLNVALR	586	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1735.2	30.89595	2	851.431647	851.426618	R	Q	113	120
PSM	QMEITPAIR	587	sp|P0AD49|YFIA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=1.1.2092.2	39.9387	2	1040.5393	1040.5319	K	Q	9	18
PSM	DVRPPAGWEEPGASNNSGDNGSPK	588	sp|P0AAI3|FTSH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1704.5	30.1293	4	2438.106494	2437.089444	R	A	597	621
PSM	DVRPPAGWEEPGASNNSGDNGSPK	589	sp|P0AAI3|FTSH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1708.7	30.23945	3	2438.109971	2437.089444	R	A	597	621
PSM	DGPMFVDLDDAR	590	sp|P0C0K3|SRKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=1.1.2284.3	44.72552	2	1350.6132	1349.5912	R	N	211	223
PSM	EIGEVLATHDETQR	591	sp|P33590|NIKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1516.4	25.27687	3	1597.792571	1596.774364	K	Q	456	470
PSM	DANGNLLADGDSVTIIK	592	sp|P0AFJ1|YJDM_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2306.7	45.30175	2	1715.889247	1714.873744	K	D	46	63
PSM	TQTQLQQQHLENQINNNSQR	593	sp|P0ADX7|YHHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.1455.8	23.72287	3	2422.194071	2421.174511	K	V	60	80
PSM	LATELAR	594	sp|P0AA10|RL13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1306.2	19.97265	2	772.447247	772.444303	R	R	28	35
PSM	HHNEFHEQCVER	595	sp|Q46920|QUEF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=1.1.1170.2	16.56767	4	1620.692894	1620.685172	R	I	224	236
PSM	RMGHAGAIIAGGK	596	sp|P0AGE9|SUCD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35	ms_run[1]:scan=1.1.1148.2	15.99055	3	1253.672771	1253.666275	K	G	244	257
PSM	NMAGSLVR	597	sp|P0AG44|RL17_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1398.2	22.22365	2	846.440047	846.438172	R	H	23	31
PSM	LGDIEYR	598	sp|P68066|GRCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1465.2	23.94165	2	864.437847	864.434132	K	E	49	56
PSM	HIALVAHDHCK	599	sp|P0A731|MGSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:4	ms_run[1]:scan=1.1.1162.2	16.35727	3	1299.647171	1299.650625	K	Q	13	24
PSM	ESDELIAK	600	sp|P0A858|TPIS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1314.2	20.17643	2	903.457847	903.454927	K	K	104	112
PSM	ETLEDAVK	601	sp|P68066|GRCA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1457.3	23.76348	2	903.460047	903.454927	R	H	81	89
PSM	YTQLIER	602	sp|P0ADZ4|RS15_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1415.2	22.66603	2	921.494847	921.491982	R	L	78	85
PSM	LENSLGGIK	603	sp|P0A7V0|RS2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1450.2	23.57682	2	929.521047	929.518196	K	D	144	153
PSM	KIEAALADK	604	sp|P0A805|RRF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1235.6	18.25163	2	957.557447	957.549496	K	E	170	179
PSM	KPITDLGVK	605	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1358.2	21.32918	2	969.590047	969.585882	K	A	155	164
PSM	FGNMSGQMR	606	sp|P0A8G6|NQOR_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1382.5	21.82267	2	1026.444847	1026.437520	R	T	80	89
PSM	FGNMSGQMR	607	sp|P0A8G6|NQOR_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35	ms_run[1]:scan=1.1.1205.6	17.49252	2	1042.440247	1042.432435	R	T	80	89
PSM	HHNEFHEQCVER	608	sp|Q46920|QUEF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=1.1.1170.6	16.5772	3	1620.695471	1620.685172	R	I	224	236
PSM	SIGFSSSSTGR	609	sp|P0C037|PPNP_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1387.7	21.95535	2	1084.519447	1084.514902	K	A	14	25
PSM	GSDTNIQQLNEQER	610	sp|P0ACD8|MBHL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1415.5	22.67318	3	1630.766771	1630.754691	K	Y	381	395
PSM	DNEQDMIVK	611	sp|P0ADC1|LPTE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1446.3	23.47392	2	1090.502447	1090.496475	K	E	137	146
PSM	AYREEAIIK	612	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1316.4	20.23383	2	1091.605447	1091.597509	R	S	25	34
PSM	AALVDHDNIK	613	sp|P0AFH8|OSMY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1250.4	18.62802	2	1094.579847	1094.572023	K	S	65	75
PSM	TYVPADDYR	614	sp|P0AFG8|ODP1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1430.4	23.05803	2	1098.506247	1098.498189	R	V	814	823
PSM	HHFENVSIE	615	sp|P23847|DPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1445.2	23.44547	2	1110.520447	1110.509423	K	-	527	536
PSM	SGGVTFAARPQDHSQK	616	sp|P60723|RL4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1231.4	18.14398	3	1684.835471	1684.828131	R	V	80	96
PSM	KLEHAVPMAK	617	sp|P0A955|ALKH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1203.2	17.43067	3	1122.622571	1122.621950	K	A	25	35
PSM	LKSLVSDDKK	618	sp|P69783|PTGA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1172.5	16.62788	2	1131.656447	1131.649939	K	D	7	17
PSM	TVNNDTLTIR	619	sp|P39180|AG43_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1476.3	24.2269	2	1145.611047	1145.604051	K	E	466	476
