MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL04.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL04.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	68-UNIMOD:267	0.05	54.0	3	1	0
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	263-UNIMOD:21,279-UNIMOD:4,283-UNIMOD:267	0.01	51.0	4	1	0
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	1218-UNIMOD:21,1217-UNIMOD:21,1176-UNIMOD:21	0.04	51.0	3	2	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	82-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188,94-UNIMOD:21	0.02	50.0	5	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	121-UNIMOD:267	0.05	50.0	5	1	0
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.14	50.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	741-UNIMOD:4,754-UNIMOD:267	0.01	49.0	2	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	100-UNIMOD:21,114-UNIMOD:21,107-UNIMOD:21,97-UNIMOD:267,113-UNIMOD:21,116-UNIMOD:267	0.03	49.0	4	1	0
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	1800-UNIMOD:21,1823-UNIMOD:188,1805-UNIMOD:21,1803-UNIMOD:21	0.01	49.0	5	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	207-UNIMOD:267,212-UNIMOD:21,216-UNIMOD:21,225-UNIMOD:267,5749-UNIMOD:21,5752-UNIMOD:21,5763-UNIMOD:21,5765-UNIMOD:188,3727-UNIMOD:188	0.01	49.0	4	4	4
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	377-UNIMOD:21,398-UNIMOD:21,401-UNIMOD:267,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4	0.02	48.0	4	2	1
PRT	sp|P15408-3|FOSL2_HUMAN	Isoform 3 of Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	172-UNIMOD:21	0.11	48.0	1	1	1
PRT	sp|Q14393-3|GAS6_HUMAN	Isoform 3 of Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	141-UNIMOD:4,147-UNIMOD:4,153-UNIMOD:4	0.03	48.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	128-UNIMOD:188	0.06	47.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1943-UNIMOD:21,1950-UNIMOD:188,1957-UNIMOD:188	0.01	47.0	12	1	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1517-UNIMOD:21,1519-UNIMOD:21,1510-UNIMOD:188,1527-UNIMOD:188	0.01	47.0	13	1	0
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	119-UNIMOD:188	0.09	47.0	2	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	165-UNIMOD:21	0.04	47.0	1	1	1
PRT	sp|Q96B97|SH3K1_HUMAN	SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	475-UNIMOD:188	0.03	47.0	1	1	1
PRT	sp|Q96CC6|RHDF1_HUMAN	Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	180-UNIMOD:21,183-UNIMOD:21,190-UNIMOD:4	0.04	47.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	86-UNIMOD:188	0.06	47.0	2	1	0
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1558-UNIMOD:4,1561-UNIMOD:21,1568-UNIMOD:21	0.01	46.0	4	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	73-UNIMOD:21	0.14	46.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	18-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188,2-UNIMOD:1	0.09	46.0	16	2	1
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	118-UNIMOD:21,126-UNIMOD:21,146-UNIMOD:267	0.09	46.0	2	1	0
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	168-UNIMOD:188	0.06	46.0	2	1	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1372-UNIMOD:267	0.01	45.0	2	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	189-UNIMOD:188	0.06	45.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	45.0	1	1	1
PRT	sp|Q5SXM2|SNPC4_HUMAN	snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1436-UNIMOD:4,1441-UNIMOD:4,1455-UNIMOD:267	0.01	45.0	3	1	0
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	909-UNIMOD:21,912-UNIMOD:188,927-UNIMOD:188	0.02	45.0	2	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	169-UNIMOD:21,181-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.04	45.0	2	1	0
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	185-UNIMOD:21,189-UNIMOD:21	0.09	45.0	2	1	0
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	42-UNIMOD:21,45-UNIMOD:21,44-UNIMOD:188,65-UNIMOD:188	0.11	45.0	9	1	0
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	116-UNIMOD:21,987-UNIMOD:21,991-UNIMOD:21	0.03	45.0	2	2	2
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	56-UNIMOD:21,74-UNIMOD:188	0.04	45.0	4	1	0
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	481-UNIMOD:21,482-UNIMOD:21,486-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	28-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:188	0.17	45.0	3	1	0
PRT	sp|P38398-6|BRCA1_HUMAN	Isoform 6 of Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	509-UNIMOD:21,530-UNIMOD:267	0.04	45.0	2	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	110-UNIMOD:188	0.08	44.0	2	1	0
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4,767-UNIMOD:267	0.04	44.0	10	1	0
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	338-UNIMOD:4,346-UNIMOD:4	0.04	44.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	494-UNIMOD:21,490-UNIMOD:21	0.03	44.0	2	1	0
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	917-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.04	44.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	197-UNIMOD:188	0.05	44.0	4	1	0
PRT	sp|Q96HH9-5|GRM2B_HUMAN	Isoform 5 of GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	110-UNIMOD:4,117-UNIMOD:21,121-UNIMOD:21	0.08	44.0	1	1	0
PRT	sp|P46100-2|ATRX_HUMAN	Isoform 1 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	1066-UNIMOD:267,1323-UNIMOD:21,1327-UNIMOD:4,605-UNIMOD:28,615-UNIMOD:21,619-UNIMOD:188,622-UNIMOD:188	0.02	44.0	6	3	2
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	191-UNIMOD:4,199-UNIMOD:21,198-UNIMOD:188,209-UNIMOD:188	0.02	44.0	2	1	0
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	83-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|O60271-3|JIP4_HUMAN	Isoform 3 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	249-UNIMOD:21,256-UNIMOD:188,273-UNIMOD:188	0.03	44.0	5	1	0
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	253-UNIMOD:188	0.05	43.0	2	1	0
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	66-UNIMOD:21,67-UNIMOD:21,71-UNIMOD:267,86-UNIMOD:267	0.04	43.0	7	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	222-UNIMOD:21,224-UNIMOD:21,233-UNIMOD:267	0.01	43.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	391-UNIMOD:4,394-UNIMOD:188,35-UNIMOD:21,41-UNIMOD:188,58-UNIMOD:267	0.06	43.0	5	2	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	200-UNIMOD:21,194-UNIMOD:21	0.05	43.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	257-UNIMOD:267	0.02	43.0	3	1	0
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	52-UNIMOD:4,56-UNIMOD:267	0.05	43.0	2	1	0
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	294-UNIMOD:267,304-UNIMOD:21	0.06	43.0	3	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	37-UNIMOD:267	0.13	43.0	4	1	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	657-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	819-UNIMOD:21,828-UNIMOD:188,837-UNIMOD:188	0.01	43.0	2	1	0
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	140-UNIMOD:21,151-UNIMOD:4,160-UNIMOD:267	0.05	43.0	2	1	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	324-UNIMOD:267	0.04	43.0	3	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	56-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	8-UNIMOD:188,13-UNIMOD:21,28-UNIMOD:188	0.10	43.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.08	43.0	2	1	0
PRT	sp|P34896-4|GLYC_HUMAN	Isoform 4 of Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	53-UNIMOD:267	0.06	43.0	1	1	1
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.05	43.0	2	1	0
PRT	sp|P28331|NDUS1_HUMAN	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q8N2F6-2|ARM10_HUMAN	Isoform 2 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	42-UNIMOD:21,44-UNIMOD:188,45-UNIMOD:21,65-UNIMOD:188	0.08	43.0	5	1	0
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	86-UNIMOD:21,89-UNIMOD:188,108-UNIMOD:188	0.04	43.0	4	1	0
PRT	sp|Q96HH9|GRM2B_HUMAN	GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	214-UNIMOD:4,221-UNIMOD:21,225-UNIMOD:21	0.06	43.0	1	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	315-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q08357|S20A2_HUMAN	Sodium-dependent phosphate transporter 2 OS=Homo sapiens OX=9606 GN=SLC20A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	415-UNIMOD:188,422-UNIMOD:21,425-UNIMOD:188,259-UNIMOD:21,262-UNIMOD:188,272-UNIMOD:188	0.06	42.0	4	2	0
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.09	42.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.01	42.0	1	1	1
PRT	sp|Q5C9Z4|NOM1_HUMAN	Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	280-UNIMOD:21,295-UNIMOD:188,297-UNIMOD:188	0.03	42.0	1	1	1
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	179-UNIMOD:21,185-UNIMOD:188	0.09	42.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	853-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	262-UNIMOD:188	0.05	42.0	3	1	0
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	616-UNIMOD:21,626-UNIMOD:21,634-UNIMOD:4,623-UNIMOD:21	0.04	42.0	2	1	0
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	267-UNIMOD:21,272-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	243-UNIMOD:21,231-UNIMOD:188	0.07	42.0	2	1	0
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1279-UNIMOD:21,1287-UNIMOD:4	0.02	42.0	2	1	0
PRT	sp|Q12948|FOXC1_HUMAN	Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	227-UNIMOD:188,233-UNIMOD:4,235-UNIMOD:21,241-UNIMOD:21,256-UNIMOD:188	0.06	42.0	1	1	1
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	487-UNIMOD:21,493-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	204-UNIMOD:21,214-UNIMOD:21,284-UNIMOD:21,297-UNIMOD:21	0.05	42.0	2	2	2
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	668-UNIMOD:188	0.02	42.0	3	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	148-UNIMOD:267	0.06	42.0	3	1	0
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	144-UNIMOD:188	0.09	42.0	2	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	253-UNIMOD:267	0.07	42.0	2	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	655-UNIMOD:267,657-UNIMOD:21,659-UNIMOD:21,670-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	113-UNIMOD:21,118-UNIMOD:21,125-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	113-UNIMOD:4,117-UNIMOD:188	0.13	42.0	2	1	0
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	530-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q53EP0-2|FND3B_HUMAN	Isoform 2 of Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	253-UNIMOD:21,256-UNIMOD:188,270-UNIMOD:188	0.03	42.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	150-UNIMOD:188	0.06	42.0	2	1	0
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	771-UNIMOD:188	0.00	42.0	2	1	0
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	805-UNIMOD:21,809-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	360-UNIMOD:21	0.00	42.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	2	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	122-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	47-UNIMOD:21,51-UNIMOD:21,56-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	464-UNIMOD:4,465-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1,19-UNIMOD:188,12-UNIMOD:21	0.07	42.0	3	2	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	257-UNIMOD:267	0.01	42.0	3	1	0
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	608-UNIMOD:21,610-UNIMOD:188,624-UNIMOD:267,335-UNIMOD:21,346-UNIMOD:4	0.04	42.0	2	2	2
PRT	sp|Q9H6U6|BCAS3_HUMAN	Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	475-UNIMOD:28,479-UNIMOD:4,480-UNIMOD:21,488-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q6P3S6|FBX42_HUMAN	F-box only protein 42 OS=Homo sapiens OX=9606 GN=FBXO42 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	365-UNIMOD:21,373-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|Q9Y520-3|PRC2C_HUMAN	Isoform 3 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	187-UNIMOD:21,196-UNIMOD:188,215-UNIMOD:188	0.01	41.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	679-UNIMOD:21,683-UNIMOD:21,692-UNIMOD:188,678-UNIMOD:21	0.03	41.0	5	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	400-UNIMOD:21,405-UNIMOD:188,409-UNIMOD:188,398-UNIMOD:21,377-UNIMOD:21	0.04	41.0	3	2	1
