MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL05.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL05.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null	199-UNIMOD:21	0.06	58.0	1	1	1
PRT	sp|Q96HP0|DOCK6_HUMAN	Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	882-UNIMOD:21	0.01	51.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	5747-UNIMOD:188,5749-UNIMOD:21,5765-UNIMOD:188,5739-UNIMOD:21,5740-UNIMOD:188,5744-UNIMOD:188,5181-UNIMOD:188,45-UNIMOD:267,5737-UNIMOD:21,1833-UNIMOD:4,5731-UNIMOD:21,679-UNIMOD:188	0.02	51.0	9	6	5
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	47-UNIMOD:21,48-UNIMOD:267,71-UNIMOD:188	0.20	50.0	2	1	0
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	36-UNIMOD:21,34-UNIMOD:188,53-UNIMOD:188	0.10	50.0	2	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	269-UNIMOD:21,240-UNIMOD:21,490-UNIMOD:21,494-UNIMOD:188,506-UNIMOD:188	0.05	50.0	5	3	2
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	106-UNIMOD:267	0.04	50.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	113-UNIMOD:188,168-UNIMOD:4,179-UNIMOD:188	0.21	49.0	4	2	1
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	125-UNIMOD:188	0.05	49.0	1	1	1
PRT	sp|Q8NEY1-7|NAV1_HUMAN	Isoform 7 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	199-UNIMOD:21,198-UNIMOD:188,207-UNIMOD:188	0.01	48.0	2	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	134-UNIMOD:267	0.07	48.0	2	1	0
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	819-UNIMOD:21	0.02	48.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	847-UNIMOD:21,846-UNIMOD:21,861-UNIMOD:267	0.03	48.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	17-UNIMOD:188,18-UNIMOD:21,21-UNIMOD:188,2-UNIMOD:1,11-UNIMOD:21	0.10	48.0	7	2	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1517-UNIMOD:21,1519-UNIMOD:21	0.01	47.0	2	1	0
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	158-UNIMOD:188	0.02	47.0	2	1	0
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	82-UNIMOD:21,94-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188	0.02	46.0	4	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	134-UNIMOD:267	0.07	46.0	3	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	64-UNIMOD:188	0.03	46.0	2	1	0
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	324-UNIMOD:21	0.07	46.0	1	1	1
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	62-UNIMOD:21	0.05	46.0	1	1	1
PRT	sp|Q9HAZ1|CLK4_HUMAN	Dual specificity protein kinase CLK4 OS=Homo sapiens OX=9606 GN=CLK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	138-UNIMOD:21,149-UNIMOD:4,156-UNIMOD:267	0.04	46.0	2	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	819-UNIMOD:21,828-UNIMOD:188,837-UNIMOD:188	0.01	46.0	2	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	64-UNIMOD:21,74-UNIMOD:188,62-UNIMOD:21	0.04	46.0	3	1	0
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	191-UNIMOD:4,198-UNIMOD:188,199-UNIMOD:21,209-UNIMOD:188	0.02	46.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1122-UNIMOD:21,1146-UNIMOD:267,1120-UNIMOD:21	0.02	46.0	3	1	0
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	199-UNIMOD:188	0.10	45.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.15	45.0	1	1	0
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	16-UNIMOD:21,35-UNIMOD:188,222-UNIMOD:188,230-UNIMOD:21,240-UNIMOD:188	0.16	45.0	3	2	1
PRT	sp|Q9Y462|ZN711_HUMAN	Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	230-UNIMOD:21,235-UNIMOD:188,245-UNIMOD:188	0.03	45.0	3	1	0
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1340-UNIMOD:21,1343-UNIMOD:188,1349-UNIMOD:188,1372-UNIMOD:21,1369-UNIMOD:21,1376-UNIMOD:188,1385-UNIMOD:188	0.03	45.0	8	2	0
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1153-UNIMOD:21,1488-UNIMOD:21,1235-UNIMOD:21,778-UNIMOD:4,780-UNIMOD:21,1239-UNIMOD:21,1526-UNIMOD:21,1522-UNIMOD:21	0.08	45.0	7	5	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	284-UNIMOD:267,234-UNIMOD:188	0.05	45.0	4	2	1
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	428-UNIMOD:21,440-UNIMOD:4	0.05	45.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	72-UNIMOD:21,87-UNIMOD:267,74-UNIMOD:21	0.01	45.0	3	1	0
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	579-UNIMOD:21,585-UNIMOD:4,595-UNIMOD:4	0.02	45.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	67-UNIMOD:267	0.11	45.0	1	1	0
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	176-UNIMOD:21,179-UNIMOD:188	0.05	44.0	2	1	0
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	438-UNIMOD:267	0.03	44.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	1943-UNIMOD:21,1698-UNIMOD:28,1703-UNIMOD:267,1716-UNIMOD:188,1950-UNIMOD:188,1957-UNIMOD:188,1751-UNIMOD:267	0.04	44.0	6	4	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.08	44.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	60-UNIMOD:21	0.10	44.0	1	1	1
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	393-UNIMOD:188,395-UNIMOD:21,402-UNIMOD:4,409-UNIMOD:188	0.01	44.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	651-UNIMOD:188,464-UNIMOD:188	0.06	44.0	7	2	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	323-UNIMOD:21,334-UNIMOD:4	0.07	44.0	1	1	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	647-UNIMOD:267	0.04	44.0	3	2	1
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	294-UNIMOD:267,304-UNIMOD:21	0.06	44.0	2	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	117-UNIMOD:21,120-UNIMOD:267,134-UNIMOD:267,119-UNIMOD:21	0.02	44.0	2	1	0
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	295-UNIMOD:21,301-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|Q8N9M5|TM102_HUMAN	Transmembrane protein 102 OS=Homo sapiens OX=9606 GN=TMEM102 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	218-UNIMOD:21	0.05	44.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	770-UNIMOD:4,782-UNIMOD:21	0.01	44.0	2	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	116-UNIMOD:21,118-UNIMOD:21	0.05	44.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	2-UNIMOD:1,12-UNIMOD:21,19-UNIMOD:188,26-UNIMOD:188	0.07	44.0	2	1	0
PRT	sp|Q9UKY7-2|CDV3_HUMAN	Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	30-UNIMOD:21	0.23	43.0	1	1	1
PRT	sp|Q13367-3|AP3B2_HUMAN	Isoform 3 of AP-3 complex subunit beta-2 OS=Homo sapiens OX=9606 GN=AP3B2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	494-UNIMOD:21,498-UNIMOD:188,499-UNIMOD:188,485-UNIMOD:21,497-UNIMOD:21	0.04	43.0	5	1	0
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	768-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q96EV2-2|RBM33_HUMAN	Isoform 2 of RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	205-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=H2AFY2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	171-UNIMOD:21,175-UNIMOD:21	0.07	43.0	2	1	0
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	141-UNIMOD:4,146-UNIMOD:267,17-UNIMOD:4,31-UNIMOD:188	0.20	43.0	4	2	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	206-UNIMOD:188	0.04	43.0	3	1	0
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1053-UNIMOD:21,1059-UNIMOD:4,1071-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|Q9HBD1-6|RC3H2_HUMAN	Isoform 6 of Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	361-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	868-UNIMOD:188,872-UNIMOD:21,883-UNIMOD:188,870-UNIMOD:21,234-UNIMOD:21	0.04	43.0	9	2	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1074-UNIMOD:188	0.01	43.0	3	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	328-UNIMOD:267	0.02	43.0	3	1	0
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	80-UNIMOD:188	0.05	43.0	2	1	0
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	625-UNIMOD:21,637-UNIMOD:4	0.03	43.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1155-UNIMOD:4,1162-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	140-UNIMOD:21,151-UNIMOD:4,160-UNIMOD:267	0.05	43.0	2	1	0
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	14-UNIMOD:21	0.07	43.0	3	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	498-UNIMOD:188,500-UNIMOD:21,513-UNIMOD:4,514-UNIMOD:188	0.01	43.0	5	1	0
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	481-UNIMOD:21,482-UNIMOD:21,486-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	37-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1106-UNIMOD:21,1110-UNIMOD:188,1114-UNIMOD:188	0.01	43.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	665-UNIMOD:21,681-UNIMOD:21	0.04	43.0	2	1	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	145-UNIMOD:28,160-UNIMOD:21,147-UNIMOD:188,151-UNIMOD:188,173-UNIMOD:267,164-UNIMOD:21	0.07	43.0	4	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	679-UNIMOD:21,683-UNIMOD:21,692-UNIMOD:188,678-UNIMOD:21	0.03	42.0	5	1	0
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1148-UNIMOD:21,1157-UNIMOD:188,1161-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	768-UNIMOD:4,774-UNIMOD:21,784-UNIMOD:188,786-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	194-UNIMOD:21,208-UNIMOD:267,197-UNIMOD:21	0.00	42.0	2	1	0
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	917-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	339-UNIMOD:4,351-UNIMOD:4,352-UNIMOD:4	0.05	42.0	1	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1129-UNIMOD:4,1131-UNIMOD:21,1130-UNIMOD:188,1144-UNIMOD:188	0.01	42.0	4	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	110-UNIMOD:4,114-UNIMOD:4,120-UNIMOD:188	0.06	42.0	2	1	0
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	151-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	491-UNIMOD:188,493-UNIMOD:21,507-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	191-UNIMOD:267,179-UNIMOD:21,175-UNIMOD:267	0.08	42.0	4	2	0
PRT	sp|Q9NS73-3|MBIP1_HUMAN	Isoform 3 of MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	91-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	185-UNIMOD:21,190-UNIMOD:188,196-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	17-UNIMOD:21,15-UNIMOD:21	0.14	42.0	3	1	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	151-UNIMOD:21,161-UNIMOD:4,449-UNIMOD:21,454-UNIMOD:188,462-UNIMOD:188	0.03	42.0	3	2	1
PRT	sp|Q9H3Q1-2|BORG4_HUMAN	Isoform 2 of Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	68-UNIMOD:21,71-UNIMOD:21	0.10	42.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	659-UNIMOD:21,674-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	307-UNIMOD:21,309-UNIMOD:21,302-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	247-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|Q96HH9-5|GRM2B_HUMAN	Isoform 5 of GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	110-UNIMOD:4,116-UNIMOD:21,121-UNIMOD:21	0.08	42.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	195-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q16512-3|PKN1_HUMAN	Isoform 3 of Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	561-UNIMOD:21,552-UNIMOD:188,562-UNIMOD:21,565-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	143-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	220-UNIMOD:21,236-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.05	42.0	3	1	0
