MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL03.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q86UE8-3|TLK2_HUMAN	Isoform 3 of Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	715-UNIMOD:21,693-UNIMOD:188,716-UNIMOD:21	0.04	55.0	2	1	0
PRT	sp|Q15361|TTF1_HUMAN	Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	496-UNIMOD:188	0.02	52.0	2	1	0
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	86-UNIMOD:188	0.06	50.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	134-UNIMOD:4	0.18	49.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	207-UNIMOD:267,210-UNIMOD:21,212-UNIMOD:21,225-UNIMOD:267,5749-UNIMOD:21,5752-UNIMOD:21,5763-UNIMOD:21	0.01	49.0	2	2	2
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	22-UNIMOD:188	0.04	47.0	3	1	0
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	83-UNIMOD:188	0.02	47.0	2	1	0
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	294-UNIMOD:267,304-UNIMOD:21	0.06	47.0	23	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	257-UNIMOD:267	0.04	47.0	2	2	2
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	262-UNIMOD:188	0.07	46.0	1	1	1
PRT	sp|Q9Y520-3|PRC2C_HUMAN	Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	187-UNIMOD:21	0.01	46.0	1	1	1
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	263-UNIMOD:21,279-UNIMOD:4	0.01	46.0	3	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	377-UNIMOD:21,398-UNIMOD:21,401-UNIMOD:267,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4	0.02	46.0	4	2	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	204-UNIMOD:21,209-UNIMOD:188,214-UNIMOD:21,219-UNIMOD:188	0.03	46.0	3	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.04	46.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	41-UNIMOD:21,57-UNIMOD:188,42-UNIMOD:21	0.08	46.0	5	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.06	45.0	1	1	1
PRT	sp|Q9H7P6-2|MB12B_HUMAN	Isoform 2 of Multivesicular body subunit 12B OS=Homo sapiens OX=9606 GN=MVB12B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	201-UNIMOD:21,204-UNIMOD:21,221-UNIMOD:267	0.12	45.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	236-UNIMOD:21,237-UNIMOD:21,234-UNIMOD:21	0.07	45.0	2	1	0
PRT	sp|P85037-2|FOXK1_HUMAN	Isoform 2 of Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	553-UNIMOD:21	0.05	45.0	1	1	1
PRT	sp|Q8WVB6-2|CTF18_HUMAN	Isoform 2 of Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	64-UNIMOD:21,73-UNIMOD:21,58-UNIMOD:267,79-UNIMOD:267	0.03	45.0	2	1	0
PRT	sp|P0C1Z6|TFPT_HUMAN	TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	252-UNIMOD:21	0.07	45.0	2	1	0
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	77-UNIMOD:21,81-UNIMOD:21,95-UNIMOD:267	0.05	44.0	2	1	0
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	231-UNIMOD:188,243-UNIMOD:21	0.07	44.0	1	1	0
PRT	sp|Q6R327|RICTR_HUMAN	Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1174-UNIMOD:21,1177-UNIMOD:21,1184-UNIMOD:188	0.01	44.0	3	1	0
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	663-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	416-UNIMOD:4,421-UNIMOD:21,423-UNIMOD:21,431-UNIMOD:267,432-UNIMOD:188	0.04	44.0	4	1	0
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	274-UNIMOD:188	0.05	43.0	2	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1365-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	267-UNIMOD:21,272-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	102-UNIMOD:21,108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188,101-UNIMOD:21	0.05	43.0	2	1	0
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	120-UNIMOD:21,135-UNIMOD:21,118-UNIMOD:267,137-UNIMOD:267	0.04	43.0	2	1	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	505-UNIMOD:188,523-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	59-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|P43268-2|ETV4_HUMAN	Isoform 2 of ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	110-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q4KMQ1|TPRN_HUMAN	Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	267-UNIMOD:21,274-UNIMOD:21,284-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,67-UNIMOD:267,69-UNIMOD:21,86-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|O76094|SRP72_HUMAN	Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	621-UNIMOD:21,625-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	42.0	2	1	0