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	205-UNIMOD:188	0.06	41.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	498-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	274-UNIMOD:188	0.05	41.0	2	1	0
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	284-UNIMOD:188	0.05	41.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	31-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q9P2N6-8|KANL3_HUMAN	Isoform 8 of KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	428-UNIMOD:21,436-UNIMOD:21,449-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	387-UNIMOD:4,392-UNIMOD:21,394-UNIMOD:21,402-UNIMOD:267,403-UNIMOD:267	0.04	41.0	4	1	0
PRT	sp|Q5TC82-2|RC3H1_HUMAN	Isoform 2 of Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	531-UNIMOD:21,535-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	159-UNIMOD:188,171-UNIMOD:21,173-UNIMOD:21,187-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	215-UNIMOD:188	0.06	41.0	2	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	105-UNIMOD:21,109-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	164-UNIMOD:21,167-UNIMOD:4,148-UNIMOD:267	0.13	41.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	73-UNIMOD:188	0.10	41.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	472-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	157-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	191-UNIMOD:21,200-UNIMOD:21,204-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	217-UNIMOD:21,219-UNIMOD:188,221-UNIMOD:4,232-UNIMOD:188,213-UNIMOD:21	0.03	41.0	2	1	0
PRT	sp|O15014|ZN609_HUMAN	Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	842-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.04	41.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	587-UNIMOD:21,603-UNIMOD:188,894-UNIMOD:267,897-UNIMOD:21,899-UNIMOD:21,907-UNIMOD:267	0.04	41.0	2	2	2
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	221-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	85-UNIMOD:267	0.27	41.0	2	1	0
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	215-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	82-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188	0.02	41.0	1	1	0
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	653-UNIMOD:188	0.03	40.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	364-UNIMOD:21,380-UNIMOD:21,381-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q14657|LAGE3_HUMAN	EKC/KEOPS complex subunit LAGE3 OS=Homo sapiens OX=9606 GN=LAGE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	18-UNIMOD:267	0.12	40.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	79-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	35-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	680-UNIMOD:267	0.02	40.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	569-UNIMOD:21,570-UNIMOD:21	0.03	40.0	3	1	0
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|Q8NEJ9-2|NGDN_HUMAN	Isoform 2 of Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	142-UNIMOD:21,161-UNIMOD:188,162-UNIMOD:188	0.07	40.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	306-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	61-UNIMOD:188	0.05	40.0	2	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	68-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	829-UNIMOD:188	0.02	40.0	6	1	0
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	277-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q8N5P1|ZC3H8_HUMAN	Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZC3H8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	70-UNIMOD:21,71-UNIMOD:188,82-UNIMOD:4,92-UNIMOD:188	0.08	40.0	1	1	1
PRT	sp|P10321|HLAC_HUMAN	HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	341-UNIMOD:188,345-UNIMOD:4,350-UNIMOD:4,357-UNIMOD:21,360-UNIMOD:21,364-UNIMOD:4,365-UNIMOD:188	0.08	40.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	230-UNIMOD:21,247-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	498-UNIMOD:188,500-UNIMOD:21,513-UNIMOD:4,514-UNIMOD:188	0.01	40.0	1	1	1
PRT	sp|O15126|SCAM1_HUMAN	Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	334-UNIMOD:188	0.07	40.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	557-UNIMOD:21,559-UNIMOD:21,560-UNIMOD:21,569-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.02	40.0	5	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	78-UNIMOD:21,85-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,10-UNIMOD:188,22-UNIMOD:267	0.10	40.0	2	1	0
PRT	sp|Q9ULU4|PKCB1_HUMAN	Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	486-UNIMOD:21,490-UNIMOD:21,492-UNIMOD:188,505-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|P09496-5|CLCA_HUMAN	Isoform 5 of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	131-UNIMOD:267	0.13	39.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	483-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1104-UNIMOD:21,1114-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	214-UNIMOD:267	0.05	39.0	1	1	1
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	149-UNIMOD:267	0.11	39.0	1	1	1
PRT	sp|Q6ZUJ8|BCAP_HUMAN	Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	147-UNIMOD:4,149-UNIMOD:21,159-UNIMOD:188,165-UNIMOD:188,151-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|Q96BZ8|LENG1_HUMAN	Leukocyte receptor cluster member 1 OS=Homo sapiens OX=9606 GN=LENG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:267	0.06	39.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	412-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|Q7Z3F1|GP155_HUMAN	Integral membrane protein GPR155 OS=Homo sapiens OX=9606 GN=GPR155 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	837-UNIMOD:21,841-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	102-UNIMOD:21,108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188	0.05	39.0	1	1	1
PRT	sp|P55210-4|CASP7_HUMAN	Isoform 4 of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	185-UNIMOD:267	0.09	39.0	2	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	240-UNIMOD:21,244-UNIMOD:21	0.04	39.0	3	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	807-UNIMOD:21,810-UNIMOD:188,811-UNIMOD:21,814-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2689-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	423-UNIMOD:21,425-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P13051-2|UNG_HUMAN	Isoform 1 of Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	51-UNIMOD:21,55-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|Q9HCH0-2|NCK5L_HUMAN	Isoform 2 of Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	447-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	171-UNIMOD:267,182-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	314-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	695-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	551-UNIMOD:21,552-UNIMOD:4,556-UNIMOD:188,567-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	238-UNIMOD:267	0.05	39.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q8IWY9|CDAN1_HUMAN	Codanin-1 OS=Homo sapiens OX=9606 GN=CDAN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	265-UNIMOD:21,270-UNIMOD:4,277-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q92835-3|SHIP1_HUMAN	Isoform 3 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	300-UNIMOD:267,301-UNIMOD:21,302-UNIMOD:267,305-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	827-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|Q6GQQ9-2|OTU7B_HUMAN	Isoform 2 of OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	467-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	95-UNIMOD:188,98-UNIMOD:188,99-UNIMOD:21	0.19	39.0	1	1	1
PRT	sp|Q15678|PTN14_HUMAN	Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens OX=9606 GN=PTPN14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	620-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	322-UNIMOD:4,326-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1932-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	33-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	247-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	232-UNIMOD:4,236-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	206-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,8-UNIMOD:188,18-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	189-UNIMOD:21,197-UNIMOD:21	0.09	39.0	1	1	0
PRT	sp|Q92769|HDAC2_HUMAN	Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	417-UNIMOD:4,422-UNIMOD:21,424-UNIMOD:21	0.04	39.0	1	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	230-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	372-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q86US8-3|EST1A_HUMAN	Isoform 3 of Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	548-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|Q9BSA4|TTYH2_HUMAN	Protein tweety homolog 2 OS=Homo sapiens OX=9606 GN=TTYH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	392-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	41-UNIMOD:21,57-UNIMOD:188	0.08	38.0	1	1	1
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	354-UNIMOD:21,368-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q5TGY3|AHDC1_HUMAN	AT-hook DNA-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	596-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q8IUI4|S29P2_HUMAN	Putative protein SNX29P2 OS=Homo sapiens OX=9606 GN=SNX29P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	191-UNIMOD:21	0.10	38.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	171-UNIMOD:188	0.09	38.0	1	1	1
PRT	sp|Q86WC4|OSTM1_HUMAN	Osteopetrosis-associated transmembrane protein 1 OS=Homo sapiens OX=9606 GN=OSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	333-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	101-UNIMOD:188	0.09	38.0	2	1	0
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	59-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	216-UNIMOD:21,220-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	516-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q86YD5-2|LRAD3_HUMAN	Isoform 2 of Low-density lipoprotein receptor class A domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LDLRAD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	248-UNIMOD:21	0.13	38.0	1	1	1
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	339-UNIMOD:188	0.03	38.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	416-UNIMOD:267,417-UNIMOD:21,431-UNIMOD:4,432-UNIMOD:21,437-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q9BVS4-2|RIOK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	380-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:4,171-UNIMOD:4,176-UNIMOD:188	0.06	38.0	1	1	1
PRT	sp|Q9Y4U1|MMAC_HUMAN	Methylmalonic aciduria and homocystinuria type C protein OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	273-UNIMOD:267,275-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	220-UNIMOD:21,224-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	311-UNIMOD:21,315-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2161-UNIMOD:21,2165-UNIMOD:21,2169-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	300-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	216-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q504T8|MIDN_HUMAN	Midnolin OS=Homo sapiens OX=9606 GN=MIDN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	206-UNIMOD:21,222-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|P26640-2|SYVC_HUMAN	Isoform 2 of Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	242-UNIMOD:267	0.06	38.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	13-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	560-UNIMOD:21,568-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	467-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	140-UNIMOD:28,157-UNIMOD:188,158-UNIMOD:188	0.08	38.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	2323-UNIMOD:21,2328-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	107-UNIMOD:28,109-UNIMOD:21,124-UNIMOD:267	0.04	38.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NAGDLAPAGGAASASTDEAADAESGTR	1	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0		ms_run[2]:scan=11270	53.833	2	2432.0688	2432.0688	R	N	42	69