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	184-UNIMOD:21,186-UNIMOD:4	0.02	42.0	2	1	0
PRT	sp|Q8N5I9|CL045_HUMAN	Uncharacterized protein C12orf45 OS=Homo sapiens OX=9606 GN=C12orf45 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	13-UNIMOD:4,15-UNIMOD:21	0.11	42.0	1	1	1
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	75-UNIMOD:21,80-UNIMOD:188,84-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2839-UNIMOD:4,2848-UNIMOD:4	0.01	41.0	2	2	2
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	907-UNIMOD:267,910-UNIMOD:21,913-UNIMOD:21,922-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	717-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	659-UNIMOD:21,656-UNIMOD:188,672-UNIMOD:188	0.02	41.0	7	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	66-UNIMOD:21,67-UNIMOD:21,156-UNIMOD:21	0.21	41.0	2	2	2
PRT	sp|Q9Y2D5-7|AKAP2_HUMAN	Isoform 5 of A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	482-UNIMOD:21,481-UNIMOD:188,503-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	255-UNIMOD:21,263-UNIMOD:188,265-UNIMOD:188	0.05	41.0	5	2	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	117-UNIMOD:21,134-UNIMOD:4	0.18	41.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	212-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q5FWF4-2|ZRAB3_HUMAN	Isoform 2 of DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens OX=9606 GN=ZRANB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	52-UNIMOD:4,53-UNIMOD:21,63-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	391-UNIMOD:4,394-UNIMOD:188	0.03	41.0	5	1	0
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	119-UNIMOD:188	0.09	41.0	2	1	0
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	8-UNIMOD:4,17-UNIMOD:4,18-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	661-UNIMOD:4,662-UNIMOD:21,659-UNIMOD:21,674-UNIMOD:188,675-UNIMOD:188	0.01	41.0	2	1	0
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	486-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q969F2|NKD2_HUMAN	Protein naked cuticle homolog 2 OS=Homo sapiens OX=9606 GN=NKD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	299-UNIMOD:21,315-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|P17275|JUNB_HUMAN	Transcription factor jun-B OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	252-UNIMOD:267,255-UNIMOD:21,259-UNIMOD:21,268-UNIMOD:267	0.05	41.0	1	1	1
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1154-UNIMOD:21,1163-UNIMOD:188,1168-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9P2Q2|FRM4A_HUMAN	FERM domain-containing protein 4A OS=Homo sapiens OX=9606 GN=FRMD4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	709-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|O00443-2|P3C2A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	252-UNIMOD:188,259-UNIMOD:21,261-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	213-UNIMOD:21,221-UNIMOD:4	0.03	41.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	356-UNIMOD:21,369-UNIMOD:188,373-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	121-UNIMOD:21,131-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	367-UNIMOD:4,379-UNIMOD:4,380-UNIMOD:4,382-UNIMOD:188	0.04	41.0	1	1	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	478-UNIMOD:188,482-UNIMOD:21,489-UNIMOD:188,504-UNIMOD:21,519-UNIMOD:188	0.07	41.0	1	1	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	257-UNIMOD:267,260-UNIMOD:21,281-UNIMOD:188	0.06	41.0	3	1	0
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	2-UNIMOD:1	0.07	41.0	1	1	1
PRT	sp|Q8N6N3|CA052_HUMAN	UPF0690 protein C1orf52 OS=Homo sapiens OX=9606 GN=C1orf52 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	144-UNIMOD:188	0.10	41.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2202-UNIMOD:4,2204-UNIMOD:21	0.01	40.0	3	1	0
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	337-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4,531-UNIMOD:267	0.06	40.0	3	1	0
PRT	sp|Q63HN8|RN213_HUMAN	E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1258-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1237-UNIMOD:21,1238-UNIMOD:267,1260-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	17-UNIMOD:21,23-UNIMOD:188,24-UNIMOD:188	0.16	40.0	1	1	1
PRT	sp|Q9GZR1-2|SENP6_HUMAN	Isoform 2 of Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	345-UNIMOD:21,353-UNIMOD:4,372-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	564-UNIMOD:188,569-UNIMOD:21,570-UNIMOD:21,578-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	41-UNIMOD:188,43-UNIMOD:21,63-UNIMOD:188	0.06	40.0	2	1	0
PRT	sp|Q14674-2|ESPL1_HUMAN	Isoform 2 of Separin OS=Homo sapiens OX=9606 GN=ESPL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1183-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	171-UNIMOD:4,181-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	240-UNIMOD:21,244-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	60-UNIMOD:21,63-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|O60293-2|ZC3H1_HUMAN	Isoform 2 of Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1295-UNIMOD:188,1303-UNIMOD:21,1304-UNIMOD:21,1314-UNIMOD:188	0.01	40.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	947-UNIMOD:4,952-UNIMOD:21,955-UNIMOD:188,958-UNIMOD:188,951-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	775-UNIMOD:21,795-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q17RY0-2|CPEB4_HUMAN	Isoform 2 of Cytoplasmic polyadenylation element-binding protein 4 OS=Homo sapiens OX=9606 GN=CPEB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	93-UNIMOD:188,97-UNIMOD:21,112-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	50-UNIMOD:21,42-UNIMOD:21,44-UNIMOD:188,65-UNIMOD:188	0.11	40.0	2	1	0
PRT	sp|Q9UQB8-3|BAIP2_HUMAN	Isoform 3 of Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	452-UNIMOD:21	0.05	40.0	3	1	0
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	96-UNIMOD:21,104-UNIMOD:4	0.07	40.0	1	1	1
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	384-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	13-UNIMOD:21	0.10	40.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1931-UNIMOD:188,1932-UNIMOD:21,1945-UNIMOD:188,1914-UNIMOD:188,1915-UNIMOD:21,1928-UNIMOD:188,1438-UNIMOD:21	0.02	40.0	4	3	2
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1312-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	422-UNIMOD:28,430-UNIMOD:4,439-UNIMOD:188,440-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	1498-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|Q14966|ZN638_HUMAN	Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	639-UNIMOD:385,639-UNIMOD:4,641-UNIMOD:21,652-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	40.0	2	1	0
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	729-UNIMOD:21,734-UNIMOD:188,739-UNIMOD:267,730-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P24278|ZBT25_HUMAN	Zinc finger and BTB domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZBTB25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	208-UNIMOD:4,220-UNIMOD:21,236-UNIMOD:188	0.07	39.0	1	1	1
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	466-UNIMOD:21,469-UNIMOD:4,468-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	194-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P18583-10|SON_HUMAN	Isoform J of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1697-UNIMOD:21,1699-UNIMOD:188,1706-UNIMOD:188	0.01	39.0	1	1	1
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	387-UNIMOD:4,392-UNIMOD:21,394-UNIMOD:21,402-UNIMOD:267,403-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|P25440-4|BRD2_HUMAN	Isoform 4 of Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	178-UNIMOD:21,181-UNIMOD:21,162-UNIMOD:188,189-UNIMOD:188	0.04	39.0	5	1	0
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	274-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	122-UNIMOD:21,123-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	216-UNIMOD:21,219-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	97-UNIMOD:267,99-UNIMOD:21,101-UNIMOD:4,117-UNIMOD:267	0.06	39.0	3	1	0
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	551-UNIMOD:21,552-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	360-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:188	0.04	39.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	77-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q4KWH8-2|PLCH1_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1454-UNIMOD:21,1467-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	238-UNIMOD:21,246-UNIMOD:188,254-UNIMOD:188	0.02	39.0	3	1	0
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	626-UNIMOD:21,633-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	388-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9Y4U1|MMAC_HUMAN	Methylmalonic aciduria and homocystinuria type C protein OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	275-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	613-UNIMOD:21,610-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|A4D1S0-2|KLRG2_HUMAN	Isoform 2 of Killer cell lectin-like receptor subfamily G member 2 OS=Homo sapiens OX=9606 GN=KLRG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	197-UNIMOD:4,202-UNIMOD:267,204-UNIMOD:21,218-UNIMOD:4,219-UNIMOD:4,220-UNIMOD:267	0.09	39.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	518-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1136-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	357-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q9UDY2-6|ZO2_HUMAN	Isoform 6 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	142-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	409-UNIMOD:21,921-UNIMOD:21,926-UNIMOD:188,930-UNIMOD:188	0.04	39.0	2	2	2
PRT	sp|Q9NZI8|IF2B1_HUMAN	Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	20-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	98-UNIMOD:28,112-UNIMOD:188,113-UNIMOD:21,116-UNIMOD:21,119-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	655-UNIMOD:27,659-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q9P2K5|MYEF2_HUMAN	Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	119-UNIMOD:4,134-UNIMOD:188	0.09	38.0	2	1	0
PRT	sp|O15514|RPB4_HUMAN	DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|P15924-2|DESP_HUMAN	Isoform DPII of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	165-UNIMOD:21,167-UNIMOD:188,174-UNIMOD:4,185-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|Q86TU7|SETD3_HUMAN	Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	584-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	502-UNIMOD:21,507-UNIMOD:4,517-UNIMOD:188,518-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1147-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	263-UNIMOD:21,279-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|Q02078-3|MEF2A_HUMAN	Isoform RSRFC4 of Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	96-UNIMOD:4,98-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	133-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	243-UNIMOD:21,251-UNIMOD:267	0.08	38.0	1	1	1