PSM	AEEIVASNPEK	620	sp|P0ABK5|CYSK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1286.4	19.45403	2	1185.595847	1185.587733	K	Y	127	138
PSM	AINYGYTDDR	621	sp|P0A991|ALF1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1433.2	23.13187	2	1186.536447	1186.525467	K	V	249	259
PSM	IRTGEEDDAAI	622	sp|P0A9Z1|GLNB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1386.6	21.92678	2	1188.570847	1188.562246	R	-	102	113
PSM	QDLDQLQAGAR	623	sp|P21888|SYC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1476.4	24.22928	2	1213.614847	1213.605114	R	V	158	169
PSM	VGAAVGAGAGNEER	624	sp|P0ADG7|IMDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1200.6	17.36205	2	1256.619847	1256.610928	R	V	220	234
PSM	LVIESGDSAQSR	625	sp|P76170|YNFB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1348.5	21.07393	2	1260.642847	1260.630994	K	Q	33	45
PSM	FTDGENGEEING	626	sp|P0A746|MSRB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1466.6	23.97672	2	1280.528247	1280.515690	R	-	126	138
PSM	AWHSSSETIAK	627	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.1279.7	19.27895	2	1295.567247	1295.554732	K	I	81	92
PSM	FNSLTPEQQR	628	sp|P68066|GRCA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.1447.4	23.5025	2	1298.578247	1298.565631	R	D	107	117
PSM	DEFAESRPLEK	629	sp|P26646|ACUI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1419.3	22.77363	2	1319.646647	1319.635745	R	Q	199	210
PSM	NVVAGDPSPDGQGR	630	sp|P16659|SYP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1250.7	18.63517	2	1367.652647	1367.642956	R	L	389	403
PSM	EKPAVLGHDEAAYSK	631	sp|P0A912|PAL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1279.4	19.2718	3	1613.814971	1613.804936	K	N	151	166
PSM	KQVEEAGDKLPADDK	632	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1186.6	16.9971	3	1641.836771	1641.820980	R	T	548	563
PSM	GTAMNPVDHPHGGGEGR	633	sp|P60422|RL2_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1172.4	16.62548	3	1687.762871	1687.748500	R	N	222	239
PSM	DASDLLR	634	sp|P0AE08|AHPC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1604.2	27.5396	2	788.405647	788.402832	R	K	144	151
PSM	LVADLIR	635	sp|P61175|RL22_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1779.2	31.96253	2	798.497047	798.496339	R	G	19	26
PSM	YVLDSDE	636	sp|P69828|PTKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1549.2	26.1278	2	839.355847	839.354879	K	-	144	151
PSM	SLNVALR	637	sp|P08200|IDH_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1718.2	30.48862	2	851.431647	851.426618	R	Q	113	120
PSM	YPQLTIR	638	sp|P09373|PFLB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1700.2	30.01635	2	889.506647	889.502152	K	V	726	733
PSM	DWQPEVK	639	sp|P0AG86|SECB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1512.3	25.16937	2	900.438047	900.434132	K	L	35	42
PSM	YAGVGDIIK	640	sp|P0ADY3|RL14_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1771.2	31.75623	2	934.520247	934.512383	R	I	32	41
PSM	SQAIEGLVK	641	sp|P0A850|TIG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1535.2	25.77077	2	943.538047	943.533846	K	A	288	297
PSM	FTINAEVR	642	sp|P68919|RL25_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.1640.2	28.44457	2	948.5062	948.5024	M	K	2	10
PSM	SQLEEIIK	643	sp|P37903|USPF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1710.2	30.27995	2	958.535847	958.533512	K	K	70	78
PSM	VAFTALVEK	644	sp|P0A7L3|RL20_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1875.2	34.36973	2	976.566047	976.559333	K	A	104	113
PSM	SQWLGGWR	645	sp|P0AFW2|RMF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1959.2	36.52013	2	988.494047	988.487899	R	E	38	46
PSM	AEITASLVK	646	sp|P0A6P1|EFTS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.1740.2	31.01623	2	1010.5105	1010.5044	M	E	2	11
PSM	EVIEFYSK	647	sp|P0A850|TIG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1751.4	31.3064	2	1013.513647	1013.506963	K	N	383	391
PSM	LIYTASDLK	648	sp|P0A6Q3|FABA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1647.3	28.63015	2	1022.574647	1022.564812	R	V	154	163
PSM	FICIADASK	649	sp|P0A7Z0|RPIA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4	ms_run[1]:scan=1.1.1655.4	28.84227	2	1023.513047	1023.505917	K	Q	113	122
PSM	GFEELDTSK	650	sp|P0A715|KDSA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1514.2	25.21967	2	1024.480847	1024.471306	K	-	276	285
PSM	DQVGNILIR	651	sp|P15288|PEPD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1870.3	34.2407	2	1026.585647	1026.582194	R	K	50	59
PSM	EVVDWETR	652	sp|P68206|YJBJ_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1624.5	28.04227	2	1032.495447	1032.487624	K	N	57	65
PSM	LGADGNALFR	653	sp|P0A836|SUCC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1777.4	31.91465	2	1032.542447	1032.535243	K	Q	216	226
PSM	DIGAQYIIIGHSER	654	sp|P0A858|TPIS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1966.3	36.70749	3	1570.824071	1570.810356	K	R	85	99