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	2	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23834	114.69	2	2431.1719	2431.1719	R	S	258	284
PSM	SSVKTPETVVPTAPELQASASTDQPVTSEPTSR	3	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	2-UNIMOD:21	ms_run[2]:scan=18036	85.718	3	3476.656	3476.6560	R	T	1217	1250
PSM	AQAVSEEEEEEEGKSSSPK	4	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	5-UNIMOD:21,14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5309	25.383	2	2140.9088	2140.9088	K	K	78	97
PSM	LVQDVANNTNEEAGDGTTTATVLAR	5	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=14570	69.186	2	2559.2413	2559.2413	K	S	97	122
PSM	LVQDVANNTNEEAGDGTTTATVLAR	6	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	25-UNIMOD:267	ms_run[2]:scan=14574	69.203	2	2569.2495	2569.2495	K	S	97	122
PSM	NAGDLAPAGGAASASTDEAADAESGTR	7	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	27-UNIMOD:267	ms_run[2]:scan=11271	53.835	2	2442.077	2442.0770	R	N	42	69
PSM	SEGEGEAASADDGSLNTSGAGPK	8	sp|Q9NWV8-3|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=7248	34.644	2	2105.8985	2105.8985	R	S	49	72
PSM	LQELESCSGLGSTSDDTDVR	9	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	7-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=13501	64.496	2	2177.9622	2177.9622	R	E	735	755
PSM	LQELESCSGLGSTSDDTDVR	10	sp|Q14C86-3|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	7-UNIMOD:4	ms_run[2]:scan=13531	64.615	2	2167.9539	2167.9539	R	E	735	755
PSM	RPPSPDVIVLSDNEQPSSPR	11	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=16476	78.162	2	2349.0403	2349.0403	R	V	97	117
PSM	TLSSPSLQTDGIAATPVPPPPPPK	12	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=19781	93.814	2	2453.255	2453.2550	R	S	1800	1824
PSM	TVIRLPSGSGAASPTGSAVDIR	13	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	4-UNIMOD:267,9-UNIMOD:21,13-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=19347	91.732	2	2291.0827	2291.0827	K	A	204	226
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	14	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=17205	81.589	3	3011.3427	3011.3427	R	D	374	402
PSM	SGGGSVGAVVVKQEPLEEDSPSSSSAGLDK	15	sp|P15408-3|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=16426	77.943	3	2952.3601	2952.3601	R	A	172	202
PSM	TCQDIDECADSEACGEAR	16	sp|Q14393-3|GAS6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	2-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=8072	38.474	2	2085.7674	2085.7674	R	C	140	158
PSM	TLSSPSLQTDGIAATPVPPPPPPK	17	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=19740	93.608	2	2447.2349	2447.2349	R	S	1800	1824
PSM	AQAVSEEEEEEEGKSSSPK	18	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21	ms_run[2]:scan=5101	24.397	2	2128.8685	2128.8685	K	K	78	97
PSM	DATNVGDEGGFAPNILENK	19	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	19-UNIMOD:188	ms_run[2]:scan=20187	95.777	2	1965.9375	1965.9375	K	E	110	129
PSM	GAGDGSDEEVDGKADGAEAKPAE	20	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21	ms_run[2]:scan=5100	24.395	2	2253.8911	2253.8911	K	-	1938	1961
PSM	KVVEAVNSDSDSEFGIPK	21	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16077	76.25	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	22	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16942	80.365	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	23	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=18005	85.582	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	24	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=17045	80.856	2	2091.9206	2091.9206	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	25	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=17129	81.239	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LGIYDADGDGDFDVDDAK	26	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	18-UNIMOD:188	ms_run[2]:scan=19786	93.836	2	1905.8212	1905.8212	K	V	102	120
PSM	RPPSPDVIVLSDNEQPSSPR	27	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=15342	72.723	2	2349.0403	2349.0403	R	V	97	117
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	28	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21	ms_run[2]:scan=7651	36.484	3	2856.1094	2856.1094	R	S	161	188
PSM	SNDIDLEGFDSVVSSTEK	29	sp|Q96B97|SH3K1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	18-UNIMOD:188	ms_run[2]:scan=23797	114.5	2	1946.9052	1946.9052	R	L	458	476
PSM	TLSSPSLQTDGIAATPVPPPPPPK	30	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=19961	94.672	2	2447.2349	2447.2349	R	S	1800	1824
PSM	VADDTAEGLSAPHTPVTPGAASLCSFSSSR	31	sp|Q96CC6|RHDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	14-UNIMOD:21,17-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=19694	93.371	3	3147.3257	3147.3257	R	S	167	197
PSM	VNEASGDGDGEDAVVILEK	32	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=16475	78.158	2	1915.9011	1915.9011	K	T	68	87
PSM	VNEASGDGDGEDAVVILEK	33	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	19-UNIMOD:188	ms_run[2]:scan=16499	78.267	2	1921.9212	1921.9212	K	T	68	87
PSM	KQETAAVCGETDEEAGESGGEGIFR	34	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15435	73.135	3	2786.078	2786.0780	K	E	1551	1576
PSM	KVVEAVNSDSDSEFGIPK	35	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16709	79.304	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	36	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=17777	84.522	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	37	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16305	77.34	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	38	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=10202	48.479	3	2796.2339	2796.2339	K	K	68	94
PSM	SETAPAETATPAPVEKSPAK	39	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:21	ms_run[2]:scan=6305	30.02	2	2060.9667	2060.9667	M	K	2	22
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	40	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=19904	94.392	3	2952.3714	2952.3714	R	E	118	147
PSM	TIQNLYDLDEDDDGIASVPTK	41	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=22421	107.2	2	2321.0911	2321.0911	K	Q	148	169
PSM	AAEINGEVDDDDAGGEWR	42	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:267	ms_run[2]:scan=13431	64.192	2	1927.8059	1927.8059	R	L	1355	1373
PSM	AAEINGEVDDDDAGGEWR	43	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=13434	64.205	2	1917.7977	1917.7977	R	L	1355	1373
PSM	AASADSTTEGTPADGFTVLSTK	44	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	22-UNIMOD:188	ms_run[2]:scan=17557	83.409	2	2132.0217	2132.0217	K	S	168	190
PSM	AQAVSEEEEEEEGKSSSPK	45	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:188,17-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=3720	18.253	2	2140.9088	2140.9088	K	K	78	97
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	46	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14974	71.055	3	2789.2772	2789.2772	R	T	112	140
PSM	CSASSCLDTSNDPDDLDVLR	47	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=18876	89.576	2	2238.9369	2238.9369	K	T	1436	1456
PSM	GAGDGSDEEVDGKADGAEAKPAE	48	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=5314	25.403	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GVSQEKEAQISSAIVSSVQSK	49	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=20370	96.668	2	2241.089	2241.0890	R	I	907	928
PSM	KQETAAVCGETDEEAGESGGEGIFR	50	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15203	72.065	3	2786.078	2786.0780	K	E	1551	1576
PSM	KVVEAVNSDSDSEFGIPK	51	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16514	78.348	2	2091.9206	2091.9206	K	K	1510	1528
PSM	NHLSPQQGGATPQVPSPCCR	52	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10472	49.713	2	2359.9468	2359.9468	K	F	166	186
PSM	SPSGPVKSPPLSPVGTTPVK	53	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=13189	63.117	2	2091.0054	2091.0054	K	L	178	198
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	54	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=19875	94.261	3	2962.3796	2962.3796	R	E	118	147
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	55	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=20865	99.138	3	2692.1753	2692.1753	R	L	42	66
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	56	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=20735	98.471	2	2692.1753	2692.1753	R	L	42	66
PSM	SVSVDSGEQREAGTPSLDSEAK	57	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=10402	49.376	2	2328.0118	2328.0118	R	E	116	138
PSM	SYEDLTESEDGAASGDSHK	58	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=8807	42.002	2	2076.7797	2076.7797	R	E	56	75
PSM	TVTPASSAKTSPAKQQAPPVR	59	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5350	25.562	2	2361.0532	2361.0532	K	N	476	497
PSM	TYADYESVNECMEGVCK	60	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=16294	77.292	2	2053.8067	2053.8067	R	M	18	35
PSM	VAESAQSPAAAHTTDTAGYNAMEESVSR	61	sp|P38398-6|BRCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21	ms_run[2]:scan=13951	66.434	3	2930.239	2930.2390	K	E	503	531
PSM	TLSSPSLQTDGIAATPVPPPPPPK	62	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	6-UNIMOD:21,24-UNIMOD:188	ms_run[1]:scan=20000	94.85880833333334	2	2454.270899	2453.255038	R	S	1800	1824
PSM	AEDNADTLALVFEAPNQEK	63	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=24409	117.76	2	2080.0056	2080.0056	R	V	92	111
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	64	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12312	58.591	3	3173.2435	3173.2435	R	-	738	768
PSM	CQLALQNVCDDVDNDDVSLK	65	sp|Q9C0B1|FTO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=21262	101.07	2	2320.0311	2320.0311	R	S	338	358
PSM	CSASSCLDTSNDPDDLDVLR	66	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:4,6-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=18863	89.531	2	2248.9452	2248.9452	K	T	1436	1456
PSM	DATNVGDEGGFAPNILENK	67	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=20206	95.86	2	1959.9174	1959.9174	K	E	110	129
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	68	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=18282	86.891	3	2961.1785	2961.1785	R	V	489	518
PSM	GAVAAEGASDTEREEPTESQGLAAR	69	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=10264	48.768	3	2581.1293	2581.1293	R	L	907	932
PSM	KVVEAVNSDSDSEFGIPK	70	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16288	77.26	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LAPITSDPTEATAVGAVEASFK	71	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=26286	129.03	2	2174.1107	2174.1107	R	C	386	408
PSM	NHLSPQQGGATPQVPSPCCR	72	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=10576	50.213	2	2349.9385	2349.9385	K	F	166	186
PSM	QNLYDLDEDDDGIASVPTK	73	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=19443	92.189	2	2106.9593	2106.9593	K	Q	179	198
PSM	QNLYDLDEDDDGIASVPTK	74	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=19708	93.443	2	2112.9795	2112.9795	K	Q	179	198
PSM	RPPSPDVIVLSDNEQPSSPR	75	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,4-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=16486	78.206	2	2369.0569	2369.0569	R	V	97	117
PSM	SVCGHLENTSVGNSPNPSSAENSFR	76	sp|Q96HH9-5|GRM2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=14397	68.41	3	2806.1055	2806.1055	K	A	108	133
PSM	SVPVTVDDDDDDNDPENR	77	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:267	ms_run[2]:scan=8924	42.552	2	2025.8275	2025.8275	K	I	1049	1067
PSM	SYEDLTESEDGAASGDSHK	78	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=8806	41.999	2	2082.7998	2082.7998	R	E	56	75
PSM	TCDSITPSKSSPVPVSDTQK	79	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=8545	40.584	2	2212.9923	2212.9923	R	L	190	210