PRT	sp|O00165-3|HAX1_HUMAN	Isoform 3 of HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P48634-2|PRC2A_HUMAN	Isoform 2 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	598-UNIMOD:21,603-UNIMOD:188	0.01	42.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	66-UNIMOD:21,67-UNIMOD:21,71-UNIMOD:267,86-UNIMOD:267	0.11	42.0	4	1	0
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	97-UNIMOD:267,100-UNIMOD:21,114-UNIMOD:21,116-UNIMOD:267	0.03	42.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	73-UNIMOD:188	0.10	42.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.01	42.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	882-UNIMOD:21,886-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	464-UNIMOD:4	0.04	42.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	85-UNIMOD:267	0.27	42.0	2	1	0
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.09	41.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	196-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	364-UNIMOD:21,368-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	490-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	501-UNIMOD:267	0.05	41.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q9UK61-2|TASOR_HUMAN	Isoform 2 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	666-UNIMOD:21,670-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	240-UNIMOD:21,244-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	655-UNIMOD:267,657-UNIMOD:21,662-UNIMOD:21,670-UNIMOD:267	0.02	41.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1701-UNIMOD:21,1703-UNIMOD:4,1705-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	334-UNIMOD:4	0.04	41.0	1	1	1
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	289-UNIMOD:21,296-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1458-UNIMOD:21,1462-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	676-UNIMOD:21,680-UNIMOD:267,681-UNIMOD:21,693-UNIMOD:267	0.03	41.0	1	1	1
PRT	sp|P16070-15|CD44_HUMAN	Isoform 15 of CD44 antigen OS=Homo sapiens OX=9606 GN=CD44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	186-UNIMOD:267	0.09	41.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	311-UNIMOD:21,315-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	86-UNIMOD:21,89-UNIMOD:188,108-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	107-UNIMOD:28,109-UNIMOD:21,124-UNIMOD:267	0.04	41.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	66-UNIMOD:21,67-UNIMOD:21,86-UNIMOD:267	0.04	41.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	1	sp|Q86UE8-3|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	23-UNIMOD:21	ms_run[2]:scan=8589	44.012	2	2419.05	2419.0500	R	-	693	719
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	2	sp|Q86UE8-3|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:188,24-UNIMOD:21	ms_run[2]:scan=8646	44.276	2	2425.0701	2425.0701	R	-	693	719
PSM	YLSADSGDADDSDADLGSAVK	3	sp|Q15361|TTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=12483	62.883	2	2070.8866	2070.8866	R	Q	476	497
PSM	YLSADSGDADDSDADLGSAVK	4	sp|Q15361|TTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	21-UNIMOD:188	ms_run[2]:scan=12496	62.939	2	2076.9067	2076.9067	R	Q	476	497
PSM	VNEASGDGDGEDAVVILEK	5	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	19-UNIMOD:188	ms_run[2]:scan=15751	78.721	2	1921.9212	1921.9212	K	T	68	87
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	6	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	24-UNIMOD:4	ms_run[2]:scan=8980	45.869	3	3412.3605	3412.3605	K	A	111	145
PSM	TVIRLPSGSGAASPTGSAVDIR	7	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	4-UNIMOD:267,7-UNIMOD:21,9-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=18052	90.165	2	2291.0827	2291.0827	K	A	204	226
PSM	AADSDDGAVSAPAASDGGVSK	8	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	21-UNIMOD:188	ms_run[2]:scan=5607	29.421	2	1852.8382	1852.8382	M	S	2	23
PSM	AIEDEGGNPDEIEITSEGNK	9	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	20-UNIMOD:188	ms_run[2]:scan=12867	64.733	2	2121.9645	2121.9645	K	K	64	84
PSM	RGGGSGGGEESEGEEVDED	10	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=3624	19.467	2	1940.6784	1940.6784	R	-	294	313
PSM	TEEEEEEEEEEEEDDEEEEGDDEGQK	11	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=8043	41.387	3	3143.0866	3143.0866	K	S	269	295
PSM	VNEASGDGDGEDAVVILEK	12	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=15756	78.741	2	1915.9011	1915.9011	K	T	68	87