PRT	sp|Q8IUI4|S29P2_HUMAN	Putative protein SNX29P2 OS=Homo sapiens OX=9606 GN=SNX29P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	191-UNIMOD:21	0.10	38.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	208-UNIMOD:4,218-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|Q9HCH0-2|NCK5L_HUMAN	Isoform 2 of Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	447-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9Y485|DMXL1_HUMAN	DmX-like protein 1 OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	918-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	590-UNIMOD:21,597-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9P266|JCAD_HUMAN	Junctional protein associated with coronary artery disease OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1281-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	436-UNIMOD:188,385-UNIMOD:21	0.04	38.0	2	2	2
PRT	sp|Q13555-9|KCC2G_HUMAN	Isoform 9 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	344-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	312-UNIMOD:21,321-UNIMOD:188,322-UNIMOD:188,310-UNIMOD:21	0.05	38.0	2	1	0
PRT	sp|Q9P2R6|RERE_HUMAN	Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	53-UNIMOD:21,56-UNIMOD:21,73-UNIMOD:188,74-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1765-UNIMOD:21,1770-UNIMOD:4,1784-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	97-UNIMOD:267,100-UNIMOD:21,114-UNIMOD:21,116-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q8IWC1-2|MA7D3_HUMAN	Isoform 2 of MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	185-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	660-UNIMOD:4,673-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	361-UNIMOD:188	0.03	38.0	1	1	1
PRT	sp|Q9P0K1-5|ADA22_HUMAN	Isoform 5 of Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ADAM22	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	821-UNIMOD:21,826-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1008-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1383-UNIMOD:21,1393-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|P52594-2|AGFG1_HUMAN	Isoform 2 of Arf-GAP domain and FG repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=AGFG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	251-UNIMOD:21,273-UNIMOD:188	0.05	38.0	1	1	1
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	254-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|Q9UK96|FBX10_HUMAN	F-box only protein 10 OS=Homo sapiens OX=9606 GN=FBXO10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	309-UNIMOD:4,326-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	86-UNIMOD:21	0.17	38.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	862-UNIMOD:21,870-UNIMOD:188,875-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	465-UNIMOD:21,477-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2159-UNIMOD:21,2165-UNIMOD:21,2169-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	593-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	54-UNIMOD:188	0.15	38.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	122-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	133-UNIMOD:21,145-UNIMOD:188,148-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|Q9ULH0-5|KDIS_HUMAN	Isoform 5 of Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	293-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	115-UNIMOD:267,121-UNIMOD:21,122-UNIMOD:21,134-UNIMOD:267	0.11	38.0	4	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	447-UNIMOD:385,447-UNIMOD:4,462-UNIMOD:188	0.03	38.0	3	1	0
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4	0.04	38.0	1	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	106-UNIMOD:28,113-UNIMOD:21,119-UNIMOD:188,122-UNIMOD:188	0.01	38.0	2	1	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.10	38.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	716-UNIMOD:21,731-UNIMOD:188,732-UNIMOD:267	0.02	38.0	1	1	0
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	31-UNIMOD:28,42-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	223-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	914-UNIMOD:21,918-UNIMOD:21,921-UNIMOD:21,925-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	926-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q96IX5|ATPMD_HUMAN	ATP synthase membrane subunit DAPIT, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	16-UNIMOD:188	0.28	37.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	364-UNIMOD:21,374-UNIMOD:21,380-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q9UID6|ZN639_HUMAN	Zinc finger protein 639 OS=Homo sapiens OX=9606 GN=ZNF639 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	200-UNIMOD:21,206-UNIMOD:4,209-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	373-UNIMOD:188	0.04	37.0	1	1	1
PRT	sp|O00444-3|PLK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	337-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	670-UNIMOD:4,677-UNIMOD:21,686-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	79-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|Q9UHL9-2|GT2D1_HUMAN	Isoform 2 of General transcription factor II-I repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	448-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P46100-2|ATRX_HUMAN	Isoform 1 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1323-UNIMOD:21,1327-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q9BY67-5|CADM1_HUMAN	Isoform 5 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	394-UNIMOD:21,409-UNIMOD:188,410-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|Q03001|DYST_HUMAN	Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	7416-UNIMOD:21	0.00	37.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	327-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	448-UNIMOD:267	0.02	37.0	12	1	0
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	648-UNIMOD:188,649-UNIMOD:21,652-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	525-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q49AR2|CE022_HUMAN	UPF0489 protein C5orf22 OS=Homo sapiens OX=9606 GN=C5orf22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	195-UNIMOD:4,197-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|O15020-2|SPTN2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	182-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|O43707-3|ACTN4_HUMAN	Isoform 3 of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	232-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|O95251|KAT7_HUMAN	Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	56-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	108-UNIMOD:21,109-UNIMOD:21	0.02	37.0	3	1	0
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1105-UNIMOD:21,1115-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	53-UNIMOD:21,61-UNIMOD:188,63-UNIMOD:188	0.02	37.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	165-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	517-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	330-UNIMOD:21,334-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	105-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	315-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|O60506-2|HNRPQ_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	26-UNIMOD:267	0.03	37.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	148-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q8NEZ4-2|KMT2C_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1889-UNIMOD:21	0.00	37.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	678-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9H6Y2|WDR55_HUMAN	WD repeat-containing protein 55 OS=Homo sapiens OX=9606 GN=WDR55 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	5-UNIMOD:4,8-UNIMOD:267,14-UNIMOD:21,27-UNIMOD:267	0.07	37.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21,22-UNIMOD:267,40-UNIMOD:267	0.05	37.0	1	1	1
PRT	sp|Q15678|PTN14_HUMAN	Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens OX=9606 GN=PTPN14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	620-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	33-UNIMOD:21,34-UNIMOD:188,53-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	192-UNIMOD:4,194-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|P15923-2|TFE2_HUMAN	Isoform E47 of Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	530-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	847-UNIMOD:21,860-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	61-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	104-UNIMOD:188	0.10	37.0	1	1	1
PRT	sp|Q9BQE9-2|BCL7B_HUMAN	Isoform 2 of B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	62-UNIMOD:21	0.19	37.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	48-UNIMOD:4,53-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	58-UNIMOD:4,59-UNIMOD:267	0.03	37.0	2	1	0
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	101-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|Q9H5H4|ZN768_HUMAN	Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	160-UNIMOD:21,157-UNIMOD:188,169-UNIMOD:188	0.04	37.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	188-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q5T5Y3|CAMP1_HUMAN	Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1398-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	496-UNIMOD:28	0.03	37.0	1	1	1
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.10	37.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	108-UNIMOD:21,109-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|P26440|IVD_HUMAN	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	34-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q8IVL1|NAV2_HUMAN	Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1234-UNIMOD:21,1235-UNIMOD:21,1236-UNIMOD:21,1239-UNIMOD:21,1243-UNIMOD:21	0.01	37.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	INKTSPVTASDPAGPSYAAATLQASSAASSASPVSR	1	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	5-UNIMOD:21	ms_run[2]:scan=20244	91.289	3	3497.6675	3497.6675	R	A	195	231
PSM	SKSISSSNPDLAVAPGSVDDEVSR	2	sp|Q96HP0|DOCK6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	5-UNIMOD:21	ms_run[2]:scan=16027	71.322	2	2496.1381	2496.1381	R	I	878	902
PSM	SSKASLGSLEGEAEAEASSPK	3	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:188,5-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=19939	89.902	2	2125.9819	2125.9819	K	G	5745	5766
PSM	AVGAQASVGSRSEGEGEAASADDGSLNTSGAGPK	4	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	10-UNIMOD:21	ms_run[2]:scan=11005	49.17	3	3169.3797	3169.3797	R	S	38	72