PSM	TTYDSAEEENKENLYAGK	80	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=9722	46.238	2	2140.8838	2140.8838	K	N	79	97
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	81	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:21	ms_run[2]:scan=13729	65.461	3	2823.2448	2823.2448	K	A	248	274
PSM	SETAPAETATPAPVEKSPAK	82	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	17-UNIMOD:21	ms_run[1]:scan=7368	35.199415	2	2061.9752	2060.9662	M	K	2	22
PSM	YGDINFDDLNSEQSYNK	83	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=19346	91.72926	2	2020.863277	2020.865030	K	S	197	214
PSM	DPDAQPGGELMLGGTDSK	84	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14392	68.39	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	85	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:21	ms_run[2]:scan=18329	87.084	2	2961.1785	2961.1785	R	V	489	518
PSM	GAGDGSDEEVDGKADGAEAKPAE	86	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=5622	26.82	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	87	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=19537	92.631	3	2729.1371	2729.1371	K	S	61	87
PSM	GVSQEKEAQISSAIVSSVQSK	88	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,6-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=20375	96.69	2	2253.1292	2253.1292	R	I	907	928
PSM	HIISATSLSTSPTELGSR	89	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=16953	80.412	2	2025.9049	2025.9049	R	N	216	234
PSM	LASGEDDPFDSDFSCPVK	90	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=20445	97.032	2	1990.8562	1990.8562	K	L	377	395
PSM	LEAIEDDSVKETDSSSASAATPSK	91	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	21-UNIMOD:21	ms_run[2]:scan=9749	46.366	3	2517.1007	2517.1007	K	K	180	204
PSM	LSEGSQPAEEEEDQETPSR	92	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=6447	30.782	2	2126.9115	2126.9115	K	N	239	258
PSM	MAEGGSGDVDDAGDCSGAR	93	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:4	ms_run[2]:scan=4137	20.147	2	1825.6843	1825.6843	K	Y	38	57
PSM	QNLYDLDEDDDGIASVPTK	94	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:188	ms_run[2]:scan=19441	92.178	2	2112.9795	2112.9795	K	Q	179	198
PSM	RGGGSGGGEESEGEEVDED	95	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2781	14.022	2	1940.6784	1940.6784	R	-	294	313
PSM	SASPDDDLGSSNWEAADLGNEER	96	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	23-UNIMOD:267	ms_run[2]:scan=18805	89.274	2	2444.0239	2444.0239	R	K	15	38
PSM	SIEGTADDEEEGVSPDTAIR	97	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:267	ms_run[2]:scan=13483	64.416	2	2099.937	2099.9370	K	S	638	658
PSM	SPQVLGSSLSVRSPTGSPSR	98	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=14529	69.018	2	2157.9821	2157.9821	K	L	975	995
PSM	SPSGPVKSPPLSPVGTTPVK	99	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=13171	63.032	2	2091.0054	2091.0054	K	L	178	198
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	100	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=18265	86.82	3	2692.1753	2692.1753	R	L	42	66
PSM	SSSPAELDLKDDLQQTQGK	101	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,10-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=16286	77.25	2	2151.0135	2151.0135	R	C	819	838
PSM	SVEDDEEGHLICQSGDVLSAR	102	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,12-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=19225	91.202	2	2405.0082	2405.0082	R	Y	140	161
PSM	SVPVTVDDDDDDNDPENR	103	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8905	42.486	2	2015.8192	2015.8192	K	I	1049	1067
PSM	SVPVTVDDDDDDNDPENR	104	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=8713	41.538	2	2025.8275	2025.8275	K	I	1049	1067
PSM	TDASSASSFLDSDELER	105	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:267	ms_run[2]:scan=19223	91.191	2	1838.8045	1838.8045	R	T	308	325
PSM	TDASSASSFLDSDELER	106	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=19241	91.268	2	1828.7963	1828.7963	R	T	308	325
PSM	TESPATAAETASEELDNR	107	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=17695	84.171	2	1900.8526	1900.8526	R	S	39	57
PSM	TTDEGAKNNEESPTATVAEQGEDITSK	108	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:188,12-UNIMOD:21,27-UNIMOD:188	ms_run[2]:scan=12620	60.228	3	2913.2803	2913.2803	M	K	2	29
PSM	VIAINVDDPDAANYNDINDVK	109	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=20365	96.646	3	2287.0968	2287.0968	K	R	156	177
PSM	VNPDTGYINYDQLEENAR	110	sp|P34896-4|GLYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=18796	89.237	2	2119.9686	2119.9686	K	L	36	54
PSM	YYSPCEEHPAETNQNEGAESGTIR	111	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10127	48.116	3	2828.1261	2828.1261	R	Q	182	206
PSM	YDDIEGANYFQQANELSK	112	sp|P28331|NDUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=21159	100.54707333333333	2	2104.934493	2103.938529	R	L	656	674
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	113	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:21	ms_run[1]:scan=19852	94.13900333333333	3	2692.157917	2692.175281	R	L	42	66
PSM	SPQKSTVLTNGEAAMQSSNSESK	114	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:21,4-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=9752	46.37921333333333	3	2473.110028	2472.124222	K	K	86	109
PSM	SVCGHLENTSVGNSPNPSSAENSFR	115	sp|Q96HH9|GRM2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	3-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=14623	69.42689666666666	3	2807.113692	2806.105518	K	A	212	237
PSM	AADEEAFEDNSEEYIR	116	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=16152	76.626	2	1896.7889	1896.7889	R	R	300	316
PSM	AADSSAPEDSEKLVGDTVSYSK	117	sp|Q08357|S20A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:188,19-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=14068	66.952	2	2347.0507	2347.0507	R	K	404	426
PSM	AADSSAPEDSEKLVGDTVSYSK	118	sp|Q08357|S20A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:21	ms_run[2]:scan=14072	66.967	2	2335.0104	2335.0104	R	K	404	426
PSM	AEAAASALADADADLEER	119	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19546	92.671	2	1787.8174	1787.8174	K	L	198	216
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	120	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12073	57.582	3	3173.2435	3173.2435	R	-	738	768
PSM	APPVDDAEVDELVLQTK	121	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22300	106.53	2	1837.9309	1837.9309	K	R	1315	1332
PSM	AQAVSEEEEEEEGKSSSPK	122	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=3727	18.282	2	2128.8685	2128.8685	K	K	78	97
PSM	AQEAEAQSEDDDEDTEEEQGEEKEK	123	sp|Q5C9Z4|NOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,23-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=4064	19.82	3	2959.129	2959.1290	K	G	273	298
PSM	EAAVSASDILQESAIHSPGTVEK	124	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=19878	94.275	2	2424.1517	2424.1517	R	E	163	186
PSM	ETTDTDTADQVIASFK	125	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=21333	101.45	2	1740.8054	1740.8054	R	V	838	854
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	126	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23642	113.68	2	2431.1719	2431.1719	R	S	258	284
PSM	GDVVNQDDLYQALASGK	127	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=21745	103.62	2	1797.884	1797.8840	R	I	246	263
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	128	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,18-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=15112	71.66	3	2842.2398	2842.2398	K	Q	609	638
PSM	GNKSPSPPDGSPAATPEIR	129	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=9045	43.061	2	2036.8606	2036.8606	K	V	262	281
PSM	GPDKLLPYPTLASPASD	130	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=23081	110.73	2	1820.8597	1820.8597	R	-	228	245
PSM	GPDKLLPYPTLASPASD	131	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:188,16-UNIMOD:21	ms_run[2]:scan=23108	110.86	2	1826.8799	1826.8799	R	-	228	245
PSM	GWGQQDGPGPPSPGQSPSPCR	132	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=11959	57.092	2	2227.9106	2227.9106	R	T	1268	1289
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	133	sp|Q12948|FOXC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:188,11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21,34-UNIMOD:188	ms_run[2]:scan=20018	94.945	3	3501.6655	3501.6655	R	I	223	257
PSM	KASSPSPLTIGTPESQR	134	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=10711	50.829	2	1914.8489	1914.8489	R	K	482	499
PSM	KQETAAVCGETDEEAGESGGEGIFR	135	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15177	71.947	2	2786.078	2786.0780	K	E	1551	1576
PSM	KVVEAVNSDSDSEFGIPK	136	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16501	78.278	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LAPVPSPEPQKPAPVSPESVK	137	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=13628	65.019	2	2313.1059	2313.1059	K	A	199	220
PSM	LEDTENWLYEDGEDQPK	138	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=18888	89.63	2	2085.911	2085.9110	K	Q	652	669
PSM	LGIYDADGDGDFDVDDAK	139	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19797	93.883	2	1899.801	1899.8010	K	V	102	120
PSM	LSEGSQPAEEEEDQETPSR	140	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=6661	31.918	2	2126.9115	2126.9115	K	N	239	258
PSM	LYGSAGPPPTGEEDTAEKDEL	141	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14425	68.536	2	2174.9855	2174.9855	K	-	634	655
PSM	MAEGGSGDVDDAGDCSGAR	142	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=4125	20.092	2	1835.6926	1835.6926	K	Y	38	57
PSM	NAGDLAPAGGAASASTDEAADAESGTR	143	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11266	53.804	3	2432.0688	2432.0688	R	N	42	69
PSM	NGLAEGTEQEEEEEDEQVR	144	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=10675	50.67	2	2199.9279	2199.9279	R	L	130	149
PSM	QFYDQALQQAVVDDDANNAK	145	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20047	95.079	2	2252.0346	2252.0346	K	A	125	145
PSM	QQLSAEELDAQLDAYNAR	146	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=21104	100.29	2	2043.9737	2043.9737	K	M	236	254
PSM	RNSSSPVSPASVPGQR	147	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6823	32.71	2	1804.7773	1804.7773	R	R	655	671
PSM	RSSQPSPTAVPASDSPPTKQEVK	148	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=8087	38.54	3	2633.1177	2633.1177	R	K	111	134
PSM	SEDFGVNEDLADSDAR	149	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14977	71.067	2	1738.7282	1738.7282	R	A	189	205
PSM	SETAPAETATPAPVEKSPAK	150	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=6683	32.034	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	151	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=7131	34.13	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	152	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6534	31.287	2	2073.007	2073.0070	M	K	2	22
PSM	SGEEDFESLASQFSDCSSAK	153	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:4	ms_run[2]:scan=24153	116.38	2	2179.8852	2179.8852	K	A	98	118
PSM	SLDGALYDDEDDDDIER	154	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=16238	77.026	2	1964.7999	1964.7999	K	A	514	531
PSM	SSKASLGSLEGEAEAEASSPKGK	155	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17569	83.476	3	2458.9907	2458.9907	K	F	5745	5768
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	156	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=20520	97.416	2	2692.1753	2692.1753	R	L	42	66
PSM	SSPKSNDSDLQEYELEVK	157	sp|Q53EP0-2|FND3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=16316	77.399	2	2158.971	2158.9710	R	R	253	271
PSM	SVGDGETVEFDVVEGEK	158	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=18234	86.664	2	1800.8361	1800.8361	R	G	134	151
PSM	SVLDQDDVDTSMEESLK	159	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=19362	91.8	2	1915.8664	1915.8664	K	H	755	772
PSM	TAPRQEAIPDLEDSPPVSDSEEQQESAR	160	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15980	75.812	3	3240.3497	3240.3497	K	A	792	820
PSM	TGSTSSKEDDYESDAATIVQK	161	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=13979	66.55	2	2310.9741	2310.9741	R	C	360	381