PSM	RGGGSGGGEESEGEEVDED	13	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	11-UNIMOD:21	ms_run[1]:scan=3152	16.994683333333334	2	1931.677902	1930.670169	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	14	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=3423	18.403291666666664	2	1940.683665	1940.678438	R	-	294	313
PSM	AAAASAAEAGIATTGTEDSDDALLK	15	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	25-UNIMOD:188	ms_run[2]:scan=16982	84.848	2	2325.1279	2325.1279	R	M	238	263
PSM	AAGSPSSSDQDEKLPGQDESTAGTSEQNDILK	16	sp|Q9Y520-3|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=13609	68.344	3	3341.442	3341.4420	K	V	184	216
PSM	AIEDEGGNPDEIEITSEGNK	17	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=12881	64.8	2	2115.9444	2115.9444	K	K	64	84
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	18	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=22489	113.61	2	2431.1719	2431.1719	R	S	258	284
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	19	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=22664	114.62	2	2431.1719	2431.1719	R	S	258	284
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	20	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=16057	80.287	3	3021.351	3021.3510	R	D	374	402
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	21	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=16264	81.335	3	3021.351	3021.3510	R	D	374	402
PSM	LAPVPSPEPQKPAPVSPESVK	22	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,11-UNIMOD:188,16-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=12875	64.772	2	2325.1461	2325.1461	K	A	199	220
PSM	TTTTNTQVEGDDEAAFLER	23	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=15412	77.053	2	2096.9498	2096.9498	K	L	75	94
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	24	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=16396	81.99392666666667	3	3013.356227	3011.342712	R	D	374	402
PSM	GIPLATGDTSPEPELLPGAPLPPPK	25	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[1]:scan=24740	127.30335166666666	3	2549.321167	2549.312552	K	E	33	58
PSM	RGGGSGGGEESEGEEVDED	26	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=2595	14.14826	2	1940.683890	1940.678438	R	-	294	313
PSM	AADSDDGAVSAPAASDGGVSK	27	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=5581	29.292	2	1846.8181	1846.8181	M	S	2	23
PSM	AASADSTTEGTPADGFTVLSTK	28	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=16762	83.775	2	2126.0015	2126.0015	K	S	168	190
PSM	GIPLATGDTSPEPELLPGAPLPPPK	29	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=24372	125.06	2	2549.3126	2549.3126	K	E	33	58
PSM	NHDSSQPTTPSQSSAASTPAPNLPR	30	sp|Q9H7P6-2|MB12B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21,8-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=9871	50.159	3	2717.1359	2717.1359	R	-	197	222
PSM	PASPSSPEHLPATPAESPAQR	31	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10001	50.763	2	2285.9719	2285.9719	R	F	232	253
PSM	PASPSSPEHLPATPAESPAQR	32	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10210	51.772	2	2285.9719	2285.9719	R	F	232	253
PSM	SRVEEPSGAVTTPAGVIAAAGPQGPGTGE	33	sp|P85037-2|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21	ms_run[2]:scan=17179	85.808	3	2742.2862	2742.2862	R	-	542	571
PSM	TFEEALARGDAASSPAPAASVGSSQGGAR	34	sp|Q8WVB6-2|CTF18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=14113	70.727	3	2877.2332	2877.2332	R	K	51	80
PSM	GPDKLLPYPTLASPASD	35	sp|P0C1Z6|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	16-UNIMOD:21	ms_run[1]:scan=22106	111.45251499999999	2	1820.865388	1820.859748	R	-	237	254
PSM	GIPLATGDTSPEPELLPGAPLPPPK	36	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[1]:scan=24515	125.92509333333334	3	2549.321167	2549.312552	K	E	33	58
PSM	RGGGSGGGEESEGEEVDED	37	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=2345	12.863973333333334	2	1940.683851	1940.678438	R	-	294	313
PSM	AAAAGLGHPASPGGSEDGPPGSEEEDAAR	38	sp|Q99856|ARI3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9757	49.613	3	2819.1073	2819.1073	R	E	67	96
PSM	GPDKLLPYPTLASPASD	39	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:188,16-UNIMOD:21	ms_run[2]:scan=22081	111.33	2	1826.8799	1826.8799	R	-	228	245
PSM	HIEDTGSTPSIGENDLK	40	sp|Q6R327|RICTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=12042	60.757	2	1971.7864	1971.7864	K	F	1168	1185