PSM	KLSGDQITLPTTVDYSSVPK	5	sp|O00559|RCAS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	3-UNIMOD:21	ms_run[2]:scan=22268	100.74	2	2228.0977	2228.0977	R	Q	34	54
PSM	NLKTEEEEEEEEEEEEDDEEEEGDDEGQK	6	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	4-UNIMOD:21	ms_run[2]:scan=13428	60.17	3	3578.2749	3578.2749	R	S	266	295
PSM	SVSTPSEAGSQDSGDGAVGSR	7	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=5558	24.667	2	1949.8563	1949.8563	K	R	86	107
PSM	GNDISSGTVLSDYVGSGPPK	8	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	20-UNIMOD:188	ms_run[2]:scan=20662	93.19	2	1954.9579	1954.9579	K	G	94	114
PSM	LAQQQAAAAAAAAAAASQQGSAK	9	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	23-UNIMOD:188	ms_run[2]:scan=16146	71.817	3	2060.0706	2060.0706	K	N	103	126
PSM	APEAAVSEDGKSDDELLSSK	10	sp|Q8NEY1-7|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	12-UNIMOD:21	ms_run[2]:scan=12426	55.705	2	2126.9257	2126.9257	K	A	188	208
PSM	GVVPLAGTNGETTTQGLDGLSER	11	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=20666	93.21	2	2271.1343	2271.1343	K	C	112	135
PSM	KLSSSDAPAQDTGSSAAAVETDASR	12	sp|Q7Z4S6-6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	5-UNIMOD:21	ms_run[2]:scan=11116	49.629	2	2501.0919	2501.0919	R	T	815	840
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	13	sp|Q01831-2|XPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	16-UNIMOD:21	ms_run[2]:scan=9165	41.222	3	2967.2003	2967.2003	K	I	832	862
PSM	SETAPAETATPAPVEKSPAK	14	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6729	29.9	2	2073.007	2073.0070	M	K	2	22
PSM	GGVTGSPEASISGSKGDLK	15	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	14-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10199	45.649	2	1837.8861	1837.8861	K	S	5726	5745
PSM	KVVEAVNSDSDSEFGIPK	16	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=17645	78.494	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LAEDAPNFDGPAAEGQPGQK	17	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=12930	57.887	2	2010.9283	2010.9283	R	Q	139	159
PSM	APEAAVSEDGKSDDELLSSK	18	sp|Q8NEY1-7|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:188,12-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=12423	55.692	2	2138.9659	2138.9659	K	A	188	208
PSM	AQAVSEEEEEEEGKSSSPK	19	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=5409	24.087	2	2128.8685	2128.8685	K	K	78	97
PSM	GVVPLAGTDGETTTQGLDGLSER	20	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	23-UNIMOD:267	ms_run[2]:scan=21305	96.208	2	2282.1266	2282.1266	K	C	112	135
PSM	IGGDAGTSLNSNDYGYGGQK	21	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	20-UNIMOD:188	ms_run[2]:scan=12223	54.835	2	1978.8964	1978.8964	K	R	45	65
PSM	SEVERPASIPLSSGYSTASSDSTPR	22	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=16087	71.589	3	2660.1967	2660.1967	K	A	324	349
PSM	SGSPSDNSGAEEMEVSLAKPK	23	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=14777	66.115	2	2198.9403	2198.9403	R	H	60	81
PSM	SIEDDEEGHLICQSGDVLR	24	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=20055	90.39	2	2260.9547	2260.9547	R	A	138	157
PSM	SSSPAELDLKDDLQQTQGK	25	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21,10-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=17278	76.795	2	2151.0135	2151.0135	R	C	819	838
PSM	STIGVMVTASHNPEEDNGVK	26	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=14551	65.04	2	2169.9709	2169.9709	K	L	55	75
PSM	SVSTPSEAGSQDSGDGAVGSR	27	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	21-UNIMOD:267	ms_run[2]:scan=5509	24.482	2	1959.8645	1959.8645	K	R	86	107
PSM	TCDSITPSKSSPVPVSDTQK	28	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:4,9-UNIMOD:188,10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=8946	40.284	2	2225.0326	2225.0326	R	L	190	210
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	29	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=15249	68.043	3	2919.3123	2919.3123	R	V	1118	1147
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	30	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=15636	69.667	3	2919.3123	2919.3123	R	V	1118	1147
PSM	AQAVSEEEEEEEGKSSSPK	31	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21	ms_run[2]:scan=3831	17.43	2	2128.8685	2128.8685	K	K	78	97
PSM	AQAVSEEEEEEEGKSSSPK	32	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21,14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5408	24.085	2	2140.9088	2140.9088	K	K	78	97
PSM	FGIVTSSAGTGTTEDTEAK	33	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12628	56.632	2	1870.8796	1870.8796	R	K	181	200
PSM	GDQPAASGDSDDDEPPPLPR	34	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11228	50.084	2	2034.8767	2034.8767	R	L	48	68
PSM	GSSGSPAHAESYSSGGGGQQK	35	sp|P15408|FOSL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21	ms_run[2]:scan=1468	7.8513	2	2014.8018	2014.8018	R	F	15	36
PSM	GVVPLAGTNGETTTQGLDGLSER	36	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	23-UNIMOD:267	ms_run[2]:scan=20671	93.231	2	2281.1425	2281.1425	K	C	112	135
PSM	IGSDGSQEDAKEDGFGSEVIK	37	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=14865	66.513	2	2246.958	2246.9580	K	V	225	246
PSM	KVVEAVNSDSDSEFGIPK	38	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=17562	78.153	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LGAGEGGEASVSPEKTSTTSK	39	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21,15-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=6483	28.828	2	2083.9713	2083.9713	K	G	1329	1350
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTR	40	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=19471	87.571	3	3856.8619	3856.8619	R	G	1153	1189
PSM	STNGDTFLGGEDFDQALLR	41	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:267	ms_run[2]:scan=27462	128.99	2	2064.9628	2064.9628	K	H	266	285
PSM	VAASPKSPTAALNESLVECPK	42	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=17496	77.839	2	2248.081	2248.0811	K	C	422	443
PSM	VASGSDLHLTDIDSDSNR	43	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=15744	70.105	2	1990.8509	1990.8509	K	G	70	88
PSM	VSNQDSKSPLGFYCDQNPVESSMCQSNSR	44	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21,14-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=20761	93.638	3	3400.3796	3400.3796	K	D	572	601
PSM	GDQPAASGDSDDDEPPPLPR	45	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	20-UNIMOD:267	ms_run[1]:scan=11233	50.10406833333334	2	2045.894533	2044.884926	R	L	48	68
PSM	AAKLSEGSQPAEEEEDQETPSR	46	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=7865	35.261	2	2467.0388	2467.0388	R	N	236	258
PSM	AATSGVPSIYAPSTYAHLSPAK	47	sp|Q86X29-6|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:21	ms_run[2]:scan=21168	95.559	2	2268.0828	2268.0828	K	T	158	180
PSM	ADDLLPLGDQTQDGDFGSR	48	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:267	ms_run[2]:scan=21814	98.614	2	2028.9264	2028.9264	R	L	420	439
PSM	AESPAEKVPEESVLPLVQK	49	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=20931	94.425	2	2141.106	2141.1060	K	S	488	507
PSM	AESPAEKVPEESVLPLVQK	50	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=20921	94.379	2	2129.0657	2129.0657	K	S	488	507
PSM	FGIVTSSAGTGTTEDTEAK	51	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=12621	56.6	2	1876.8997	1876.8997	R	K	181	200
PSM	GAGDGSDEEVDGKADGAEAKPAE	52	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=5435	24.197	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GIVDQSQQAYQEAFEISK	53	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=24266	110.86	2	2039.98	2039.9800	K	K	140	158
PSM	KLSGDQITLPTTVDYSSVPK	54	sp|O00559|RCAS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,3-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22270	100.75	2	2240.138	2240.1380	R	Q	34	54
PSM	KSLDSDESEDEEDDYQQK	55	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=7076	31.367	2	2238.8325	2238.8325	K	R	56	74
PSM	KYSASSGGLCEEATAAK	56	sp|Q9UHV7|MED13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,3-UNIMOD:21,10-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9406	42.302	2	1820.8055	1820.8055	R	V	393	410
PSM	LGAGEGGEASVSPEKTSTTSK	57	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=6151	27.383	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LGAGEGGEASVSPEKTSTTSK	58	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=6373	28.393	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LYGSAGPPPTGEEDTAEKDEL	59	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:188	ms_run[2]:scan=15766	70.202	2	2181.0057	2181.0057	K	-	634	655
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	60	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=12730	57.042	3	3045.258	3045.2580	R	V	320	347
PSM	QGAIVAVTGDGVNDSPALK	61	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=16726	74.282	2	1810.9425	1810.9425	R	K	708	727
PSM	RGGGSGGGEESEGEEVDED	62	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2875	13.239	2	1940.6784	1940.6784	R	-	294	313
PSM	SDSRAQAVSEDAGGNEGR	63	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=3186	14.451	2	1904.7765	1904.7765	R	A	117	135
PSM	SHSESASPSALSSSPNNLSPTGWSQPK	64	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17574	78.21	3	2899.2063	2899.2063	R	T	283	310
PSM	SPSDVSASESPQHDVVDLGSTAPLK	65	sp|Q8N9M5|TM102_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=19182	86.184	3	2602.18	2602.1800	K	T	209	234
PSM	SSSPAELDLKDDLQQTQGK	66	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=17267	76.742	2	2138.9733	2138.9733	R	C	819	838
PSM	TCSDGGPSSELAHSPTNSGK	67	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4985	22.271	2	2067.8205	2067.8205	R	K	769	789
PSM	KIVEPEVVGESDSEVEGDAWR	68	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=19965	90.01381166666667	3	2490.040102	2489.040047	R	M	106	127
PSM	ADHSFSDGVPSDSVEAAKNASNTEK	69	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,11-UNIMOD:21,18-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=15569	69.37227166666666	3	2696.1646	2696.1636	M	L	2	27
PSM	AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK	70	sp|Q9UKY7-2|CDV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=8214	37.007	3	3748.6787	3748.6787	R	A	28	77
PSM	AFYGSEEDEAKGAGSEETAAAAAPSR	71	sp|Q13367-3|AP3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=13520	60.564	2	2651.1024	2651.1024	K	K	236	262
PSM	AGLESGAEPGDGDSDTTKK	72	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4007	18.144	2	1925.8294	1925.8294	K	K	481	500
PSM	AGLESGAEPGDGDSDTTKK	73	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4396	19.713	2	1925.8294	1925.8294	K	K	481	500
PSM	AQAVSEEEEEEEGKSSSPK	74	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:188,17-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=3816	17.37	2	2140.9088	2140.9088	K	K	78	97
PSM	DGPSSAPATPTKAPYSPTTSK	75	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=8943	40.268	2	2139.9725	2139.9725	R	E	753	774
PSM	DIKEESDEEEEDDEESGR	76	sp|Q96EV2-2|RBM33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=4300	19.31	2	2218.7911	2218.7911	K	L	200	218