PSM	TSSAETPTIPLGSAVEAIK	162	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22481	107.53	2	1870.9888	1870.9888	K	A	550	569
PSM	TVDFTQDSNYLLTGGQDK	163	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=21607	102.92	2	2000.9327	2000.9327	K	L	105	123
PSM	TYADYESVNECMEGVCK	164	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=16301	77.322	2	2059.8269	2059.8269	R	M	18	35
PSM	VAAAAGSGPSPPGSPGHDR	165	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4518	21.85	2	1856.7483	1856.7483	R	E	38	57
PSM	VIAINVDDPDAANYNDINDVK	166	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20377	96.697	2	2287.0968	2287.0968	K	R	156	177
PSM	VQTDAFVSNELDDPDDLQCK	167	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=19938	94.554	2	2314.0366	2314.0367	R	R	446	466
PSM	VSDESLSKVQEAESPVFK	168	sp|Q08357|S20A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=17194	81.541	2	2057.9558	2057.9558	R	E	255	273
PSM	ADHSFSDGVPSDSVEAAK	169	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,18-UNIMOD:188	ms_run[1]:scan=12836	61.38861833333333	2	1865.8383	1865.8370	M	N	2	20
PSM	LSEGSQPAEEEEDQETPSR	170	sp|Q9UKV3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=6948	33.278965	2	2117.896884	2116.903266	K	N	239	258
PSM	LSEGSQPAEEEEDQETPSR	171	sp|Q9UKV3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	19-UNIMOD:267	ms_run[1]:scan=7173	34.313158333333334	2	2127.902452	2126.911535	K	N	239	258
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	172	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=13603	64.91537833333334	3	3174.239298	3173.243468	R	-	738	768
PSM	SETAPAETATPAPVEKSPAK	173	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7035	33.682826666666664	2	2102.9832	2102.9768	M	K	2	22
PSM	TEELIESPKLESSEGEIIQTVDR	174	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	7-UNIMOD:21,9-UNIMOD:188,23-UNIMOD:267	ms_run[1]:scan=24614	118.92028166666667	3	2698.314764	2697.296851	K	Q	602	625
PSM	LVQDVANNTNEEAGDGTTTATVLAR	175	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	25-UNIMOD:267	ms_run[1]:scan=14776	70.14785833333333	3	2570.256328	2569.249522	K	S	97	122
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	176	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:188,4-UNIMOD:21,24-UNIMOD:188	ms_run[1]:scan=19425	92.10771	3	2705.212719	2704.215539	R	L	42	66
PSM	QGGRCSPVPGLSSSPSGSPLHGK	177	sp|Q9H6U6|BCAS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,5-UNIMOD:4,6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=14227	67.64677666666667	3	2391.0092	2391.0075	K	L	475	498
PSM	APLSPSLNSRPSPISATPPALVPETR	178	sp|Q6P3S6|FBX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=22133	105.65502166666666	3	2815.391218	2814.371827	R	E	362	388
PSM	AAGSPSSSDQDEKLPGQDESTAGTSEQNDILK	179	sp|Q9Y520-3|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=14322	68.082	3	3341.442	3341.4420	K	V	184	216
PSM	AAGSPSSSDQDEKLPGQDESTAGTSEQNDILK	180	sp|Q9Y520-3|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,13-UNIMOD:188,32-UNIMOD:188	ms_run[2]:scan=14332	68.127	3	3353.4823	3353.4823	K	V	184	216
PSM	AAPEASSPPASPLQHLLPGK	181	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=21053	100.04	2	2133.0004	2133.0004	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	182	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=21668	103.24	2	2133.0004	2133.0004	K	A	673	693
PSM	AAVLSDSEDEEKASAK	183	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5419	25.876	2	1740.7858	1740.7858	K	K	394	410
PSM	AAVLSDSEDEEKASAK	184	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6988	33.452	2	1740.7858	1740.7858	K	K	394	410
PSM	AEDNADTLALVFEAPNQEK	185	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=24408	117.75	2	2073.9855	2073.9855	R	V	92	111
PSM	AEQINQAAGEASAVLAK	186	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=16924	80.281	2	1675.8836	1675.8836	K	A	189	206
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	187	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12894	61.663	3	3173.2435	3173.2435	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	188	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12268	58.398	3	3183.2517	3183.2517	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	189	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12475	59.403	3	3183.2517	3183.2517	R	-	738	768
PSM	AGLESGAEPGDGDSDTTK	190	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=4896	23.525	2	1711.748	1711.7480	K	K	481	499
PSM	AQEAPGQAEPPAAAEVQGAGNENEPR	191	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10915	51.846	3	2587.1899	2587.1899	R	E	113	139
PSM	DPDAQPGGELMLGGTDSK	192	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=14378	68.336	2	1792.8245	1792.8245	R	Y	236	254
PSM	EAGVEMGDEDDLSTPNEK	193	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=11964	57.112	2	1940.8253	1940.8253	R	L	257	275
PSM	EAPETDTSPSLWDVEFAK	194	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=24293	117.1	2	2026.9467	2026.9467	K	Q	267	285
PSM	EVIEIEDASPTKCPITTK	195	sp|P46100-2|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=15475	73.334	2	2109.9905	2109.9905	R	L	1315	1333
PSM	GAGDGSDEEVDGKADGAEAKPAE	196	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=4336	21.037	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	197	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=4355	21.128	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	198	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=5273	25.229	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	199	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5157	24.659	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	200	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5375	25.67	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GALVVEDNDSGVPVEETK	201	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=13526	64.596	2	1862.9205	1862.9205	R	K	14	32
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	202	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,15-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=15500	73.443	3	2842.2398	2842.2398	K	Q	609	638
PSM	GSRPASPAAKLPASPSGSEDLSSVSSSPTSSPK	203	sp|Q9P2N6-8|KANL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=13350	63.817	3	3365.4467	3365.4467	R	T	423	456
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	204	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=16985	80.56	3	3011.3427	3011.3427	R	D	374	402
PSM	IACDEEFSDSEDEGEGGRR	205	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9010	42.918	2	2336.8045	2336.8045	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	206	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=9415	44.812	2	2336.8045	2336.8045	R	N	385	404
PSM	IDHLSSSAPGSPPDLLESVPK	207	sp|Q5TC82-2|RC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22970	110.13	2	2305.028	2305.0280	K	S	525	546
PSM	KSAEPSANTTLVSETEEEGSVPAFGAAAK	208	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,13-UNIMOD:21,15-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=18623	88.453	3	3049.3609	3049.3609	R	P	159	188
PSM	KVVEAVNSDSDSEFGIPK	209	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=18263	86.809	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	210	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=18515	87.983	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LASGEDDPFDSDFSCPVK	211	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:4	ms_run[2]:scan=20453	97.075	2	1984.836	1984.8360	K	L	377	395
PSM	LEDTENWLYEDGEDQPK	212	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18880	89.592	2	2079.8909	2079.8909	K	Q	652	669
PSM	LQDLDTDYGSGYPNDPK	213	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13341	63.782	2	1896.8378	1896.8378	K	T	199	216
PSM	LSVPTSDEEDEVPAPKPR	214	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13482	64.414	2	2124.9018	2124.9018	K	G	104	122
PSM	NGLAEGTEQEEEEEDEQVR	215	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10691	50.739	2	2189.9196	2189.9196	R	L	130	149
PSM	QFYDQALQQAVVDDDANNAK	216	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:188	ms_run[2]:scan=20062	95.144	2	2258.0547	2258.0547	K	A	125	145
PSM	RAYLPDGYENENQLLNSQDC	217	sp|Q9UFW8|CGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=19278	91.429	2	2478.0159	2478.0159	R	-	148	168
PSM	RGGGSGGGEESEGEEVDED	218	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=2783	14.029	2	1930.6702	1930.6702	R	-	294	313
PSM	SASPDDDLGSSNWEAADLGNEER	219	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18771	89.143	3	2434.0157	2434.0157	R	K	15	38
PSM	SASPDDDLGSSNWEAADLGNEER	220	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18801	89.256	2	2434.0157	2434.0157	R	K	15	38
PSM	SLDSDESEDEEDDYQQK	221	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=7112	34.05	2	2036.7914	2036.7914	K	R	57	74
PSM	SLEEEGQELPQSADVQR	222	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12813	61.25	2	1913.8967	1913.8967	R	W	934	951
PSM	SQSSDTEQQSPTSGGGK	223	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=727	5.3557	2	1685.7436	1685.7436	R	V	456	473
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	224	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=20460	97.108	3	2692.1753	2692.1753	R	L	42	66
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	225	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=20521	97.419	2	2704.2155	2704.2155	R	L	42	66
PSM	SSTPSHGQTTATEPTPAQK	226	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=1822	9.7211	2	2004.879	2004.8790	R	T	153	172
PSM	SVLDQDDVDTSMEESLK	227	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19351	91.754	2	1909.8463	1909.8463	K	H	755	772
PSM	TASESISNLSEAGSIKKGER	228	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=10677	50.676	2	2302.9485	2302.9485	K	E	191	211
PSM	TESPATAAETASEELDNR	229	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=17719	84.269	2	1900.8526	1900.8526	R	S	39	57
PSM	TGSESPKVCSDQSSGSGTGK	230	sp|O15169-2|AXIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:188,9-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=1195	7.1535	2	2046.8604	2046.8604	R	G	213	233
PSM	TNSPAYSDISDAGEDGEGKVDSVK	231	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=14028	66.77	3	2520.0541	2520.0541	K	S	840	864
PSM	TTTTNTQVEGDDEAAFLER	232	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16108	76.397	2	2096.9498	2096.9498	K	L	75	94
PSM	TYVDPHTYEDPNQAVLK	233	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=13571	64.774	2	2074.9344	2074.9344	K	F	587	604
PSM	TYVGVVDGENELASPK	234	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15396	72.951	2	1676.8257	1676.8257	R	L	206	222
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	235	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12221	58.215	3	2831.1125	2831.1125	R	T	60	86
PSM	VAESAQSPAAAHTTDTAGYNAMEESVSR	236	sp|P38398-6|BRCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=13930	66.352	3	2940.2472	2940.2472	K	E	503	531
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	237	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,9-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=14168	67.391	3	2835.285	2835.2850	K	A	248	274
PSM	VTPDIEESLLEPENEK	238	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:188	ms_run[2]:scan=21059	100.08	2	1846.9143	1846.9143	K	I	200	216
PSM	YYSPCEEHPAETNQNEGAESGTIR	239	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10120	48.086	3	2818.1178	2818.1178	R	Q	182	206
PSM	ADHSFSDGVPSDSVEAAKNASNTEK	240	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=14635	69.49427	3	2684.1282	2684.1234	M	L	2	27
PSM	NQSPTEAEKPASSSLPSSPPPQLLTR	241	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21,9-UNIMOD:188,26-UNIMOD:267	ms_run[1]:scan=18228	86.63374833333333	3	2815.372968	2814.377167	K	N	33	59
PSM	LSEGSQPAEEEEDQETPSR	242	sp|Q9UKV3|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=6907	33.10475833333333	2	2117.896884	2116.903266	K	N	239	258
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	243	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	7-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=13058	62.48934666666667	3	3928.659014	3927.670193	R	Q	329	367