PSM	HIEDTGSTPSIGENDLK	41	sp|Q6R327|RICTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21,10-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=11886	60.033	2	1977.8065	1977.8065	K	F	1168	1185
PSM	NGVIQHTGAAAEEFNDDTD	42	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:21	ms_run[2]:scan=11400	57.703	2	2082.8168	2082.8168	R	-	646	665
PSM	RGGGSGGGEESEGEEVDED	43	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=1549	8.8865	2	1930.6702	1930.6702	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	44	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=2551	13.936	2	1930.6702	1930.6702	R	-	294	313
PSM	GPDKLLPYPTLASPASD	45	sp|P0C1Z6|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	16-UNIMOD:21	ms_run[1]:scan=21910	110.42732	2	1820.865388	1820.859748	R	-	237	254
PSM	RGGGSGGGEESEGEEVDED	46	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=3227	17.390806666666666	2	1940.683645	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	47	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=1251	7.222411666666667	2	1940.683979	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	48	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=3033	16.385146666666667	2	1940.683624	1940.678438	R	-	294	313
PSM	IACEEEFSDSEEEGEGGRK	49	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=7840	40.442373333333336	2	2332.845859	2332.841482	R	N	414	433
PSM	AADSDDGAVSAPAASDGGVSK	50	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5583	29.303	2	1846.8181	1846.8181	M	S	2	23
PSM	EAGVEMGDEDDLSTPNEK	51	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11267	57.054	2	1934.8051	1934.8051	R	L	257	275
PSM	GAGDGSDEEVDGKADGAEAKPAE	52	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=4681	24.718	2	2253.8911	2253.8911	K	-	1360	1383
PSM	GNKSPSPPDGSPAATPEIR	53	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=8567	43.91	2	2036.8606	2036.8606	K	V	262	281
PSM	GPPASSPAPAPKFSPVTPK	54	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=12585	63.358	2	2003.9562	2003.9562	R	F	97	116
PSM	GRLTPSPDIIVLSDNEASSPR	55	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=20307	101.73	2	2383.0822	2383.0822	R	S	117	138
PSM	GRLTPSPDIIVLSDNEASSPR	56	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,4-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=20313	101.76	2	2403.0987	2403.0987	R	S	117	138
PSM	IACEEEFSDSEEEGEGGRK	57	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6994	36.309	2	2316.8131	2316.8131	R	N	414	433
PSM	IACEEEFSDSEEEGEGGRK	58	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7472	38.643	2	2316.8131	2316.8131	R	N	414	433
PSM	KPVTVSPTTPTSPTEGEAS	59	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,19-UNIMOD:21	ms_run[2]:scan=8538	43.774	2	1970.9181	1970.9181	R	-	505	524
PSM	LSEGSQPAEEEEDQETPSR	60	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=5961	31.187	2	2126.9115	2126.9115	K	N	239	258
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	61	sp|Q9C0E8-3|LNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=14118	70.748	3	2539.2472	2539.2472	R	D	52	77
PSM	RGGGSGGGEESEGEEVDED	62	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=1502	8.6198	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	63	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=4251	22.619	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	64	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21	ms_run[2]:scan=2356	12.918	2	1930.6702	1930.6702	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	65	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21	ms_run[2]:scan=2956	15.98	2	1930.6702	1930.6702	R	-	294	313
PSM	SPAPGALGQSPLQPFPR	66	sp|P43268-2|ETV4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=18773	93.724	2	1798.8767	1798.8767	K	A	101	118
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	67	sp|Q4KMQ1|TPRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21,23-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=11321	57.305	3	3346.4784	3346.4784	K	Q	252	285
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	68	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,14-UNIMOD:267,16-UNIMOD:21,33-UNIMOD:267	ms_run[1]:scan=11178	56.66215833333334	3	3283.3852	3281.3822	R	G	54	87
PSM	RGGGSGGGEESEGEEVDED	69	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=2835	15.358626666666666	2	1940.683890	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	70	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=2139	11.857001666666667	2	1940.683970	1940.678438	R	-	294	313