PSM	DSDKEGTSNSTSEDGPGDGFTILSSK	77	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=19110	85.832	3	2710.1131	2710.1131	K	S	164	190
PSM	EILGTAQSVGCNVDGR	78	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=13772	61.672	2	1684.8078	1684.8078	K	H	131	147
PSM	GADFLVTEVENGGSLGSK	79	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:188	ms_run[2]:scan=24163	110.34	2	1784.8888	1784.8888	K	K	189	207
PSM	GVGIISEGNETVEDIAAR	80	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=22464	101.71	2	1828.9167	1828.9167	K	L	630	648
PSM	IETDEEESCDNAHGDANQPAR	81	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,9-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=4065	18.386	2	2446.9208	2446.9208	R	D	1051	1072
PSM	IETDEEESCDNAHGDANQPAR	82	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=4054	18.337	2	2436.9125	2436.9125	R	D	1051	1072
PSM	IGGDAGTSLNSNDYGYGGQK	83	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12194	54.695	2	1972.8763	1972.8763	K	R	45	65
PSM	IGSPPKTPVSNVAATSAGPSNVGTELNSVPQK	84	sp|Q9HBD1-6|RC3H2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=19084	85.707	3	3183.5813	3183.5813	K	S	352	384
PSM	KETESEAEDNLDDLEK	85	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,5-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=13679	61.307	2	1955.8287	1955.8288	K	H	868	884
PSM	LAEDAPNFDGPAAEGQPGQK	86	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=12916	57.827	2	2016.9484	2016.9484	R	Q	139	159
PSM	LPPNTNDEVDEDPTGNK	87	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:188	ms_run[2]:scan=8234	37.093	2	1859.848	1859.8480	R	A	1058	1075
PSM	NEEDAAELVALAQAVNAR	88	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=27700	130.54	2	1882.9385	1882.9385	R	A	311	329
PSM	NQDLAPNSAEQASILSLVTK	89	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=27169	127.15	2	2104.1107	2104.1107	R	I	61	81
PSM	SDSRAQAVSEDAGGNEGR	90	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=3191	14.471	2	1884.7599	1884.7599	R	A	117	135
PSM	SQQSSGRTSGSDDPGICSNTDSTQAQVLLGK	91	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=16908	75.15	3	3260.4253	3260.4253	K	K	621	652
PSM	SSLSNNECGSLDKTSPEMSNSNNDER	92	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9363	42.131	3	2951.1546	2951.1546	K	K	1148	1174
PSM	STNGDTFLGGEDFDQALLR	93	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=27469	129.02	2	2054.9545	2054.9545	K	H	266	285
PSM	SVEDDEEGHLICQSGDVLSAR	94	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=20073	90.474	2	2394.9999	2394.9999	R	Y	140	161
PSM	TAKDSDDDDDVAVTVDR	95	sp|Q16623-3|STX1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=8137	36.657	2	1915.7684	1915.7684	R	D	10	27
PSM	TAKDSDDDDDVAVTVDR	96	sp|Q16623-3|STX1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=8367	37.689	2	1915.7684	1915.7684	R	D	10	27
PSM	TAKDSDDDDDVAVTVDR	97	sp|Q16623-3|STX1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=8652	38.98	2	1915.7684	1915.7684	R	D	10	27
PSM	TCDSITPSKSSPVPVSDTQK	98	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=8952	40.307	2	2212.9923	2212.9923	R	L	190	210
PSM	TSEIEPKNSPEDLGLSLTGDSCK	99	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=19744	88.901	2	2568.1705	2568.1705	K	L	492	515
PSM	TVTPASSAKTSPAKQQAPPVR	100	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5601	24.845	2	2361.0532	2361.0532	K	N	476	497
PSM	VASGSDLHLTDIDSDSNR	101	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=15232	67.979	2	1990.8509	1990.8509	K	G	70	88
PSM	VDGETASDSESRAESAPLPVSADDTPEVLNR	102	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21	ms_run[2]:scan=20230	91.234	3	3293.4573	3293.4573	K	A	27	58
PSM	VPDEEENEESDNEKETEK	103	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=2547	11.933	2	2228.8482	2228.8482	K	S	1097	1115
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	104	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	11-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=23916	109.06983833333334	3	3176.535500	3175.546831	R	A	655	686
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	105	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7989	35.82756666666667	3	3007.3412	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	106	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=8184	36.85763	3	3007.3412	3007.3292	K	S	145	174
PSM	AAPEASSPPASPLQHLLPGK	107	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22132	100.11	2	2133.0004	2133.0004	K	A	673	693
PSM	AGLASPEEEDAVGKEPLK	108	sp|Q9UNS1-2|TIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=14369	64.259	2	1918.8925	1918.8925	K	A	1144	1162
PSM	AGLESGAEPGDGDSDTTKK	109	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4809	21.513	2	1925.8294	1925.8294	K	K	481	500
PSM	APVAGTCYQAEWDDYVPK	110	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4	ms_run[2]:scan=23139	105.16	2	2068.92	2068.9200	R	L	162	180
PSM	APYQENDGYCPDLELSDSEAESDGNKEK	111	sp|Q92613|JADE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:4,16-UNIMOD:21,26-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=17304	76.916	3	3251.3165	3251.3165	R	V	759	787
PSM	DAHDVSPTSTDTEAQLTVER	112	sp|Q8IVF2-3|AHNK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=13135	58.815	2	2260.9724	2260.9724	R	Q	189	209
PSM	GAVAAEGASDTEREEPTESQGLAAR	113	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=10589	47.35	3	2581.1293	2581.1293	R	L	907	932
PSM	GCITIIGGGDTATCCAK	114	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=13771	61.67	2	1753.7797	1753.7797	R	W	338	355
PSM	GGVTGSPEASISGSKGDLK	115	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=10201	45.653	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GSYGDLGGPIITTQVTIPK	116	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=24427	111.71	2	1916.0255	1916.0255	R	D	354	373
PSM	GVVPLAGTDGETTTQGLDGLSER	117	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=21329	96.309	2	2272.1183	2272.1183	K	C	112	135
PSM	IACKSPPPESVDTPTSTK	118	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=6612	29.39	2	1993.9068	1993.9068	K	Q	1127	1145
PSM	IISNASCTTNCLAPLAK	119	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4,11-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=15627	69.623	2	1838.9326	1838.9326	K	V	104	121
PSM	IYISNTFSPSKAEGDSAGTAGTPGGTPAGDK	120	sp|Q92925-3|SMRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=17307	76.93	3	3033.3605	3033.3605	R	V	148	179
PSM	KETESEAEDNLDDLEK	121	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=10930	48.882	2	1943.7885	1943.7885	K	H	868	884
PSM	KTSASDVTNIYPGDAGK	122	sp|Q15042-4|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=11770	52.699	2	1814.849	1814.8490	K	A	491	508
PSM	KYSASSGGLCEEATAAK	123	sp|Q9UHV7|MED13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=9376	42.191	2	1808.7652	1808.7652	R	V	393	410
PSM	LGAGEGGEASVSPEKTSTTSK	124	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21,15-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=32359	162.38	2	2083.9713	2083.9713	K	G	1329	1350
PSM	LPDSDDDEDEETAIQR	125	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10187	45.606	2	1846.7705	1846.7705	R	V	176	192
PSM	LPPNTNDEVDEDPTGNK	126	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8405	37.869	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQSPIKEENTTAVEEIGR	127	sp|Q9NS73-3|MBIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=15479	69.009	2	2093.0042	2093.0042	K	T	89	107
PSM	LYGSAGPPPTGEEDTAEKDEL	128	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15256	68.072	2	2174.9855	2174.9855	K	-	634	655
PSM	NTDVAQSPEAPKQEAPAK	129	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,12-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4084	18.468	2	1971.9342	1971.9342	R	K	179	197
PSM	SASPDDDLGSSNWEAADLGNEERK	130	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=19955	89.97	3	2642.077	2642.0770	R	Q	15	39
PSM	SDESGEEKNGDEDCQR	131	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=725	5.3134	2	1933.6633	1933.6633	K	G	148	164
PSM	SETAPAETATPAPVEKSPAK	132	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=6707	29.809	2	2060.9667	2060.9667	M	K	2	22
PSM	SLSSSPVKKANDGEGGDEEAGTEEAVPR	133	sp|Q9H3Q1-2|BORG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=11200	49.979	3	2975.2434	2975.2435	K	R	68	96
PSM	SQSESSDEVTELDLSHGK	134	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=13488	60.439	2	2032.857	2032.8570	R	K	657	675
PSM	SSLGQSASETEEDTVSVSKK	135	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=10081	45.162	2	2147.9471	2147.9471	R	E	302	322
PSM	SSSPAPADIAQTVQEDLR	136	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=24926	114.37	2	1893.9308	1893.9308	K	T	230	248
PSM	SSVKTPETVVPTAPELQASASTDQPVTSEPTSR	137	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=19001	85.31	3	3476.656	3476.6560	R	T	1481	1514
PSM	STIGVMVTASHNPEEDNGVK	138	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=14578	65.161	2	2163.9508	2163.9508	K	L	55	75
PSM	SVCGHLENTSVGNSPNPSSAENSFR	139	sp|Q96HH9-5|GRM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=15470	68.974	3	2806.1055	2806.1055	K	A	108	133
PSM	TSEIEPKNSPEDLGLSLTGDSCK	140	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=19653	88.404	3	2568.1705	2568.1705	K	L	492	515
PSM	TSKAETPTESVSEPEVATK	141	sp|P18858-2|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=8441	38.037	2	2069.9406	2069.9406	K	Q	190	209
PSM	TTGDISVEKLNLGTDSDSSPQK	142	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:21	ms_run[2]:scan=17125	76.091	2	2371.0792	2371.0792	R	S	544	566
PSM	TTGDISVEKLNLGTDSDSSPQK	143	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:188,19-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=17063	75.832	2	2383.1195	2383.1195	R	S	544	566
PSM	TVEVAEGEAVRTPQSVTAK	144	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=11151	49.784	2	2050.9936	2050.9936	R	Q	132	151
PSM	VAAAAGSGPSPPGSPGHDR	145	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4740	21.18	2	1846.7401	1846.7401	R	E	38	57
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	146	sp|Q5JTV8|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=11644	52.103	2	2835.1244	2835.1244	K	A	212	237
PSM	VQANLGAPDINIEGLDAK	147	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=23035	104.64	2	1842.9783	1842.9783	K	V	5164	5182
PSM	YYSPCEEHPAETNQNEGAESGTIR	148	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10496	46.953	2	2818.1178	2818.1178	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	149	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10073	45.131	3	2834.1127	2834.1127	R	Q	182	206
PSM	QAQQERDELADEIANSSGK	150	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,6-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=18358	81.87895666666667	2	2086.9731	2086.9733	R	G	1698	1717
PSM	SETAPAETATPAPVEKSPAKK	151	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7806	34.97915666666667	2	2231.0783	2231.0717	M	K	2	23
PSM	ASPSCSSPTRDSSGVPVSK	152	sp|Q8N5I9|CL045_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=4865	21.745508333333333	2	1985.863197	1984.856136	K	E	9	28