PSM	LVQDVANNTNEEAGDGTTTATVLAR	244	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	25-UNIMOD:267	ms_run[1]:scan=14377	68.33358166666666	3	2570.237519	2569.249522	K	S	97	122
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	245	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[1]:scan=21165	100.57743666666667	3	2705.219663	2704.215539	R	L	42	66
PSM	AQAVSEEEEEEEGKSSSPK	246	sp|Q9GZR7|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	5-UNIMOD:21,14-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=5793	27.608701666666665	2	2141.908714	2140.908792	K	K	78	97
PSM	AAPEASSPPASPLQHLLPGK	247	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=21456	102.13	2	2133.0004	2133.0004	K	A	673	693
PSM	AGEAAELQDAEVESSAK	248	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=11114	52.848	2	1709.8051	1709.8051	K	S	637	654
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	249	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12520	59.647	3	3173.2435	3173.2435	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	250	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=11989	57.231	3	3183.2517	3183.2517	R	-	738	768
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	251	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,21-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=20038	95.038	3	3664.6141	3664.6141	R	A	360	392
PSM	AQAVSEEEEEEEGKSSSPK	252	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=5334	25.488	2	2128.8685	2128.8685	K	K	78	97
PSM	ASLGSLEGEAEAEASSPK	253	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=18589	88.299	2	1737.8364	1737.8364	K	G	5748	5766
PSM	DADADAGGGADGGDGR	254	sp|Q14657|LAGE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=769	5.5336	2	1385.5319	1385.5319	R	G	3	19
PSM	DASDDLDDLNFFNQK	255	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=26577	131	2	1761.7789	1761.7789	K	K	65	80
PSM	DYLDFLDDEEDQGIYQSK	256	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=26667	131.62	2	2197.9635	2197.9635	R	V	18	36
PSM	ELGGLEGDPSPEEDEGIQK	257	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13650	65.114	2	1997.9066	1997.9066	K	A	248	267
PSM	ESEITDEDIDGILER	258	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:267	ms_run[2]:scan=22144	105.7	2	1742.8086	1742.8086	K	G	666	681
PSM	FSKEEPVSSGPEEAVGK	259	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10256	48.734	2	1935.7904	1935.7904	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	260	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10483	49.759	2	1935.7904	1935.7904	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	261	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=4614	22.276	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	262	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=18481	87.805	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	263	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=17013	80.704	3	2749.1537	2749.1537	K	S	61	87
PSM	IACDEEFSDSEDEGEGGRR	264	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=8645	41.16	2	2336.8045	2336.8045	R	N	385	404
PSM	IEDLSQQAQLAAAEK	265	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13495	64.471	2	1613.8261	1613.8261	K	F	128	143
PSM	KQETAAVCGETDEEAGESGGEGIFR	266	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14818	70.362	3	2786.078	2786.0780	K	E	1551	1576
PSM	LSSEDEEEDEAEDDQSEASGKK	267	sp|Q8NEJ9-2|NGDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,21-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=6773	32.446	2	2517.9794	2517.9794	K	S	141	163
PSM	NGLAEGTEQEEEEEDEQVR	268	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=10674	50.668	3	2199.9279	2199.9279	R	L	130	149
PSM	NPDDITQEEYGEFYK	269	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=17790	84.574	2	1852.8099	1852.8099	R	S	292	307
PSM	QLQQAQAAGAEQEVEK	270	sp|P39748-2|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8052	38.386	2	1726.8486	1726.8486	K	F	46	62
PSM	QNLYDLDEDDDGIASVPTK	271	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19703	93.423	2	2106.9593	2106.9593	K	Q	179	198
PSM	QSGEAFVELGSEDDVK	272	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=16518	78.37	2	1714.7993	1714.7993	R	M	53	69
PSM	SAEIDSDDTGGSAAQK	273	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2084	10.896	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	274	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2316	11.911	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	275	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=2080	10.877	2	1556.6898	1556.6898	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	276	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=2309	11.882	2	1556.6898	1556.6898	K	Q	814	830
PSM	SELSQDAEPAGSQETKDSGSQEVLSELR	277	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=18672	88.68	3	3056.3459	3056.3459	R	V	266	294
PSM	SETAPAETATPAPVEKSPAK	278	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=6893	33.043	2	2060.9667	2060.9667	M	K	2	22
PSM	SIEGTADDEEEGVSPDTAIR	279	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13486	64.431	2	2089.9288	2089.9288	K	S	638	658
PSM	SKDYDVYSDNDICSQESEDNFAK	280	sp|Q8N5P1|ZC3H8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,2-UNIMOD:188,13-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=16063	76.191	3	2820.1148	2820.1148	R	E	70	93
PSM	SLDGALYDDEDDDDIER	281	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16244	77.058	2	1954.7916	1954.7916	K	A	514	531
PSM	SQSSDTEQQSPTSGGGK	282	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=735	5.3853	2	1679.7235	1679.7235	R	V	456	473
PSM	SSGGKGGSCSQAACSNSAQGSDESLITCKA	283	sp|P10321|HLAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:188,9-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:21,24-UNIMOD:21,28-UNIMOD:4,29-UNIMOD:188	ms_run[2]:scan=9431	44.884	3	3133.2228	3133.2228	K	-	337	367
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	284	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=21319	101.38	3	2692.1753	2692.1753	R	L	42	66
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	285	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=19277	91.426	3	2704.2155	2704.2155	R	L	42	66
PSM	SSSPAELDLKDDLQQTQGK	286	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=16269	77.17	2	2138.9733	2138.9733	R	C	819	838
PSM	SSSPAPADIAQTVQEDLR	287	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=24790	119.94	2	1973.8971	1973.8971	K	T	230	248
PSM	SYEDLTESEDGAASGDSHK	288	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=9044	43.057	2	2076.7797	2076.7797	R	E	56	75
PSM	TCDSITPSKSSPVPVSDTQK	289	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,9-UNIMOD:188,10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=8557	40.645	2	2225.0326	2225.0326	R	L	190	210
PSM	TSEIEPKNSPEDLGLSLTGDSCK	290	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=18960	89.99	3	2568.1705	2568.1705	K	L	492	515
PSM	TTDEGAKNNEESPTATVAEQGEDITSK	291	sp|Q13451-2|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=12506	59.577	3	2901.2401	2901.2401	M	K	2	29
PSM	TVQTAAANAASTAASSAAQNAFK	292	sp|O15126|SCAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:188	ms_run[2]:scan=20885	99.229	3	2157.0758	2157.0758	K	G	312	335
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	293	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,3-UNIMOD:21	ms_run[2]:scan=16051	76.139	3	2894.3576	2894.3576	K	H	557	585
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	294	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=16264	77.147	3	2894.3576	2894.3576	K	H	557	585
PSM	VAAAAGSGPSPPGSPGHDR	295	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4517	21.847	2	1846.7401	1846.7401	R	E	38	57
PSM	VQTDAFVSNELDDPDDLQCK	296	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:4	ms_run[2]:scan=19937	94.55	2	2308.0165	2308.0165	R	R	446	466
PSM	YYSPCEEHPAETNQNEGSESGTIR	297	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=9617	45.762	3	2844.121	2844.1210	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	298	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9621	45.778	3	2834.1127	2834.1127	R	Q	182	206
PSM	ETAPAETATPAPVEKSPAK	299	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	16-UNIMOD:21	ms_run[1]:scan=6156	29.224151666666668	2	1973.9396	1973.9342	S	K	3	22
PSM	TEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQAR	300	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=17055	80.91062666666667	4	4617.001971	4616.985787	R	D	68	114
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	301	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21	ms_run[1]:scan=21633	103.06414333333333	3	2693.176071	2692.175281	R	L	42	66
PSM	SGEENPASKPTPVQDVQGDGR	302	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1	ms_run[1]:scan=9324	44.35672833333333	2	2209.0288	2209.0242	M	W	2	23
PSM	SPQKSTVLTNGEAAMQSSNSESK	303	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21	ms_run[1]:scan=9777	46.481903333333335	3	2461.069934	2460.083964	K	K	86	109
PSM	SPQKSTVLTNGEAAMQSSNSESK	304	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21,4-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=13897	66.21864166666666	3	2473.111754	2472.124222	K	K	86	109
PSM	YYSPCEEHPAETNQNEGSESGTIR	305	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[1]:scan=10179	48.36736166666667	3	2845.110476	2844.120967	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	306	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=9950	47.29399333333333	3	2835.101184	2834.112698	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	307	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=10240	48.66245833333333	3	2835.099660	2834.112698	R	Q	182	206
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	308	sp|Q9ULU4|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=19571	92.78486666666666	3	2629.274863	2628.264024	K	T	481	506
PSM	SAEIDSDDTGGSAAQK	309	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=2659	13.457154999999998	2	1551.660103	1550.669624	K	Q	814	830
PSM	AAEEAFVNDIDESSPGTEWER	310	sp|P09496-5|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:267	ms_run[2]:scan=22534	107.81	3	2361.0272	2361.0272	R	V	111	132
PSM	AAESPDQKDTDGGPKEEESPV	311	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=6278	29.866	2	2264.9322	2264.9322	K	-	480	501
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	312	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=12608	60.163	3	3090.3373	3090.3373	R	V	1094	1125
PSM	AAPEASSPPASPLQHLLPGK	313	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=21754	103.66	2	2126.9803	2126.9803	K	A	673	693
PSM	AEDGSVIDYELIDQDAR	314	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=20982	99.705	2	1917.8831	1917.8831	R	D	198	215
PSM	AIEQADLLQEEDESPR	315	sp|P61966|AP1S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=15157	71.857	2	1851.8726	1851.8726	K	S	134	150
PSM	AISEDSGCDSVTDTEPEDEKVVSYSK	316	sp|Q6ZUJ8|BCAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,10-UNIMOD:21,20-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=13242	63.358	3	2938.2353	2938.2353	K	Q	140	166
PSM	ALQEGQPEEDETDDR	317	sp|Q96BZ8|LENG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267	ms_run[2]:scan=5096	24.377	2	1740.7314	1740.7314	R	R	225	240
PSM	ASVDSGSSEEQGGSSR	318	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=873	5.9288	2	1538.6445	1538.6445	R	A	623	639
PSM	CSASSCLDTSNDPDDLDVLR	319	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=18872	89.566	3	2238.9369	2238.9369	K	T	1436	1456
PSM	DTSFLGSDDIGNIDVR	320	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=22820	109.35	2	1732.8143	1732.8143	K	E	397	413
PSM	EAAVSASDILQESAIHSPGTVEK	321	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=19894	94.349	2	2418.1316	2418.1316	R	E	163	186
PSM	EAGVEMGDEDDLSTPNEK	322	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11974	57.162	2	1934.8051	1934.8051	R	L	257	275