PSM	GLTFTYEPK	655	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1797.3	32.39485	2	1054.542047	1054.533512	K	V	451	460
PSM	LVPIIADEAR	656	sp|P0AFG8|ODP1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1849.3	33.69363	2	1095.638247	1095.628809	R	T	516	526
PSM	FEEEGIFNR	657	sp|P27298|OPDA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1827.2	33.15523	2	1139.534847	1139.524738	R	E	628	637
PSM	TEEQLANIAR	658	sp|P27302|TKT1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1509.6	25.09735	2	1143.597847	1143.588401	R	G	529	539
PSM	VPLPPLTEER	659	sp|P0A805|RRF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1825.3	33.10477	2	1149.648847	1149.639374	R	R	100	110
PSM	DWYVVDATGK	660	sp|P0AA10|RL13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2023.4	38.15267	2	1152.553647	1152.545139	R	T	14	24
PSM	AINEDAAGNYIHYGVR	661	sp|P27302|TKT1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1766.4	31.6313	3	1761.859871	1761.843447	K	E	395	411
PSM	SAAGNYVFNER	662	sp|P38489|NFSB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1555.7	26.2967	2	1226.579647	1226.568000	K	K	63	74
PSM	RDWYVVDATGK	663	sp|P0AA10|RL13_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1705.7	30.16047	2	1308.658247	1308.646250	K	T	13	24
PSM	VVVETPVGLNER	664	sp|P08622|DNAJ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1744.4	31.1243	2	1310.732447	1310.719415	R	Q	325	337
PSM	VLGCQAVTCVAR	665	sp|P76440|PRET_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.1557.5	26.34463	2	1332.674047	1332.664226	K	E	274	286
PSM	DDDTADILTAASR	666	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2031.6	38.36687	2	1362.638447	1362.626303	K	D	141	154
PSM	AALIDCLAPDRR	667	sp|P0A910|OMPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1763.5	31.55552	2	1369.725647	1369.713619	R	V	318	330
PSM	ALVEAGVKPCGLGAR	668	sp|P27248|GCST_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:4	ms_run[1]:scan=1.1.1549.4	26.13257	3	1496.823671	1496.813333	R	D	210	225
PSM	HYHPQDATTNPSLLLK	669	sp|P0A867|TALA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1637.4	28.37062	3	1833.955271	1833.937347	R	A	25	41
PSM	VLLENLLR	670	sp|P25516|ACNA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2274.2	44.46027	2	968.607447	968.601866	K	W	44	52
PSM	GLLLDEWR	671	sp|P10908|UGPQ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2262.2	44.14595	2	1000.541047	1000.534181	R	D	166	174
PSM	LFIDNFDK	672	sp|P22259|PCKA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2113.2	40.492	2	1010.512647	1010.507297	K	Y	516	524
PSM	DVSIMPFK	673	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2351.2	46.46881	2	1015.450647	1015.444971	R	I	85	93
PSM	TIFCTFLQR	674	sp|P0A8P3|FETP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=1.1.2227.4	43.22593	2	1184.610647	1184.601215	R	E	4	13
PSM	LIQLMNETVDGDYQTFK	675	sp|P0AFG8|ODP1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2342.3	46.2323	3	2013.990671	2013.971743	K	S	311	328
PSM	DVLDLNNL	676	sp|P04036|DAPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2640.2	53.96057	2	914.476847	914.470912	R	-	266	274
PSM	ALLDFFLSR	677	sp|P0A734|MINE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.2894.2	60.64868	2	1080.6062	1080.5962	M	K	2	11
PSM	DAVNGTISYTNEAGK	678	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1534.8	25.7588	2	1539.723847	1538.721266	R	I	138	153
PSM	NGEWQNDVGAASSIYEEYYQK	679	sp|P0AFK9|POTD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.2572.4	52.22827	3	2451.0932	2450.0662	K	L	323	344
PSM	NGEWQNDVGAASSIYEEYYQK	680	sp|P0AFK9|POTD_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.2630.6	53.70597	3	2451.0982	2450.0662	K	L	323	344
PSM	SGETEDATIADLAVGTAAGQIK	681	sp|P0A6P9|ENO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2476.4	49.71055	3	2118.058271	2117.048808	R	T	372	394
PSM	IIVACGGAVATSTMAAEEIK	682	sp|P37188|PTKB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=1.1.2631.3	53.72563	3	1992.029771	1991.006749	K	E	5	25
PSM	EVVEQEYR	683	sp|P0A6T1|G6PI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1267.4	19.06688	2	1050.503847	1050.498189	R	D	438	446
PSM	YDDNFMSVVR	684	sp|P0AEE5|DGAL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=1.1.1715.3	30.41265	2	1261.556447	1260.544488	K	K	35	45
PSM	EELTNGGYNIGR	685	sp|P0A6K6|DEOB_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.1596.6	27.33878	2	1322.626247	1321.626243	R	V	199	211
PSM	QMGNSEVGHVNLGAGR	686	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1629.4	28.16317	3	1705.749971	1704.740318	R	I	60	76
PSM	GGPLADGIVITPSHNPPEDGGIK	687	sp|P36938|PGM_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2092.7	39.95061	3	2321.134871	2320.110042	K	Y	134	157
PSM	LAEGEEFTVGQSISVELFADVK	688	sp|P60438|RL3_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.3524.4	77.05303	3	2368.2142	2367.1842	R	K	84	106