PSM	AAPEASSPPASPLQHLLPGK	153	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22539	102.12	2	2133.0004	2133.0004	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	154	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22206	100.45	2	2126.9803	2126.9803	K	A	673	693
PSM	AAVLSDSEDEEKASAK	155	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5790	25.634	2	1740.7858	1740.7858	K	K	69	85
PSM	CVEDPETGLCLLPLTDK	156	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=26377	122.42	2	1958.9329	1958.9329	R	A	2839	2856
PSM	DDGVFVQEVTQNSPAAR	157	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=18997	85.292	2	1841.8783	1841.8783	R	T	29	46
PSM	DRPGSPESPLLDAPFSR	158	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,8-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=22057	99.748	2	2019.8607	2019.8607	R	A	906	923
PSM	DSNELSDSAGEEDSADLKR	159	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=9519	42.776	2	2116.8434	2116.8434	K	A	710	729
PSM	EKPDSDDDLDIASLVTAK	160	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=24869	114.05	2	2010.9035	2010.9035	R	L	655	673
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	161	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=18824	84.433	3	2729.1371	2729.1371	K	S	61	87
PSM	GQKSPGALETPSAAGSQGNTASQGK	162	sp|Q9Y2D5-7|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=6515	28.959	3	2408.0969	2408.0969	K	E	479	504
PSM	GQKSPGALETPSAAGSQGNTASQGK	163	sp|Q9Y2D5-7|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:188,4-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=6532	29.045	3	2420.1372	2420.1372	K	E	479	504
PSM	GSLGSQGAKDEPEEELQK	164	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=10238	45.817	2	1980.8677	1980.8677	K	G	1368	1386
PSM	GVGIISEGNETVEDIAAR	165	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=22459	101.68	2	1838.9249	1838.9249	K	L	630	648
PSM	IEDVGSDEEDDSGKDK	166	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=4507	20.164	2	1816.6888	1816.6888	K	K	250	266
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	167	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,25-UNIMOD:4	ms_run[2]:scan=9494	42.675	3	3620.4217	3620.4217	R	A	110	145
PSM	KETESEAEDNLDDLEK	168	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=13908	62.322	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	169	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=14608	65.324	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	170	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=14838	66.401	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	171	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,5-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=14607	65.322	2	1955.8287	1955.8288	K	H	868	884
PSM	KETESEAEDNLDDLEK	172	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,5-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=14832	66.373	2	1955.8287	1955.8288	K	H	868	884
PSM	KLSSSSEPYEEDEFNDDQSIK	173	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=15690	69.886	3	2526.0323	2526.0323	R	K	209	230
PSM	LAASEDHCSPSEETPSQSK	174	sp|Q5FWF4-2|ZRAB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=3995	18.099	2	2144.8665	2144.8665	K	Q	45	64
PSM	LASGEDDPFDSDFSCPVK	175	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:4	ms_run[2]:scan=21188	95.648	2	1984.836	1984.8360	K	L	377	395
PSM	LGAGEGGEASVSPEKTSTTSK	176	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21,15-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5940	26.33	2	2083.9713	2083.9713	K	G	1329	1350
PSM	LGIYDADGDGDFDVDDAK	177	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=20720	93.448	2	1905.8212	1905.8212	K	V	102	120
PSM	LPDSDDDEDEETAIQR	178	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:267	ms_run[2]:scan=10168	45.537	2	1856.7787	1856.7787	R	V	176	192
PSM	LYGSAGPPPTGEEDTAEKDEL	179	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=15241	68.012	2	2181.0057	2181.0057	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	180	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=15483	69.026	2	2181.0057	2181.0057	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	181	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15499	69.093	2	2174.9855	2174.9855	K	-	634	655
PSM	PEIVDTCSLASPASVCR	182	sp|P09960-2|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=17393	77.348	2	1870.8793	1870.8793	M	T	2	19
PSM	SASPDDDLGSSNWEAADLGNEERK	183	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=18900	84.802	2	2642.077	2642.0770	R	Q	15	39
PSM	SGCSDLEEAVDSGADKK	184	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=13990	62.665	2	1846.7292	1846.7292	K	F	659	676
PSM	SIDDEITEAKSGTATPQR	185	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=11468	51.22	2	1997.8943	1997.8943	R	S	476	494
PSM	SIEDDEEGHLICQSGDVLR	186	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=20014	90.224	2	2250.9464	2250.9464	R	A	138	157
PSM	SQVLVEHVVPASEPAAR	187	sp|Q969F2|NKD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=15032	67.163	2	1867.9193	1867.9193	R	A	299	316
PSM	SQVLVEHVVPASEPAAR	188	sp|Q969F2|NKD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=15039	67.19	2	1877.9276	1877.9276	R	A	299	316
PSM	SRDATPPVSPINMEDQER	189	sp|P17275|JUNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=13129	58.794	3	2220.9027	2220.9027	R	I	251	269
PSM	SSLSGDEEDELFKGATLK	190	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=22222	100.53	2	2016.9332	2016.9332	R	A	1151	1169
PSM	SSLSGDEEDELFKGATLK	191	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=22162	100.26	2	2004.8929	2004.8929	R	A	1151	1169
PSM	SSSLESQGKLLGSENDTGSPDFYTPR	192	sp|Q9P2Q2|FRM4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=20661	93.187	3	2851.2549	2851.2549	R	T	709	735
PSM	TDLEITDSKVSNLQVSPK	193	sp|O00443-2|P3C2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=17459	77.666	2	2065.0383	2065.0383	R	S	244	262
PSM	TGSESPKVCSDQSSGSGTGK	194	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1125	6.6673	2	2034.8201	2034.8201	R	G	213	233
PSM	TGSYGALAEITASKEGQK	195	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=17164	76.26	2	1889.8772	1889.8772	K	E	356	374
PSM	VPDEEENEESDNEKETEK	196	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=2546	11.93	2	2240.8884	2240.8884	K	S	1097	1115
PSM	VQEHEDSGDSEVENEAK	197	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=3972	18.01	2	1980.7586	1980.7586	R	G	115	132
PSM	YAPSGFYIASGDVSGK	198	sp|O75083|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17966	79.739	2	1617.7675	1617.7675	K	L	66	82
PSM	GCITIIGGGDTATCCAK	199	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=13754	61.61288666666667	2	1760.809957	1759.799855	R	W	366	383
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	200	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:188,8-UNIMOD:21,15-UNIMOD:188,30-UNIMOD:21,45-UNIMOD:188	ms_run[1]:scan=23622	107.5622	4	4633.143817	4633.138343	R	Q	475	520
PSM	KIVEPEVVGESDSEVEGDAWR	201	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=20187	91.04434833333333	3	2490.044500	2489.040047	R	M	106	127
PSM	EREESEDELEEANGNNPIDIEVDQNK	202	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,26-UNIMOD:188	ms_run[1]:scan=19375	87.12222	3	3111.304284	3110.317205	R	E	256	282
PSM	SDEFSLADALPEHSPAK	203	sp|Q8NDC0|MISSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1	ms_run[1]:scan=23727	108.11022333333334	2	1854.8643	1854.8630	M	T	2	19
PSM	WSNIYEDNGDDAPQNAK	204	sp|Q8N6N3|CA052_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:188	ms_run[1]:scan=12655	56.74146333333333	2	1942.830053	1941.843628	K	K	128	145
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	205	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=19508	87.76	3	3062.4016	3062.4016	K	S	2194	2221
PSM	AGAAAGDSDEESRADDK	206	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=942	6.001	2	1743.6585	1743.6585	R	G	330	347
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	207	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=13426	60.166	3	3183.2517	3183.2517	R	-	502	532
PSM	AGLASPEEEDAVGKEPLK	208	sp|Q9UNS1-2|TIM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=14376	64.297	2	1930.9328	1930.9328	K	A	1144	1162
PSM	APVAGTCYQAEWDDYVPK	209	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=23250	105.71	2	2068.92	2068.9200	R	L	162	180
PSM	APVAGTCYQAEWDDYVPK	210	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=23177	105.33	2	2074.9402	2074.9402	R	L	162	180
PSM	AVGAQASVGSRSEGEGEAASADDGSLNTSGAGPK	211	sp|Q9NWV8-3|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,11-UNIMOD:267,34-UNIMOD:188	ms_run[2]:scan=11045	49.339	3	3185.4081	3181.4199	R	S	38	72
PSM	CTGGEVGATSALAPK	212	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4	ms_run[2]:scan=9129	41.077	2	1417.6871	1417.6871	R	I	17	32
PSM	EAAEPLSEPKEDQEAAELLSEPEEESER	213	sp|Q63HN8|RN213_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	20-UNIMOD:21	ms_run[2]:scan=20798	93.81	3	3220.382	3220.3820	R	H	1239	1267
PSM	EDSRGSLIPEGATGFPDQGNTGENTR	214	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,4-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=18848	84.561	3	2804.2153	2804.2153	R	Q	1235	1261
PSM	ELVSSSSSGSDSDSEVDKK	215	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=4365	19.602	2	2033.8717	2033.8717	K	L	6	25
PSM	ESISPQPADSACSSPAPSTGKVEAALNENTCR	216	sp|Q9GZR1-2|SENP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,12-UNIMOD:4,31-UNIMOD:4	ms_run[2]:scan=17509	77.911	3	3410.4756	3410.4756	R	A	342	374
PSM	FSKEEPVSSGPEEAVGK	217	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188,8-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=11019	49.229	2	1947.8307	1947.8307	K	S	562	579
PSM	GADFLVTEVENGGSLGSK	218	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24180	110.42	2	1778.8687	1778.8687	K	K	189	207
PSM	GAGDGSDEEVDGKADGAEAKPAE	219	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5421	24.139	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GGVTGSPEASISGSKGDLK	220	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10220	45.739	2	1831.866	1831.8660	K	S	5726	5745
PSM	GKLSAEENPDDSEVPSSSGINSTK	221	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,4-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=11109	49.605	2	2539.1366	2539.1366	K	S	40	64
PSM	GPFVEAEVPDVDLECPDAK	222	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=23842	108.68	2	2085.9565	2085.9565	K	L	1819	1838
PSM	GSDGEDSASGGKTPAPGPEAASGEWELLR	223	sp|Q14674-2|ESPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=22903	103.97	3	2907.256	2907.2560	R	L	1182	1211
PSM	IACKSPPPESVDTPTSTK	224	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,4-UNIMOD:188,5-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6869	30.542	2	2005.947	2005.9470	K	Q	1127	1145
PSM	IAQLEEELEEEQGNTELINDR	225	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:267	ms_run[2]:scan=24069	109.84	3	2481.1746	2481.1746	R	L	1731	1752