PSM	FLQKSPEQSPPAINANTLQQER	323	sp|Q7Z3F1|GP155_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=16777	79.632	3	2655.2095	2655.2095	R	Y	833	855
PSM	FSKEEPVSSGPEEAVGK	324	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10045	47.725	2	1935.7904	1935.7904	K	S	562	579
PSM	GDVVNQDDLYQALASGK	325	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21742	103.61	2	1791.8639	1791.8639	R	I	246	263
PSM	GPPASSPAPAPKFSPVTPK	326	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13240	63.347	2	2003.9562	2003.9562	R	F	97	116
PSM	GTELDDGIQADSGPINDTDANPR	327	sp|P55210-4|CASP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15007	71.214	3	2370.0571	2370.0571	R	Y	163	186
PSM	GWGQQDGPGPPSPGQSPSPCR	328	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=12069	57.566	3	2227.9106	2227.9106	R	T	1268	1289
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	329	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=17037	80.825	3	3021.351	3021.3510	R	D	374	402
PSM	ILQEKLDQPVSAPPSPR	330	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13585	64.84	2	2033.9588	2033.9588	R	D	230	247
PSM	IPGGNIYISPLKSPYK	331	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,12-UNIMOD:188,13-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=20962	99.606	2	1917.9445	1917.9445	R	I	799	815
PSM	IPSFFPSPEEPPSPSAPSIAK	332	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=25187	122.31	2	2261.0657	2261.0657	R	S	2677	2698
PSM	KAEDSDSEPEPEDNVR	333	sp|Q9H0D6-2|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4490	21.725	2	1975.7085	1975.7085	R	L	419	435
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	334	sp|P13051-2|UNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13647	65.101	3	2621.1412	2621.1412	K	I	41	65
PSM	LQIGPPSPGEAQGPLLPSPAR	335	sp|Q9HCH0-2|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:21	ms_run[2]:scan=21986	104.91	3	2161.0933	2161.0933	K	G	430	451
PSM	LRTNLQPLESTQSQDF	336	sp|Q9Y248|PSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,13-UNIMOD:21	ms_run[2]:scan=19495	92.444	2	1965.9073	1965.9073	K	-	170	186
PSM	LSEGSQPAEEEEDQETPSR	337	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=6459	30.869	2	2116.9033	2116.9033	K	N	239	258
PSM	NPDDITNEEYGEFYK	338	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=17323	82.229	2	1838.7942	1838.7942	R	S	300	315
PSM	NPDDITQEEYGEFYK	339	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17981	85.488	2	1846.7897	1846.7897	R	S	292	307
PSM	QDVDDEYGVSQALAR	340	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15038	71.354	2	1664.7642	1664.7642	K	G	712	727
PSM	QGAIVAVTGDGVNDSPALK	341	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:188	ms_run[2]:scan=15707	74.49	2	1816.9626	1816.9626	R	K	677	696
PSM	QLQQAQAAGAEQEVEK	342	sp|P39748-2|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=8045	38.353	2	1732.8687	1732.8687	K	F	46	62
PSM	QQLSAEELDAQLDAYNAR	343	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21096	100.25	2	2033.9654	2033.9654	K	M	236	254
PSM	QSGEAFVELGSEDDVK	344	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16524	78.403	2	1708.7792	1708.7792	R	M	53	69
PSM	RAYLPDGYENENQLLNSQDC	345	sp|Q9UFW8|CGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,17-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=19257	91.336	2	2488.0242	2488.0242	R	-	148	168
PSM	RPPSPDVIVLSDNEQPSSPR	346	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,4-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=15374	72.854	2	2369.0569	2369.0569	R	V	97	117
PSM	SASPDDDLGSSNWEAADLGNEER	347	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	23-UNIMOD:267	ms_run[2]:scan=18779	89.175	3	2444.0239	2444.0239	R	K	15	38
PSM	SCSEEKIPEDGSLNTTK	348	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,2-UNIMOD:4,6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9418	44.826	2	1985.8692	1985.8692	R	-	551	568
PSM	SDATADDLIDVVEGNR	349	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=24018	115.67	2	1698.7936	1698.7936	R	V	223	239
PSM	SETAPAETATPAPVEKSPAK	350	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=6486	31.022	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	351	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=31052	162.35	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	352	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6316	30.078	2	2073.007	2073.0070	M	K	2	22
PSM	SGEEDFESLASQFSDCSSAK	353	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=24165	116.44	2	2185.9053	2185.9053	K	A	98	118
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	354	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7991	38.108	3	2345.0004	2345.0004	K	E	173	198
PSM	SIDGTADDEDEGVPTDQAIR	355	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12435	59.209	2	2102.924	2102.9240	K	A	628	648
PSM	SKQLQQSPTPTCPTPELGSPLPSR	356	sp|Q8IWY9|CDAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,12-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=14947	70.935	3	2765.2497	2765.2497	R	T	259	283
PSM	SQEGENEEGSEGELVVK	357	sp|Q92835-3|SHIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8991	42.844	2	1818.8119	1818.8119	K	F	550	567
PSM	SQIRSRTPSASNDDQQE	358	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:267,5-UNIMOD:21,6-UNIMOD:267,9-UNIMOD:21	ms_run[2]:scan=2426	12.384	2	2097.8269	2097.8269	R	-	297	314
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	359	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=19868	94.221	3	2704.2155	2704.2155	R	L	42	66
PSM	STETSDFENIESPLNER	360	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=19416	92.064	2	1976.8839	1976.8839	K	D	811	828
PSM	STPESGDSDKESVGSSSTSNEGGR	361	sp|Q6GQQ9-2|OTU7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=1949	10.289	2	2435.9562	2435.9562	R	R	460	484
PSM	SVGDGETVEFDVVEGEK	362	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18192	86.485	2	1794.816	1794.8160	R	G	134	151
PSM	SVPVTVDDDDDDNDPENR	363	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8700	41.483	2	2015.8192	2015.8192	K	I	1049	1067
PSM	TDASSASSFLDSDELER	364	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19017	90.232	2	1828.7963	1828.7963	R	T	308	325
PSM	TEESPASDEAGEKEAKSD	365	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:188,16-UNIMOD:188,17-UNIMOD:21	ms_run[2]:scan=1576	8.6937	2	1970.8033	1970.8033	K	-	83	101
PSM	TFQEDSSPVVHQSLQEVSEPLTATK	366	sp|Q15678|PTN14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=18860	89.517	2	2836.3168	2836.3168	K	H	608	633
PSM	TGIEQGSDAGYLCESQK	367	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=11298	53.993	2	1847.8303	1847.8303	K	F	310	327
PSM	TIQNLYDLDEDDDGIASVPTK	368	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:188	ms_run[2]:scan=22424	107.21	2	2327.1112	2327.1112	K	Q	148	169
PSM	TTKTPEDGDYSYEIIEK	369	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=14705	69.806	2	2067.8926	2067.8926	K	T	1929	1946
PSM	TVDFTQDSNYLLTGGQDK	370	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=21659	103.19	2	2006.9528	2006.9528	K	L	105	123
PSM	TYVGVVDGENELASPK	371	sp|P09327|VILI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=15425	73.079	2	1682.8459	1682.8459	R	L	206	222
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	372	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	26-UNIMOD:267	ms_run[2]:scan=12211	58.178	3	2841.1208	2841.1208	R	T	60	86
PSM	VDGETASDSESRAESAPLPVSADDTPEVLNR	373	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=19256	91.333	3	3293.4573	3293.4573	K	A	27	58
PSM	VDIDTPDINIEGSEGK	374	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=17772	84.502	2	1706.8306	1706.8306	K	F	3712	3728
PSM	VEEEQEADEEDVSEEEAESKEGTNK	375	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=8799	41.968	3	2918.135	2918.1350	K	D	235	260
PSM	VSDESLSKVQEAESPVFK	376	sp|Q08357|S20A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,8-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=17197	81.556	2	2069.9961	2069.9961	R	E	255	273
PSM	VSIRLPSTSGSEGVPFR	377	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:267,7-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=22314	106.61	2	1967.9022	1967.9022	R	T	891	908
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	378	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21,9-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=13724	65.444	3	2835.285	2835.2850	K	A	248	274
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	379	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=13959	66.469	3	2823.2448	2823.2448	K	A	248	274
PSM	VTLLDGTEYSCDLEK	380	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=19710	93.45	2	1747.8282	1747.8282	K	H	222	237
PSM	VTLLDGTEYSCDLEK	381	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=19720	93.505	2	1741.808	1741.8080	K	H	222	237
PSM	ADHSFSDGVPSDSVEAAK	382	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1	ms_run[1]:scan=12924	61.81153666666667	2	1859.8204	1859.8168	M	N	2	20
PSM	SETAPAETATPAPVEKSPAK	383	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=7097	33.98583166666666	2	2115.0232	2115.0170	M	K	2	22
PSM	ILQEKLDQPVSAPPSPR	384	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=13820	65.88830833333334	2	2034.959272	2033.958824	R	D	230	247
PSM	GADFLVTEVENGGSLGSK	385	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	18-UNIMOD:188	ms_run[1]:scan=20736	98.47436333333333	2	1785.881889	1784.888788	K	K	189	207
PSM	RGGGSGGGEESEGEEVDED	386	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=3085	15.402468333333331	2	1941.689737	1940.678438	R	-	294	313
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	387	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=17757	84.43283666666667	3	2729.147387	2729.137136	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	388	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=17974	85.46203166666666	3	2729.147387	2729.137136	K	S	61	87
PSM	GDVVNQDDLYQALASGK	389	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	17-UNIMOD:188	ms_run[1]:scan=22265	106.36994666666665	2	1798.878122	1797.884037	R	I	246	263
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	390	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:21	ms_run[1]:scan=19427	92.11780666666667	3	2693.172593	2692.175281	R	L	42	66
PSM	SPQKSTVLTNGEAAMQSSNSESK	391	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21	ms_run[1]:scan=11877	56.730646666666665	3	2461.088025	2460.083964	K	K	86	109
PSM	ASGADSKGDDLSTAILK	392	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,7-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=16085	76.28625666666666	2	1701.8857	1701.8818	M	Q	2	19
PSM	SPSGPVKSPPLSPVGTTPVK	393	sp|Q9BVC5|ASHWN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=13595	64.88318666666667	2	2092.017429	2091.005440	K	L	182	202
PSM	IACDEEFSDSEDEGEGGRR	394	sp|Q92769|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=9103	43.32673166666667	2	2317.798180	2316.787932	R	N	415	434
PSM	AADEEAFEDNSEEYIR	395	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=15936	75.618	2	1896.7889	1896.7889	R	R	300	316
PSM	AAPEASSPPASPLQHLLPGK	396	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=21457	102.13	2	2126.9803	2126.9803	K	A	673	693
PSM	AASSSSSSSSSSSSDDSEEEKAAATPK	397	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=3377	16.759	3	2656.0509	2656.0509	K	K	214	241
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	398	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12698	60.654	3	3173.2435	3173.2435	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	399	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12763	60.995	3	3183.2517	3183.2517	R	-	738	768
PSM	AGGEEEDDDDEAAGGR	400	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=1153	7.0015	2	1601.5953	1601.5953	R	C	357	373
PSM	AGGEEEDDDDEAAGGR	401	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1154	7.0039	2	1591.587	1591.5870	R	C	357	373
PSM	AISEDSGCDSVTDTEPEDEKVVSYSK	402	sp|Q6ZUJ8|BCAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=13394	64.019	3	2926.1951	2926.1951	K	Q	140	166