PSM	NGVLVFTGDYFLDEQGLPTAK	689	sp|P0AB61|YCIN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3019.4	63.93983	3	2284.161371	2283.142314	R	S	40	61
PSM	QTDELTGLSSLVVLDSAER	690	sp|P0A8T7|RPOC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=1.1.3042.2	64.54578	3	2014.9991	2015.0054	R	T	1049	1068
PSM	AVEGTPFECLK	691	sp|P0A7J3|RL10_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=1.1.1826.2	33.12898	2	1250.615047	1249.601274	R	D	63	74
PSM	AMYSIAK	692	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1393.2	22.0947	2	782.402047	782.399661	K	K	212	219
PSM	TMNITSK	693	sp|P0AD49|YFIA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=1.1.1215.3	17.73678	2	793.3974	793.3999	M	Q	2	9
PSM	HGDFTIK	694	sp|P0ADN2|YIFE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1263.2	18.95813	2	816.416047	816.413003	R	E	24	31
PSM	SELLDSR	695	sp|P69908|DCEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1337.2	20.77893	2	818.413447	818.413397	R	F	11	18
PSM	FDDIAQK	696	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1291.2	19.57963	2	835.409647	835.407583	K	V	87	94
PSM	EMVELDQ	697	sp|P65292|YGDI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35	ms_run[1]:scan=1.1.1421.2	22.8235	2	878.370447	878.369149	K	-	69	76
PSM	SHVWGNVK	698	sp|P0A953|FABB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1251.2	18.64972	2	925.483047	925.477000	R	L	46	54
PSM	QAHWNMR	699	sp|P0ABT2|DPS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1242.4	18.42062	2	941.432247	941.429004	K	G	49	56
PSM	DYEEDFK	700	sp|P0ADP9|YIHD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1502.2	24.9062	2	944.380447	944.376343	K	T	71	78
PSM	FADYDEAR	701	sp|P0A9D8|DAPD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1346.3	21.01677	2	985.418847	985.414125	K	F	90	98
PSM	QEANNDILK	702	sp|P62768|YAEH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1308.3	20.02772	2	1043.531647	1043.524738	R	I	23	32
PSM	NGIIHTTIGK	703	sp|P0A7L0|RL1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1355.2	21.25035	2	1052.604647	1052.597844	K	V	168	178
PSM	AGCPVSQVLK	704	sp|P0C0L2|OSMC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4	ms_run[1]:scan=1.1.1501.6	24.88967	2	1057.565247	1057.559016	K	A	123	133
PSM	IAATMENAQK	705	sp|P0AEX9|MALE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1214.3	17.71013	2	1075.538047	1075.533194	R	G	343	353
PSM	LLSPEVANDK	706	sp|P0AFK9|POTD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1457.4	23.76587	2	1084.584047	1084.576440	K	T	303	313
PSM	YYWPHSR	707	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1486.4	24.4903	2	1087.437047	1087.427681	R	I	351	358
PSM	AQQIVDATDK	708	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1239.3	18.34242	2	1087.559047	1087.550953	R	L	67	77
PSM	EQESNLDLR	709	sp|P0AB52|YCHN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1378.5	21.72228	2	1102.531647	1102.525467	R	L	30	39
PSM	DHIVGLNCGR	710	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=1.1.1357.3	21.3054	2	1139.561047	1139.550576	R	W	267	277
PSM	KFEELVQTR	711	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1448.2	23.52405	2	1148.628247	1148.618973	R	N	528	537
PSM	GCGITVDQAER	712	sp|P00961|SYGB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=1.1.1346.6	21.02392	2	1204.559847	1204.550636	R	L	97	108
PSM	QSNWLSGQHGEEGGSMR	713	sp|P0AF70|YJEI_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:35	ms_run[1]:scan=1.1.1376.6	21.67388	3	1874.812871	1874.796573	K	G	53	70
PSM	QNHLGSVQEEGNLR	714	sp|P64461|LSRG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1328.5	20.5506	3	1579.779971	1579.770282	R	F	24	38
PSM	RFEEHLQHEAQER	715	sp|P39177|USPG_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1233.3	18.19248	3	1707.822371	1707.807730	R	L	57	70
PSM	QMQVGGKDPLVPEENDK	716	sp|P0A800|RPOZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35	ms_run[1]:scan=1.1.1421.4	22.82827	3	1898.919071	1898.904393	R	T	29	46
PSM	SFTFVTK	717	sp|P0A7J7|RL11_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1667.2	29.15402	2	828.442647	828.438155	R	T	66	73
PSM	TSEGFFR	718	sp|P0A9G6|ACEA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1555.2	26.28478	2	842.395247	842.392267	R	T	258	265
PSM	YDFIGSR	719	sp|P0A9S3|GATD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1661.2	28.99563	2	856.411847	856.407918	K	R	106	113
PSM	EFGVNLAK	720	sp|P06959|ODP2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1683.2	29.57588	2	876.475647	876.470518	R	V	339	347
PSM	VDIDNWR	721	sp|P0AC53|G6PD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1722.4	30.5998	2	916.442047	916.440280	R	W	321	328
PSM	KYDIPVVMDSAR	722	sp|P0A853|TNAA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:35	ms_run[1]:scan=1.1.1624.2	28.0351	3	1408.708871	1408.702051	K	F	219	231
PSM	IYPGQVLR	723	sp|P0ADE6|KBP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1599.3	27.41063	2	944.551047	944.544351	K	I	138	146