PSM	IAVYSCPFDGMITETK	226	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=24165	110.35	2	1836.8733	1836.8733	K	G	166	182
PSM	ILQEKLDQPVSAPPSPR	227	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13996	62.691	2	2033.9588	2033.9588	R	D	230	247
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	228	sp|P13051|UNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=14539	64.989	3	2621.1412	2621.1412	K	I	50	74
PSM	KPISDNSFSSDEEQSTGPIK	229	sp|O60293-2|ZC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,9-UNIMOD:21,10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=14066	62.976	2	2336.9853	2336.9853	R	Y	1295	1315
PSM	LASGEDDPFDSDFSCPVK	230	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=21399	96.635	2	1990.8562	1990.8562	K	L	377	395
PSM	LASGEDDPFDSDFSCPVK	231	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=21406	96.661	2	1984.836	1984.8360	K	L	377	395
PSM	LGAGEGGEASVSPEKTSTTSK	232	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=5950	26.378	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LSEEAECPNPSTPSKAAK	233	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,12-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5325	23.691	2	2006.9059	2006.9059	K	F	941	959
PSM	NEEDAAELVALAQAVNAR	234	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=27671	130.37	2	1892.9467	1892.9467	R	A	311	329
PSM	SADGSAPAGEGEGVTLQR	235	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8762	39.421	2	1700.7966	1700.7966	K	N	31	49
PSM	SPSTTYLHTPTPSEDAAIPSK	236	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=16223	72.112	2	2285.056	2285.0560	R	S	775	796
PSM	SQIFSTASDNQPTVTIK	237	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=17151	76.202	2	1841.9466	1841.9466	K	V	448	465
PSM	SQQQEQQDPLEKQQLSPSPGQEAGILPETEK	238	sp|Q17RY0-2|CPEB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:188,16-UNIMOD:21,31-UNIMOD:188	ms_run[2]:scan=19422	87.352	3	3538.6867	3538.6867	K	A	82	113
PSM	SQSESSDEVTELDLSHGK	239	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=13454	60.296	2	2026.8368	2026.8368	R	K	657	675
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	240	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=21544	97.314	3	2692.1753	2692.1753	R	L	42	66
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	241	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=21595	97.594	3	2704.2155	2704.2155	R	L	42	66
PSM	SSSPAPADIAQTVQEDLR	242	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24955	114.52	2	1883.9225	1883.9225	K	T	230	248
PSM	SSSTGNLLDKDDLAIPPPDYGAASR	243	sp|Q9UQB8-3|BAIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=23638	107.63	2	2639.2116	2639.2116	K	A	452	477
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	244	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=19986	90.111	3	3904.8619	3904.8619	R	G	1235	1271
PSM	SVSESHTSCPAESASDAAPLQR	245	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=9803	43.956	2	2365.9846	2365.9846	K	S	96	118
PSM	TDKSSASAPDVDDPEAFPALA	246	sp|Q8NC51-2|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188	ms_run[2]:scan=21715	98.152	2	2108.9845	2108.9845	R	-	382	403
PSM	TGSYGALAEITASKEGQK	247	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=17177	76.312	2	1901.9174	1901.9174	K	E	356	374
PSM	TTDEGAKNNEESPTATVAEQGEDITSK	248	sp|Q13451-2|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=13359	59.869	3	2901.2401	2901.2401	M	K	2	29
PSM	TTKTPEDGDYSYEIIEK	249	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188,4-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=15777	70.25	2	2079.9328	2079.9328	K	T	1929	1946
PSM	VANPSGNLTETYVQDR	250	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=13728	61.518	2	1772.8569	1772.8569	R	G	1297	1313
PSM	VQEHEDSGDSEVENEAK	251	sp|Q9Y5J1|UTP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=3952	17.934	2	1986.7787	1986.7787	R	G	115	132
PSM	QITSYGETCPGLEQYAIKK	252	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,9-UNIMOD:4,18-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=21276	96.04296833333333	2	2180.0863	2180.0857	K	F	422	441
PSM	QITSYGETCPGLEQYAIKK	253	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=21270	96.01788166666667	2	2168.0469	2168.0454	K	F	422	441
PSM	TSIDAYDNFDNISLAQR	254	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	17-UNIMOD:267	ms_run[1]:scan=23239	105.65678333333332	2	1952.920781	1951.915104	R	L	1482	1499
PSM	SETAPAETATPAPVEKSPAKK	255	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7440	32.962555	2	2231.0799	2231.0717	M	K	2	23
PSM	CKSKNLEDDTLSECK	256	sp|Q14966|ZN638_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=10596	47.37511	2	1889.7642	1888.7582	R	Q	639	654
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	257	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=24121	110.10058166666667	3	3176.535500	3175.546831	R	A	655	686
PSM	ELDALDANDELTPLGR	258	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=22818	103.55016833333333	2	1741.840547	1740.853008	R	I	838	854
PSM	SETAPAAPAAPAPAEKTPVK	259	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1	ms_run[1]:scan=10046	45.0218	2	1945.0190	1945.0151	M	K	2	22
PSM	EREESEDELEEANGNNPIDIEVDQNK	260	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:21	ms_run[1]:scan=19454	87.49588	3	3095.276577	3094.288807	R	E	256	282
PSM	VQAYEEPSVASSPNGKESDLR	261	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21,16-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=12316	55.247078333333334	2	2359.058735	2358.071149	R	R	719	740
PSM	VQAYEEPSVASSPNGKESDLR	262	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:21	ms_run[1]:scan=12479	55.951640000000005	3	2343.030000	2342.042751	R	R	719	740
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	263	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=12308	55.213033333333335	3	3261.3686	3261.3655	R	G	54	87
PSM	RGGGSGGGEESEGEEVDED	264	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21	ms_run[1]:scan=2866	13.199306666666669	2	1931.674885	1930.670169	R	-	294	313
PSM	ADHSFSDGVPSDSVEAAKNASNTEK	265	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=15577	69.40541166666667	3	2684.1266	2684.1234	M	L	2	27
PSM	AAPEASSPPASPLQHLLPGK	266	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22338	101.11	2	2133.0004	2133.0004	K	A	673	693
PSM	ADDLLPLGDQTQDGDFGSR	267	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=21793	98.507	2	2028.9264	2028.9264	R	L	420	439
PSM	AESPAEKVPEESVLPLVQK	268	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=21076	95.115	3	2129.0657	2129.0657	K	S	488	507
PSM	AGLESGAEPGDGDSDTTKK	269	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=4001	18.122	2	1913.7892	1913.7892	K	K	481	500
PSM	AVTPVPTKTEEVSNLK	270	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=11454	51.16	2	1791.9019	1791.9019	R	T	447	463
PSM	CDPESVISQSHPSPSSEVTGPTFTENSVK	271	sp|P24278|ZBT25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,13-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=20081	90.518	3	3188.3952	3188.3952	R	I	208	237
PSM	DAEKTPAVSISCLELSNNLEK	272	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=23776	108.35	3	2397.1135	2397.1135	K	K	458	479
PSM	DAEKTPAVSISCLELSNNLEK	273	sp|Q9Y6M5|ZNT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=24250	110.78	2	2397.1135	2397.1135	K	K	458	479
PSM	DAHDVSPTSTDTEAQLTVER	274	sp|Q8IVF2-3|AHNK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=13084	58.594	3	2260.9724	2260.9724	R	Q	189	209
PSM	DSSDSADGRATPSENLVPSSAR	275	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=10793	48.293	3	2297.9761	2297.9761	R	V	184	206
PSM	EILGTAQSVGCNVDGR	276	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=13761	61.639	2	1674.7995	1674.7995	K	H	131	147
PSM	EKPDSDDDLDIASLVTAK	277	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=24488	112.03	2	2010.9035	2010.9035	R	L	655	673
PSM	EKPDSDDDLDIASLVTAK	278	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=24680	113.04	2	2010.9035	2010.9035	R	L	655	673
PSM	EQGTESRSSTPLPTISSSAENTR	279	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=13137	58.82	3	2514.1235	2514.1235	R	Q	151	174
PSM	ESDQTLAALLSPKESSGGEK	280	sp|P18583-10|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=20583	92.868	2	2138.0183	2138.0183	K	E	1687	1707
PSM	ESEDSETQPFDTHLEAYGPCLSPPR	281	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=23498	106.94	3	2941.2113	2941.2113	R	A	759	784
PSM	GGVTGSPEASISGSKGDLK	282	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10761	48.154	2	1837.8861	1837.8861	K	S	5726	5745
PSM	GSSGSPAHAESYSSGGGGQQK	283	sp|P15408|FOSL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=1458	7.819	2	2020.8219	2020.8219	R	F	15	36
PSM	IACDEEFSDSEDEGEGGRR	284	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=8551	38.513	2	2336.8045	2336.8045	R	N	385	404
PSM	IISNASCTTNCLAPLAK	285	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=15637	69.669	2	1832.9125	1832.9125	K	V	104	121
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	286	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=21615	97.678	3	2861.3501	2861.3501	R	A	162	190
PSM	LLDPEDVDVPQPDEK	287	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18404	82.132	2	1707.8203	1707.8203	R	S	203	218
PSM	LQVTNVLSQPLTQATVK	288	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:188	ms_run[2]:scan=23379	106.37	2	1845.0667	1845.0667	R	L	258	275
PSM	LTTTGQVTSPVKGASFVTSTNPR	289	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=16432	72.904	2	2428.1999	2428.1999	K	K	115	138
PSM	NPDDITQEEYGEFYK	290	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18763	84.054	2	1846.7897	1846.7897	R	S	292	307
PSM	NTDVAQSPEAPKQEAPAK	291	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=4079	18.443	2	1959.8939	1959.8939	R	K	179	197
PSM	PAEATSSPTSPERPR	292	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=2108	10.227	2	1741.7074	1741.7074	R	H	211	226
PSM	RVSVCAETYNPDEEEEDTDPR	293	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=12978	58.102	3	2610.0332	2610.0332	R	V	97	118
PSM	SCSEEKIPEDGSLNTTK	294	sp|P37173|TGFR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=9845	44.132	2	1973.8289	1973.8289	R	-	551	568
PSM	SEAGHASSPDSEVTSLCQK	295	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10815	48.382	2	2074.861	2074.8610	K	E	353	372
PSM	SEEISESESEETNAPKK	296	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=5335	23.738	2	1972.815	1972.8150	R	T	73	90
PSM	SETAPAAPAAPAPAEKTPVK	297	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=7927	35.564	2	1982.9714	1982.9714	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	298	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=6437	28.628	2	2060.9667	2060.9667	M	K	2	22
PSM	SGGGSVGAVVVKQEPLEEDSPSSSSAGLDK	299	sp|P15408|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:188,20-UNIMOD:21,30-UNIMOD:188	ms_run[2]:scan=16460	73.04	3	2964.4004	2964.4004	R	A	211	241
PSM	SKSLGDLTSEDIACNFESK	300	sp|Q4KWH8-2|PLCH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=21914	99.107	2	2179.9344	2179.9344	K	Y	1454	1473