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	71	sp|O76094|SRP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=15437	77.16392833333333	3	2894.365817	2894.357634	K	H	618	646
PSM	AAAAGLGHPASPGGSEDGPPGSEEEDAAR	72	sp|Q99856|ARI3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,15-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=9784	49.743	3	2829.1156	2829.1156	R	E	67	96
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	73	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14668	73.394	3	2789.2772	2789.2772	R	T	112	140
PSM	DEDDDEEEEEEGGSWGR	74	sp|O00165-3|HAX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8918	45.557	2	1981.6933	1981.6933	R	G	4	21
PSM	DLDEDELLGNLSETELK	75	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=24885	128.25	2	1931.9211	1931.9211	K	Q	14	31
PSM	EGPEPPEEVPPPTTPPVPK	76	sp|P48634-2|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14350	71.872	2	2078.9909	2078.9909	K	V	585	604
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	77	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=22737	115.03	3	2431.1719	2431.1719	R	S	258	284
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	78	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16927	84.557	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	79	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=18382	91.761	3	2729.1371	2729.1371	K	S	61	87
PSM	GTQTYSVLEGDPSENYSK	80	sp|P52701-4|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13493	67.8	2	1973.8854	1973.8854	K	Y	218	236
PSM	HIEDTGSTPSIGENDLK	81	sp|Q6R327|RICTR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=11826	59.729	2	1971.7864	1971.7864	K	F	1168	1185
PSM	IACEEEFSDSEEEGEGGRK	82	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6776	35.23	2	2316.8131	2316.8131	R	N	414	433
PSM	LAPVPSPEPQKPAPVSPESVK	83	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=12847	64.629	2	2313.1059	2313.1059	K	A	199	220
PSM	RGGGSGGGEESEGEEVDED	84	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=3837	20.516	2	1940.6784	1940.6784	R	-	294	313
PSM	RPPSPDVIVLSDNEQPSSPR	85	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,4-UNIMOD:21,18-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=15822	79.07	3	2369.0569	2369.0569	R	V	97	117
PSM	SLDSDESEDEEDDYQQK	86	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=6516	33.965	2	2036.7914	2036.7914	K	R	57	74
PSM	SSKASLGSLEGEAEAEASSPKGK	87	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=16670	83.34	3	2458.9907	2458.9907	K	F	5745	5768
PSM	SVPVTVDDDDDDNDPENR	88	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8451	43.346	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TFEEALARGDAASSPAPAASVGSSQGGAR	89	sp|Q8WVB6-2|CTF18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:267,14-UNIMOD:21,23-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=14088	70.614	3	2897.2497	2897.2497	R	K	51	80
PSM	TGKEYIPGQPPLSQSSDSSPTR	90	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=12691	63.886	2	2491.0669	2491.0669	K	N	868	890
PSM	VQTDAFVSNELDDPDDLQCK	91	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4	ms_run[2]:scan=18908	94.376	2	2308.0165	2308.0165	R	R	446	466
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	92	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	26-UNIMOD:267	ms_run[1]:scan=11460	57.9689	3	2841.128378	2841.120812	R	T	60	86
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	93	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=11455	57.94366166666667	3	2831.120863	2831.112543	R	T	60	86
PSM	GIPLATGDTSPEPELLPGAPLPPPK	94	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[1]:scan=24346	124.89455	3	2549.321167	2549.312552	K	E	33	58
PSM	RGGGSGGGEESEGEEVDED	95	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=1919	10.76786	2	1940.684063	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	96	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=4049	21.572841666666665	2	1941.686187	1940.678438	R	-	294	313
PSM	AAPTAASDQPDSAATTEK	97	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3044	16.441	2	1730.7959	1730.7959	R	A	132	150
PSM	AEDGSVIDYELIDQDAR	98	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=19951	99.918	2	1917.8831	1917.8831	R	D	180	197
PSM	AKTQTPPVSPAPQPTEER	99	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5190	27.331	2	2092.9232	2092.9232	R	L	360	378