PSM	VTLEPLER	724	sp|P0A7Z4|RPOA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1663.2	29.04837	2	955.541247	955.533846	K	G	26	34
PSM	IIGEQLGVK	725	sp|P0A6A8|ACP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1592.2	27.22463	2	955.574047	955.570232	K	Q	11	20
PSM	AQTFTLVAK	726	sp|P0A862|TPX_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1632.2	28.2354	2	977.559447	977.554582	K	D	25	34
PSM	GIPADLEDR	727	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1555.3	26.28717	2	984.491447	984.487624	R	R	82	91
PSM	DLNDQFDR	728	sp|P0A9H7|CFA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1522.2	25.42927	2	1021.453047	1021.446488	R	I	224	232
PSM	EVVDWETR	729	sp|P68206|YJBJ_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1633.5	28.26878	2	1032.495447	1032.487624	K	N	57	65
PSM	AGILAQVPAGR	730	sp|P0AEK2|FABG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1671.3	29.26178	2	1051.616847	1051.613828	R	L	198	209
PSM	DNTWYTGAK	731	sp|P0A910|OMPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1534.3	25.74688	2	1054.479447	1054.471974	K	L	25	34
PSM	GSLLLTDDAR	732	sp|P0AFK9|POTD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1698.2	29.96372	2	1059.565847	1059.556038	K	E	161	171
PSM	AYTPAEWAR	733	sp|P0A9W6|IBAG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1622.5	27.99155	2	1063.514847	1063.508694	K	D	69	78
PSM	MFTINAEVR	734	sp|P68919|RL25_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1855.3	33.84972	2	1079.554047	1079.543365	-	K	1	10
PSM	VAESVIPEIK	735	sp|P0A9S3|GATD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1824.2	33.07635	2	1083.625847	1083.617576	R	H	14	24
PSM	SQLEEIIKK	736	sp|P37903|USPF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1513.4	25.1981	2	1086.636247	1086.628475	K	F	70	79
PSM	VEFEITNGAK	737	sp|P0A972|CSPE_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1658.4	28.9212	2	1106.570647	1106.560789	R	G	50	60
PSM	IFVDEGPSMK	738	sp|P61175|RL22_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1673.4	29.3168	2	1121.553447	1121.542697	K	R	74	84
PSM	QQIIGLAEVR	739	sp|P0A705|IF2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1866.3	34.1361	2	1125.657247	1125.650607	K	D	792	802
PSM	GFAVTPPELTK	740	sp|P62707|GPMA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1922.2	35.5673	2	1158.638847	1158.628475	R	D	118	129
PSM	SVFNSAGLEVR	741	sp|P00509|AAT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2014.5	37.91788	2	1257.587247	1257.575468	K	E	135	146
PSM	MDAWLSGPNANK	742	sp|P0AEE5|DGAL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1603.4	27.51785	2	1318.610047	1318.597586	K	I	215	227
PSM	SRLPQNITLTEV	743	sp|P38489|NFSB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1965.8	36.69307	2	1369.769847	1369.756529	K	-	206	218
PSM	TSSTGLVYQVVEAGKGEAPK	744	sp|P45523|FKBA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2022.6	38.13087	3	2020.061771	2020.047686	K	D	143	163
PSM	DVDVLYFR	745	sp|P0A780|NUSB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2254.2	43.93448	2	1025.525247	1025.518196	K	E	42	50
PSM	ITPVVFIMK	746	sp|P06959|ODP2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2231.2	43.3277	2	1046.630047	1046.619825	K	A	457	466
PSM	SQWLGGWR	747	sp|P0AFW2|RMF_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2207.2	42.69482	2	1068.460847	1068.454230	R	E	38	46
PSM	DWTIEQITR	748	sp|P0A853|TNAA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2166.2	41.8098	2	1160.594047	1160.582588	K	E	247	256
PSM	VIDLMCPFAK	749	sp|P0ABB4|ATPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2358.3	46.65665	2	1192.609247	1192.598438	K	G	133	143
PSM	NNVIGLLEDPK	750	sp|P00954|SYW_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2078.3	39.5736	2	1210.666847	1210.655752	R	S	204	215
PSM	TPFLAWCEQR	751	sp|P15770|AROE_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2092.6	39.94823	2	1306.624047	1306.612842	K	G	220	230
PSM	GMASGAVIESFLDK	752	sp|P0A705|IF2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2422.4	48.27398	2	1423.715047	1423.701716	K	G	563	577
PSM	QFPNIDNAYMELGTNR	753	sp|P0AEQ3|GLNH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2352.3	46.49832	3	1881.882071	1881.867947	R	A	157	173
PSM	DAGFQAFADK	754	sp|P0A6P1|EFTS_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1876.2	34.3961	2	1069.487047	1068.487624	K	V	86	96
PSM	NGEFIEITEK	755	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2029.2	38.30442	2	1179.579647	1178.581919	K	D	18	28
PSM	ALQGEQGVVECAYVEGDGQYAR	756	sp|P61889|MDH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4	ms_run[1]:scan=1.1.1963.6	36.63535	3	2400.098171	2398.085939	R	F	241	263
PSM	QMGNSEVGHVNLGAGR	757	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.1524.3	25.48422	3	1721.736971	1720.735233	R	I	60	76
PSM	QMGNSEVGHVNLGAGR	758	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.1758.3	31.43468	2	1704.7232	1703.7082	R	I	60	76