PSM	AQLSSPEDQDDQDDIK	403	sp|Q86US8-3|EST1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8121	38.694	2	1802.7806	1802.7806	K	V	88	104
PSM	AQTPPGPSLSGSKSPCPQEK	404	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7844	37.401	2	2211.9273	2211.9273	K	S	1001	1021
PSM	DGLNDDDFEPYLSPQAR	405	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21807	103.94	2	1950.8595	1950.8595	K	P	27	44
PSM	DTSATTALELVAGER	406	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:267	ms_run[2]:scan=22064	105.32	2	1542.7765	1542.7765	K	L	534	549
PSM	DVDETGITVASLER	407	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17953	85.372	2	1503.7417	1503.7417	R	F	341	355
PSM	DYDDIDDDDPFNPQAWR	408	sp|Q9BSA4|TTYH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=26877	133.09	2	2095.8395	2095.8395	R	M	423	440
PSM	DYPDFSPSVDAEAIQK	409	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19236	91.247	2	1780.8156	1780.8156	R	A	14	30
PSM	EDAGDNDDTEGAIGVR	410	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=7505	35.807	2	1642.6946	1642.6946	R	N	377	393
PSM	ETTDTDTADQVIASFK	411	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=21311	101.33	2	1746.8255	1746.8255	R	V	838	854
PSM	GAGDGSDEEVDGKADGAEAKPAE	412	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4129	20.114	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	413	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4817	23.191	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	414	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=5506	26.258	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	415	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23700	114	3	2431.1719	2431.1719	R	S	258	284
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	416	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23812	114.59	3	2441.1802	2441.1802	R	S	258	284
PSM	GIPLATGDTSPEPELLPGAPLPPPK	417	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=26097	127.79	3	2549.3126	2549.3126	K	E	33	58
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	418	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16866	80.03	3	2729.1371	2729.1371	K	S	61	87
PSM	GTELDDGIQADSGPINDTDANPR	419	sp|P55210-4|CASP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:267	ms_run[2]:scan=15020	71.268	3	2380.0654	2380.0654	R	Y	163	186
PSM	IACDEEFSDSEDEGEGGRR	420	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9778	46.485	2	2316.7879	2316.7879	R	N	385	404
PSM	ILQEKLDQPVSAPPSPR	421	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13117	62.792	2	2033.9588	2033.9588	R	D	230	247
PSM	ISTPQTNTVPIKPLISTPPVSSQPK	422	sp|Q9BTA9-5|WAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=20516	97.398	3	2789.4017	2789.4017	R	V	352	377
PSM	LASGEDDPFDSDFSCPVK	423	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=20245	96.038	2	1990.8562	1990.8562	K	L	377	395
PSM	LASGEDDPFDSDFSCPVK	424	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4	ms_run[2]:scan=20252	96.069	2	1984.836	1984.8360	K	L	377	395
PSM	LASPQPSYAADANDSKAEYSDVLAK	425	sp|Q5TGY3|AHDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=17106	81.14	3	2690.2113	2690.2113	K	L	594	619
PSM	LDVKSIDDEDVDENEDDVYGNSSGR	426	sp|Q8IUI4|S29P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=16919	80.262	3	2864.1509	2864.1509	K	K	187	212
PSM	LEAIEDDSVKETDSSSASAATPSK	427	sp|P54578-2|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=10315	48.99	3	2517.1007	2517.1007	K	K	180	204
PSM	LEDTENWLYEDGEDQPK	428	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=18869	89.551	2	2085.911	2085.9110	K	Q	652	669
PSM	LGSTAPQVLSTSSPAQQAENEAK	429	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:188	ms_run[2]:scan=14566	69.173	3	2319.165	2319.1650	K	A	149	172
PSM	LKSSTSFANIQENSN	430	sp|Q86WC4|OSTM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=11383	54.349	2	1718.7513	1718.7513	R	-	320	335
PSM	LQDLDTDYGSGYPNDPK	431	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=13335	63.752	2	1902.8579	1902.8579	K	T	199	216
PSM	LSVPTSDEEDEVPAPKPR	432	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13719	65.421	2	2124.9018	2124.9018	K	G	104	122
PSM	MDSDEDEKEGEEEK	433	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=1237	7.3102	2	1748.5972	1748.5972	K	V	375	389
PSM	NEDITEPQSILAAAEK	434	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21131	100.41	2	1727.8578	1727.8578	R	A	86	102
PSM	NEDITEPQSILAAAEK	435	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=21134	100.43	2	1733.8779	1733.8779	R	A	86	102
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	436	sp|Q9C0E8-3|LNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=14743	69.98	3	2539.2472	2539.2472	R	D	52	77
PSM	NSYVAGQYDDAASYQR	437	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11382	54.346	2	1806.7809	1806.7809	R	L	105	121
PSM	PAEATSSPTSPERPR	438	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=1745	9.3653	2	1741.7074	1741.7074	R	H	211	226
PSM	QTSNRSEPSGEINIDSSGETVGSGER	439	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=12049	57.483	3	2772.1836	2772.1836	R	C	515	541
PSM	RNSSSPVSPASVPGQR	440	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6598	31.621	2	1804.7773	1804.7773	R	R	655	671
PSM	SCSEEKIPEDGSLNTTK	441	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=9607	45.727	2	1973.8289	1973.8289	R	-	551	568
PSM	SEAPETPMEEEAELVLTEK	442	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=27189	135.26	2	2130.9878	2130.9878	K	S	72	91
PSM	SETAPAETATPAPVEKSPAK	443	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=30290	157.14	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	444	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=30447	158.18	2	2060.9667	2060.9667	M	K	2	22
PSM	SGDEEFKGEDELCDSGR	445	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11891	56.78	2	2008.7357	2008.7357	R	Q	339	356
PSM	SGSANSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPR	446	sp|Q86YD5-2|LRAD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=18704	88.829	3	3760.645	3760.6450	R	D	248	286
PSM	SLDDDLDGVPLDATEDSK	447	sp|O15042-3|SR140_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=19509	92.502	2	1909.8736	1909.8736	K	K	322	340
PSM	SRSGSIVELIAGGGSSCSPVLSR	448	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,3-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=23114	110.89	3	2455.1082	2455.1082	R	K	415	438
PSM	SSGDPEQIKEDSLSEESADAR	449	sp|Q9BVS4-2|RIOK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=10350	49.141	2	2328.9595	2328.9595	R	S	369	390
PSM	SSVKTPETVVPTAPELQASASTDQPVTSEPTSR	450	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=18254	86.762	3	3476.656	3476.6560	R	T	1217	1250
PSM	SSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATR	451	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=18132	86.175	3	3842.8463	3842.8463	R	G	1176	1212
PSM	STNCFGDNDPIDVCEIGSK	452	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=19092	90.564	2	2132.9086	2132.9086	K	I	158	177
PSM	STPESGDSDKESVGSSSTSNEGGR	453	sp|Q6GQQ9-2|OTU7B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=1861	9.9074	3	2435.9562	2435.9562	R	R	460	484
PSM	SVEDDEEGHLICQSGDVLSAR	454	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=19214	91.143	2	2394.9999	2394.9999	R	Y	140	161
PSM	SWLSPRVSPPASPGP	455	sp|Q9Y4U1|MMAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:267,8-UNIMOD:21	ms_run[2]:scan=20176	95.725	2	1623.7686	1623.7686	R	-	268	283
PSM	SYEDLTESEDGAASGDSHK	456	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=9034	43.018	2	2082.7998	2082.7998	R	E	56	75
PSM	TGSESPKVCSDQSSGSGTGK	457	sp|O15169-2|AXIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1132	6.9229	2	2034.8201	2034.8201	R	G	213	233
PSM	TKDQPDGSSLSPAQSPSQSQPPAASSLR	458	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11024	52.375	3	2983.2962	2983.2962	R	E	210	238
PSM	TLSSPSLQTDGIAATPVPPPPPPK	459	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=19983	94.779	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TSSAETPTIPLGSAVEAIK	460	sp|Q16891-3|MIC60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=22666	108.53	2	1870.9888	1870.9888	K	A	550	569
PSM	TSSAFVGKTPEASPEPK	461	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=8495	40.361	2	1891.8006	1891.8006	K	D	303	320
PSM	TSSKESSPIPSPTSDRK	462	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3899	19.032	2	2042.8	2042.8000	R	A	2159	2176
PSM	TSSKESSPIPSPTSDRK	463	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4116	20.053	2	2042.8	2042.8000	R	A	2159	2176
PSM	TSVQTEDDQLIAGQSAR	464	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=11398	54.406	2	1827.8838	1827.8838	R	A	284	301
PSM	TYADYESVNECMEGVCK	465	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=16299	77.312	3	2053.8067	2053.8067	R	M	18	35
PSM	VLGSEGEEEDEALSPAK	466	sp|P18858-2|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11724	56.032	2	1758.816	1758.8160	R	G	63	80
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	467	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=11344	54.184	3	2835.1244	2835.1244	K	A	213	238
PSM	VPPVPTSPSPASPSPITAGSFR	468	sp|Q504T8|MIDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=19579	92.822	3	2238.0961	2238.0961	R	S	201	223
PSM	VQGSDSDEEVVVATTR	469	sp|P26640-2|SYVC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=10291	48.884	2	1700.8092	1700.8092	K	I	227	243
PSM	VSESEGKLEGQATAVTPNK	470	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=10692	50.741	2	2023.9463	2023.9463	K	N	12	31
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	471	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=14201	67.536	3	2823.2448	2823.2448	K	A	248	274
PSM	VSSPLSPLSPGIKSPTIPR	472	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=21954	104.72	2	2092.0371	2092.0371	K	A	555	574
PSM	VVSEDFLQDVSASTK	473	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188	ms_run[2]:scan=21085	100.2	2	1629.8193	1629.8193	R	S	453	468
PSM	YSGAYGASVSDEELK	474	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11962	57.106	2	1574.71	1574.7100	R	R	49	64
PSM	QTQSESSNYDSELEKEIK	475	sp|P46100-2|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,11-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=18325	87.0658	2	2188.9488	2188.9447	R	S	605	623
PSM	SETAPAETATPAPVEKSPAK	476	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	17-UNIMOD:21	ms_run[1]:scan=30133	156.08972166666666	2	2060.9720	2060.9662	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	477	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=8441	40.10202833333333	2	2023.0152	2023.0104	M	K	2	22
PSM	PSPSESPEPWKPFPAVSPEPR	478	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=22091	105.46252833333334	3	2477.083596	2477.070560	K	R	281	302
PSM	QTIDNSQGAYQEAFDISKK	479	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,18-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=19507	92.49467	2	2137.0453	2137.0361	K	E	140	159
PSM	LVQDVANNTNEEAGDGTTTATVLAR	480	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	25-UNIMOD:267	ms_run[1]:scan=14540	69.06552666666667	3	2570.256693	2569.249522	K	S	97	122
PSM	GADFLVTEVENGGSLGSK	481	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=20744	98.50771	2	1779.861896	1778.868659	K	K	189	207
PSM	VFLQGPAPVGTPSFNR	482	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[1]:scan=20601	97.84165833333334	2	1776.876147	1775.863540	R	Q	2313	2329
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	483	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=18194	86.49728166666667	3	2729.147387	2729.137136	K	S	61	87
PSM	SGEENPASKPTPVQDVQGDGR	484	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,9-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9297	44.22244333333334	3	2225.0581	2225.0526	M	W	2	23
PSM	QASTDAGTAGALTPQHVR	485	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,3-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=11314	54.062675	2	1852.8348	1852.8339	R	A	107	125
PSM	SAEIDSDDTGGSAAQK	486	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	16-UNIMOD:188	ms_run[1]:scan=2669	13.505320000000001	2	1557.679462	1556.689753	K	Q	814	830