PSM	AQTPPGPSLSGSKSPCPQEK	100	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7186	37.284	2	2211.9273	2211.9273	K	S	1001	1021
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	101	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14241	71.351	3	2789.2772	2789.2772	R	T	112	140
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	102	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21	ms_run[2]:scan=17407	86.913	2	2961.1785	2961.1785	R	V	489	518
PSM	EAGVEMGDEDDLSTPNEK	103	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=11264	57.039	2	1940.8253	1940.8253	R	L	257	275
PSM	EGVILTNESAASTGQPDNDVTEGQR	104	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	25-UNIMOD:267	ms_run[2]:scan=12510	63.005	3	2597.2081	2597.2081	K	A	477	502
PSM	FVEEEDDDEEEEEENLDDQDEQGNLK	105	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13972	70.079	3	3140.2225	3140.2225	K	G	30	56
PSM	GGNLPPVSPNDSGAKIASNPLER	106	sp|Q9UK61-2|TASOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=16574	82.868	3	2449.104	2449.1040	K	H	659	682
PSM	GIPLATGDTSPEPELLPGAPLPPPK	107	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=24576	126.29	2	2549.3126	2549.3126	K	E	33	58
PSM	GPPASSPAPAPKFSPVTPK	108	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=12572	63.294	2	1991.9159	1991.9159	R	F	97	116
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	109	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=15900	79.482	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	110	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=19816	99.168	3	2749.1537	2749.1537	K	S	61	87
PSM	ILQEKLDQPVSAPPSPR	111	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12453	62.733	2	2033.9588	2033.9588	R	D	230	247
PSM	LAPVPSPEPQKPAPVSPESVK	112	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=13053	65.635	2	2313.1059	2313.1059	K	A	199	220
PSM	RGGGSGGGEESEGEEVDED	113	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=4565	24.147	2	1940.6784	1940.6784	R	-	294	313
PSM	RNSSSPVSPASVPGQR	114	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,3-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7035	36.529	2	1804.7773	1804.7773	R	R	655	671
PSM	SATVKPGAVGAGEFVSPCESGDNTGEPSALEEQR	115	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21,18-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=16967	84.768	3	3592.5066	3592.5066	K	G	1686	1720
PSM	SEDEAGCSSVDEESYK	116	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4	ms_run[2]:scan=5481	28.822	2	1790.6789	1790.6789	K	T	328	344
PSM	SHSESASPSALSSSPNNLSPTGWSQPK	117	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=16558	82.784	3	2899.2063	2899.2063	R	T	283	310
PSM	SLGGESSGGTTPVGSFHTEAAR	118	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=11914	60.155	2	2263.9148	2263.9148	K	W	1452	1474
PSM	SSPPLRTPDVLESSGPAVR	119	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,6-UNIMOD:267,7-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16237	81.203	2	2143.9819	2143.9819	R	S	675	694
PSM	TNPEDIYPSNPTDDDVSSGSSSER	120	sp|P16070-15|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	24-UNIMOD:267	ms_run[2]:scan=12059	60.843	3	2578.0818	2578.0818	R	S	163	187
PSM	TSSAFVGKTPEASPEPK	121	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=7721	39.846	2	1891.8006	1891.8006	K	D	303	320
PSM	RGGGSGGGEESEGEEVDED	122	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=1714	9.74347	2	1940.684033	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	123	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=979	6.160196666666667	2	1940.683979	1940.678438	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	124	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=4995	26.32028	2	1941.685533	1940.678438	R	-	294	313
PSM	SPQKSTVLTNGEAAMQSSNSESK	125	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:21,4-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=9107	46.505966666666666	3	2473.112162	2472.124222	K	K	86	109
PSM	AEDGSVIDYELIDQDAR	126	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:267	ms_run[1]:scan=20135	100.87011666666666	2	1917.888002	1917.883135	R	D	180	197
PSM	QASTDAGTAGALTPQHVR	127	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=10604	53.811576666666674	2	1852.8384	1852.8339	R	A	107	125
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	128	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:21,7-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=16804	83.97804000000001	3	2739.154431	2739.145405	K	S	61	87