PSM	YQGGHNAGHTLVINGEK	759	sp|P0A7D4|PURA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1248.3	18.57372	4	1793.892094	1793.880895	R	T	34	51
PSM	DLETQSQDGTFDK	760	sp|P0A7V0|RS2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1572.7	26.72818	2	1483.650847	1482.647432	K	L	116	129
PSM	DTVEIQGEVDK	761	sp|P0ADU5|YGIW_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1550.3	26.15623	2	1232.594647	1231.593212	K	D	103	114
PSM	DQFVQPVVK	762	sp|P0ADB1|OSME_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1617.2	27.86103	2	1058.585247	1058.576046	K	D	29	38
PSM	EAPLAIELDHDK	763	sp|P68919|RL25_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:27	ms_run[1]:scan=1.1.2056.4	39.01925	2	1331.6842	1331.6712	K	V	35	47
PSM	NNYGQYLYK	764	sp|P37744|RMLA1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1616.6	27.8461	2	1162.559847	1161.545474	K	M	279	288
PSM	ADSAEVSMIPSTK	765	sp|P0A8A0|YEBC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1634.7	28.29967	2	1335.654847	1334.638782	K	A	193	206
PSM	TAEGGAEHVQPITGDNIVNVLDDFR	766	sp|P0AGJ5|YFIF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2612.5	53.23473	3	2668.294271	2666.293623	R	Q	242	267
PSM	NGNEAVLIGQLECK	767	sp|P0ACN4|ALLR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:4	ms_run[1]:scan=1.1.2246.7	43.73703	2	1544.777647	1543.766442	R	S	123	137
PSM	FTNGYVAHGVSGPSR	768	sp|P77318|YDEN_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.1523.7	25.46737	3	1628.712071	1627.714421	R	A	122	137
PSM	AWNQPGNNGQDRDPWGSSKPGGNSEGNGNK	769	sp|P0ABC7|HFLK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=1.1.1517.8	25.3127	4	3125.4042	3124.3722	M	G	2	32
PSM	NGVNLFAGDK	770	sp|P0A9C5|GLN1B_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.1966.2	36.70508	2	1034.513447	1033.519259	K	Y	278	288
PSM	GKKAGTHTVTATLGNNNTSDSQPVTFVADK	771	sp|P76347|YEEJ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2558.3	51.86495	4	3060.511694	3058.531956	K	A	1114	1144
PSM	VVTLSGFVESQAQAEEAVK	772	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3511.2	76.7642	3	1991.033471	1991.021137	K	V	86	105
PSM	ILNNIR	773	sp|P0ACF8|HNS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1334.2	20.70007	2	741.449047	741.449723	K	T	7	13
PSM	DQGIDLR	774	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1439.2	23.28787	2	815.415047	815.413731	K	N	247	254
PSM	MYVVSTK	775	sp|P0C8J6|GATY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1340.2	20.85743	2	826.428247	826.425876	-	Q	1	8
PSM	DHTLFAK	776	sp|P0A7L8|RL27_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1329.2	20.56942	2	830.429047	830.428653	R	A	56	63
PSM	NISDDLR	777	sp|P0AC59|GLRX2_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1418.2	22.74482	2	831.410647	831.408646	K	A	146	153
PSM	FAIDQEK	778	sp|P0A870|TALB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1385.2	21.8914	2	849.425247	849.423233	K	L	302	309
PSM	NVLIEAAR	779	sp|P0ABU5|ELBB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1493.3	24.6718	2	884.509447	884.507966	R	I	62	70
PSM	LIAEAMDK	780	sp|P0A6F5|CH60_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1411.3	22.56397	2	889.457647	889.457904	K	V	161	169
PSM	GYNAEVVR	781	sp|P0ACW6|YDCH_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1290.3	19.55592	2	906.458247	906.455930	R	M	43	51
PSM	DASDLLRK	782	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1406.2	22.43083	2	916.499447	916.497795	R	I	144	152
PSM	RFNIPGSK	783	sp|P0A7M9|RL31_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1395.4	22.15022	2	917.513447	917.508300	K	-	63	71
PSM	GVGFTEAPR	784	sp|P0ACD8|MBHL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1430.2	23.05327	2	932.479847	932.471580	R	G	501	510
PSM	DVNQLTPR	785	sp|P0AF28|NARL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1359.5	21.36307	2	941.498247	941.493044	R	E	152	160
PSM	LMDLSINK	786	sp|P69908|DCEA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35	ms_run[1]:scan=1.1.1485.2	24.45917	2	948.501047	948.495018	K	N	75	83
PSM	EFGEDVEK	787	sp|Q46868|UBIK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1337.4	20.7837	2	951.422447	951.418542	R	K	24	32
PSM	LEVVVNER	788	sp|P0ACF8|HNS_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1467.4	23.99818	2	956.533447	956.529095	K	R	33	41
PSM	VLENAEGDR	789	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1179.2	16.80413	2	1001.484447	1001.477788	R	T	26	35
PSM	GGGISGQAGAIR	790	sp|P0A7X3|RS9_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1291.4	19.5844	2	1042.559247	1042.551956	K	H	69	81
PSM	TDINQALNR	791	sp|P63284|CLPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1410.3	22.53783	2	1043.541847	1043.535972	R	L	62	71
PSM	DQGVVVNNVK	792	sp|P0C0V0|DEGP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1315.3	20.2052	2	1070.578647	1070.572023	K	T	408	418
PSM	LQLLHDEGR	793	sp|P0AB55|YCII_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1444.3	23.42178	2	1079.577647	1079.572357	R	L	28	37
PSM	MYAVFQSGGK	794	sp|P0AG48|RL21_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35	ms_run[1]:scan=1.1.1497.2	24.77427	2	1102.518047	1102.511731	-	Q	1	11
PSM	HDASDFETNTEDKR	795	sp|Q46845|YGHU_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1204.3	17.45912	3	1663.719971	1663.707407	R	Q	273	287
PSM	EESDSVFMR	796	sp|P0AAT9|YBEL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:35	ms_run[1]:scan=1.1.1414.3	22.64238	2	1114.469247	1114.460089	K	V	72	81
PSM	YADMLAMSAK	797	sp|P0A853|TNAA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:35	ms_run[1]:scan=1.1.1480.2	24.32933	2	1115.507247	1115.499118	K	K	260	270
PSM	LEGNNAELGAK	798	sp|P0A836|SUCC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1241.3	18.39253	2	1114.572047	1114.561852	R	K	349	360
PSM	NISVTEVHAR	799	sp|P0ABZ6|SURA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1318.5	20.28885	2	1124.599647	1124.593821	K	H	279	289
PSM	ALSGGVGAEELK	800	sp|P76536|YFEX_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1493.6	24.67895	2	1129.605647	1129.597903	R	D	66	78
PSM	NNASPADPQVH	801	sp|P0A6Y5|HSLO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1180.3	16.8328	2	1148.532047	1148.521050	R	-	282	293
PSM	HAVTEASPMVK	802	sp|P02358|RS6_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1231.5	18.14637	2	1168.600047	1168.591044	K	A	94	105
PSM	HYAHVDCPGHADYVK	803	sp|P0CE47|EFTU1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4	ms_run[1]:scan=1.1.1317.4	20.26008	3	1767.789371	1767.778738	R	N	76	91
PSM	AINYGYTDDR	804	sp|P0A991|ALF1_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1432.4	23.11048	2	1186.536447	1186.525467	K	V	249	259
PSM	DEHWICGQR	805	sp|P0A9D2|GSTA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4	ms_run[1]:scan=1.1.1426.2	22.94853	2	1199.526047	1199.514191	K	F	142	151
PSM	IEGVPESNISR	806	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1501.7	24.89205	2	1199.625047	1199.614616	K	D	57	68
PSM	HVDPAAAIQQGK	807	sp|P0AC47|FRDB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1326.6	20.50055	2	1233.656247	1233.646585	K	V	218	230
PSM	NIIQHVENNR	808	sp|P0AC19|FOLX_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1348.3	21.06917	2	1235.648847	1235.637083	K	F	63	73
PSM	EFYEKPTTER	809	sp|P68679|RS21_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1270.6	19.1503	2	1298.625247	1298.614282	R	K	36	46
PSM	IYDVLR	810	sp|P0C8J8|GATZ_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1639.2	28.41805	2	777.437447	777.438489	K	A	407	413
PSM	VAEFFGK	811	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1630.2	28.1837	2	796.414047	796.411940	K	E	353	360
PSM	TQLEWR	812	sp|P0AAT9|YBEL_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1516.2	25.2721	2	831.426247	831.423902	K	E	97	103
PSM	LNEVEFR	813	sp|P07395|SYFB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1516.3	25.27448	2	905.465647	905.460681	K	A	631	638
PSM	DWVVNER	814	sp|P23843|OPPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1595.2	27.3031	2	916.445047	916.440280	K	I	221	228
PSM	QWFTDVK	815	sp|P0AG48|RL21_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1817.2	32.89277	2	922.457847	922.454868	R	I	91	98
PSM	DNTPMFVK	816	sp|P0A9B2|G3P1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1616.3	27.83895	2	950.460647	950.453153	K	G	125	133
PSM	PFLNAYSR	817	sp|P08997|MASY_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1631.2	28.20943	2	966.497847	966.492316	K	L	306	314
PSM	VWVVEGSK	818	sp|P0A7K6|RL19_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.1713.2	30.35797	2	982.457847	982.452499	K	K	30	38
PSM	GIPADLEDR	819	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1539.2	25.87552	2	984.495447	984.487624	R	R	82	91
PSM	NFGLYNER	820	sp|P00509|AAT_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1633.3	28.264	2	1011.485047	1011.477394	K	V	247	255
PSM	VSFTIESGAK	821	sp|P0A9X9|CSPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1633.6	28.27117	2	1037.546647	1037.539326	K	G	51	61
PSM	PNPAVLICR	822	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4	ms_run[1]:scan=1.1.1675.3	29.36713	2	1038.571447	1038.564435	K	V	158	167
PSM	PNPAVLICR	823	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4	ms_run[1]:scan=1.1.1667.3	29.1564	2	1038.571447	1038.564435	K	V	158	167
PSM	DAFIDEMQR	824	sp|P0A6C1|END4_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1878.3	34.45078	2	1123.507447	1123.496809	R	C	89	98
PSM	GLDITITTTAK	825	sp|P62399|RL5_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1832.2	33.28458	2	1132.632047	1132.633954	R	S	151	162
PSM	FDGTPWSTDK	826	sp|P36938|PGM_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1752.5	31.33507	2	1152.516647	1152.508754	R	D	400	410
PSM	GFAVTPPELTK	827	sp|P62707|GPMA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1930.2	35.77783	2	1158.638847	1158.628475	R	D	118	129
PSM	IINGEVPEGLK	828	sp|P63284|CLPB_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1647.5	28.63492	2	1167.659447	1167.649939	R	G	223	234
PSM	WQIVNQNDR	829	sp|P0A9C3|GALM_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1569.4	26.6451	2	1171.584647	1171.573420	R	Q	115	124
PSM	EELDEFPASEK	830	sp|P76440|PRET_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1647.7	28.63968	2	1292.584047	1292.577227	R	E	286	297
PSM	MLQSNEYFSGK	831	sp|P0C037|PPNP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.1591.7	27.21015	2	1398.566647	1398.552684	-	V	1	12
PSM	DYLPDAFGPK	832	sp|P0ABF6|CDD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2086.3	39.78477	2	1121.550047	1121.539326	R	D	159	169
PSM	DGISALQMDIK	833	sp|P05055|PNP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2128.3	40.88673	2	1189.612847	1189.601274	R	I	500	511
PSM	DGAYDLVVPSTYYVDK	834	sp|P0AFK9|POTD_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2401.2	47.71923	3	1803.873371	1803.856697	K	M	74	90
PSM	TSPELAELLR	835	sp|P0AF50|YJBR_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2437.2	48.66703	2	1207.596247	1207.584970	K	Q	52	62
PSM	LINYLVEEFK	836	sp|P0A6Y8|DNAK_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2358.4	46.65903	2	1266.697647	1266.685990	R	K	236	246
PSM	TTLTAAITTVLAK	837	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2456.4	49.17782	2	1302.788047	1302.775868	K	T	26	39
PSM	NVEEGGSLTIIATALIDTGSK	838	sp|P0AG30|RHO_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2866.3	59.91179	3	2088.078371	2088.095030	R	M	306	327
PSM	CDMVDDEELLELVEMEVR	839	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3363.3	72.95928	3	2223.996971	2222.974522	K	E	138	156
PSM	ELLSQYDFPGDDTPIVR	840	sp|P0CE47|EFTU1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	15.0		ms_run[1]:scan=1.1.2452.3	49.06788	3	1964.9652	1963.9522	R	G	156	173
PSM	NNGSEVQSLDPHK	841	sp|P23843|OPPA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1380.7	21.7775	2	1424.668247	1423.669171	R	I	44	57
PSM	VVTLSGFVESQAQAEEAVK	842	sp|P0AFH8|OSMY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	15.0		ms_run[1]:scan=1.1.3561.2	78.003	3	1991.0372	1991.0202	K	V	86	105
PSM	FPNDVDPIETR	843	sp|P0AFG8|ODP1_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1797.5	32.39962	2	1301.631647	1301.625181	R	D	5	16
PSM	NFDNMREDEGLADR	844	sp|P0AE08|AHPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:35	ms_run[1]:scan=1.1.1529.2	25.61357	3	1697.708771	1696.711112	R	A	107	121
PSM	NGYQDSLFTSPEVAR	845	sp|P19926|AGP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2223.6	43.12555	2	1683.799847	1682.790014	K	N	267	282
PSM	QMGNSEVGHVNLGAGR	846	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.1651.2	28.73278	3	1705.740671	1704.740318	R	I	60	76
PSM	QMGNSEVGHVNLGAGR	847	sp|P37689|GPMI_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.1983.3	37.15343	2	1688.7232	1687.7132	R	I	60	76
PSM	KGGPLADGIVITPSHNPPEDGGIK	848	sp|P36938|PGM_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.1934.8	35.89758	3	2449.232171	2448.205005	K	Y	133	157
PSM	GGPLADGIVITPSHNPPEDGGIK	849	sp|P36938|PGM_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2100.7	40.15938	3	2321.134871	2320.110042	K	Y	134	157
PSM	DVFVHFSAIQGNGFK	850	sp|P0A9Y6|CSPC_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2348.3	46.39083	3	1665.834971	1664.831091	K	T	28	43
PSM	AADLVDALGQENNPEWK	851	sp|P09152|NARG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2268.6	44.31295	2	1868.906047	1868.890457	R	T	358	375
PSM	TIEDVFIHLLSDTYSAEK	852	sp|P21362|YCIF_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3176.2	68.03931	3	2081.037971	2080.036452	K	Q	5	23
PSM	DQLEQLAQLYADPNKK	853	sp|P33937|NAPA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2280.2	44.61838	3	1873.957271	1872.958142	K	V	350	366
PSM	NHFVTILGTIQGEQPGFINK	854	sp|P37194|SLP_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2563.7	52.00728	3	2213.182571	2212.164053	R	V	109	129
PSM	TQTQLQQQHLENQINNNSQR	855	sp|P0ADX7|YHHA_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1486.7	24.49747	3	2422.191671	2421.174511	K	V	60	80
PSM	KENAALNDVQVEVNYAIK	856	sp|P69856|NANC_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2017.6	37.99953	3	2176.999871	2176.980682	K	L	70	88
PSM	RVYGGEADAADKAEAANK	857	sp|P00363|FRDA_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2149.3	41.42945	3	1916.8762	1914.8472	K	K	579	597
PSM	DAVNGTISYTNEAGK	858	sp|P08997|MASY_ECOLI	0	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.1616.8	27.85087	2	1539.723647	1538.721266	R	I	138	153
PSM	KVEERELPELTAEFIK	859	sp|P0A850|TIG_ECOLI	1	userFasta.uniprot_ecoli_20200318	userFasta.uniprot_ecoli_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2396.3	47.58888	3	1933.036271	1930.041144	K	R	239	255