PSM	SLSELESLKLPAESNEK	301	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=23473	106.82	2	1952.9344	1952.9344	R	I	238	255
PSM	SLSELESLKLPAESNEK	302	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=24476	111.97	2	1952.9344	1952.9344	R	I	238	255
PSM	SLSELESLKLPAESNEK	303	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,9-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=24508	112.13	2	1964.9746	1964.9746	R	I	238	255
PSM	SLSKSDSDLLTCSPTEDATMGSR	304	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=18265	81.333	3	2537.0663	2537.0663	R	S	622	645
PSM	SQEQLAAELAEYTAK	305	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=22790	103.42	2	1650.8101	1650.8101	K	I	413	428
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	306	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=14884	66.583	3	3059.1789	3059.1789	R	S	373	399
PSM	SSSTGNLLDKDDLAIPPPDYGAASR	307	sp|Q9UQB8-3|BAIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=23407	106.49	2	2639.2116	2639.2116	K	A	452	477
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	308	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=20209	91.144	3	3904.8619	3904.8619	R	G	1235	1271
PSM	SSVKTPETVVPAAPELQPSTSTDQPVTPEPTSR	309	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=18906	84.829	3	3512.6924	3512.6924	R	A	1522	1555
PSM	SVEDDEEGHLICQSGDVLSAR	310	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,12-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=20057	90.396	2	2405.0082	2405.0082	R	Y	140	161
PSM	SWLSPRVSPPASPGP	311	sp|Q9Y4U1|MMAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=21454	96.872	2	1613.7603	1613.7603	R	-	268	283
PSM	SYSSPDITQAIQEEEKR	312	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=19989	90.124	2	2059.9099	2059.9099	R	K	610	627
PSM	TESGCDAEGRASPAEGSAGSPGSPTCCR	313	sp|A4D1S0-2|KLRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,10-UNIMOD:267,12-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=5487	24.399	3	2910.1119	2910.1119	R	C	193	221
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	314	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=15261	68.091	3	2909.304	2909.3040	R	V	1118	1147
PSM	TQSSASLAASYAAQQHPQAAASYR	315	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=14523	64.928	2	2544.1394	2544.1394	R	G	518	542
PSM	TTKSPSDSGYSYETIGK	316	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,4-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=10656	47.646	2	1911.8542	1911.8542	R	T	1912	1929
PSM	VASETHSEGSEYEELPK	317	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=10918	48.823	2	1970.8146	1970.8146	R	R	1130	1147
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	318	sp|Q5JTV8|TOIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=11749	52.611	2	2841.1445	2841.1445	K	A	212	237
PSM	VNQIGSVTESLQACK	319	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4	ms_run[2]:scan=15902	70.768	2	1632.8141	1632.8141	K	L	344	359
PSM	VQVAALQASPPLDQDDR	320	sp|Q9UDY2-6|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=16657	73.972	2	1831.9304	1831.9304	K	A	126	143
PSM	YSLQSANASSLSSGQLKSPSLSQSQASR	321	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:21	ms_run[2]:scan=17405	77.407	3	2948.3877	2948.3877	R	V	392	420
PSM	YYSPCEEHPAETNQNEGAESGTIR	322	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=10430	46.633	3	2828.1261	2828.1261	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGAESGTIR	323	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10465	46.801	3	2818.1178	2818.1178	R	Q	182	206
PSM	SETAPAETATPAPVEKSPAKK	324	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8021	35.989781666666666	2	2231.0778	2231.0717	M	K	2	23
PSM	SETAPAETATPAPVEKSPAKK	325	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7613	33.968334999999996	2	2231.0795	2231.0717	M	K	2	23
PSM	LYIGNLNESVTPADLEK	326	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	17-UNIMOD:188	ms_run[1]:scan=23731	108.12826833333334	2	1881.985312	1880.982688	K	V	4	21
PSM	DSDKEGTSNSTSEDGPGDGFTILSSK	327	sp|Q9P0M6|H2AW_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=19250	86.52523166666667	3	2713.098112	2710.113075	K	S	164	190
PSM	QTELFAHFIQPAAQKTPTSPLK	328	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,15-UNIMOD:188,16-UNIMOD:21,19-UNIMOD:21,22-UNIMOD:188	ms_run[1]:scan=29372	142.07841000000002	3	2607.2598	2607.2573	K	M	98	120
PSM	EKPDSDDDLDIASLVTAK	329	sp|Q86V48|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:27,5-UNIMOD:21	ms_run[1]:scan=26358	122.30772666666667	2	1992.8948	1992.8924	R	L	655	673
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEPR	330	sp|Q9P2K5|MYEF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=14726	65.88437333333333	3	2986.3463	2986.3453	M	R	2	31
PSM	WSNIYEDNGDDAPQNAK	331	sp|Q8N6N3|CA052_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	17-UNIMOD:188	ms_run[1]:scan=13111	58.71901666666666	2	1942.830860	1941.843628	K	K	128	145
PSM	STIGVMVTASHNPEEDNGVK	332	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=15183	67.77757333333332	2	2164.934571	2163.950764	K	L	55	75
PSM	AAPEASSPPASPLQHLLPGK	333	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22413	101.46	2	2126.9803	2126.9803	K	A	673	693
PSM	AATSGVPSIYAPSTYAHLSPAK	334	sp|Q86X29-6|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=21169	95.562	2	2274.1029	2274.1029	K	T	158	180
PSM	AGAIAPCEVTVPAQNTGLGPEK	335	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=17352	77.138	2	2185.1144	2185.1144	R	T	113	135
PSM	AGDVEEDASQLIFPK	336	sp|O15514|RPB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24473	111.96	2	1617.7886	1617.7886	R	E	10	25
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	337	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=13189	59.079	3	3183.2517	3183.2517	R	-	502	532
PSM	AGLESGAEPGDGDSDTTKK	338	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=4257	19.171	2	1913.7892	1913.7892	K	K	481	500
PSM	APYQENDGYCPDLELSDSEAESDGNKEK	339	sp|Q92613|JADE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=17270	76.758	3	3239.2762	3239.2762	R	V	759	787
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	340	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=16030	71.337	3	2789.2772	2789.2772	R	T	112	140
PSM	ASSKGGGGYTCQSGSGWDEFTK	341	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,4-UNIMOD:188,11-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=16569	73.628	2	2357.9663	2357.9663	R	H	164	186
PSM	AVEDAKGSSSDSTAGVKE	342	sp|Q86TU7|SETD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=2415	11.393	2	1816.7728	1816.7728	R	-	577	595
PSM	AVTPVPTKTEEVSNLK	343	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=11246	50.147	2	1803.9422	1803.9422	R	T	447	463
PSM	CTGGEVGATSALAPK	344	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=9130	41.079	2	1423.7073	1423.7073	R	I	17	32
PSM	EEPLSEEEPCTSTAIASPEKK	345	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,10-UNIMOD:4,20-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=13849	62.011	2	2423.0854	2423.0854	K	K	498	519
PSM	EGTLTQVPLAPPPPGAPPSPAPAR	346	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=19452	87.484	2	2397.2094	2397.2094	K	F	1129	1153
PSM	EKPDSDDDLDIASLVTAK	347	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,5-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=24578	112.51	2	2022.9437	2022.9437	R	L	655	673
PSM	EKPDSDDDLDIASLVTAK	348	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=24298	111.02	2	2010.9035	2010.9035	R	L	655	673
PSM	GADFLVTEVENGGSLGSK	349	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24168	110.36	2	1778.8687	1778.8687	K	K	189	207
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	350	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=24877	114.1	3	2431.1719	2431.1719	R	S	258	284
PSM	GCDSPDPDTSYVLTPHTEEK	351	sp|Q02078-3|MEF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=14069	62.989	2	2326.9301	2326.9301	R	Y	95	115
PSM	GSSQPNLSTSHSEQEYGK	352	sp|O95208-3|EPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=6407	28.526	2	2014.8269	2014.8269	R	A	132	150
PSM	GTLDEEDEEADSDTDDIDHR	353	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=10994	49.121	2	2365.8583	2365.8583	R	V	232	252
PSM	IACKSPPPESVDTPTSTK	354	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,4-UNIMOD:188,5-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6639	29.504	2	2005.947	2005.9470	K	Q	1127	1145
PSM	IEDVGSDEEDDSGKDK	355	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=3341	15.019	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	356	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3737	16.985	2	1828.729	1828.7290	K	K	250	266
PSM	IGSDGSQEDAKEDGFGSEVIK	357	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=14851	66.459	3	2246.958	2246.9580	K	V	225	246
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	358	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:21,28-UNIMOD:188	ms_run[2]:scan=21417	96.707	3	2873.3903	2873.3903	R	A	162	190
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	359	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=21171	95.569	3	2861.3501	2861.3501	R	A	162	190
PSM	KETESEAEDNLDDLEK	360	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=13678	61.304	2	1943.7885	1943.7885	K	H	868	884
PSM	LASGEDDPFDSDFSCPVK	361	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=21184	95.629	2	1990.8562	1990.8562	K	L	377	395
PSM	LASGEDDPFDSDFSCPVK	362	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=21507	97.146	2	1990.8562	1990.8562	K	L	377	395
PSM	LDVKSIDDEDVDENEDDVYGNSSGR	363	sp|Q8IUI4|S29P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=17864	79.405	3	2864.1509	2864.1509	K	K	187	212
PSM	LGIYDADGDGDFDVDDAK	364	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20719	93.444	2	1899.801	1899.8010	K	V	102	120
PSM	LIASYCNVGDIEGASK	365	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=16976	75.439	2	1701.8339	1701.8339	R	I	203	219
PSM	LPPNTNDEVDEDPTGNK	366	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8643	38.944	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LQIGPPSPGEAQGPLLPSPAR	367	sp|Q9HCH0-2|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=23045	104.7	3	2161.0933	2161.0933	K	G	430	451
PSM	LQVELDNVTGLLSQSDSK	368	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=26926	125.73	2	1945.0004	1945.0004	K	S	1278	1296
PSM	LSEAVWQPEEHYSSSPEK	369	sp|Q9Y485|DMXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=16490	73.205	2	2181.9256	2181.9256	K	I	904	922
PSM	MDRTPPPPTLSPAAITVGR	370	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=18849	84.563	3	2135.984	2135.9840	R	G	587	606
PSM	NADSQEDAEELKATTR	371	sp|Q9P266|JCAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=7327	32.286	2	1856.7789	1856.7789	R	G	1278	1294
PSM	NEEDAAELVALAQAVNAR	372	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=27676	130.39	2	1882.9385	1882.9385	R	A	311	329
PSM	NPDDITNEEYGEFYK	373	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188	ms_run[2]:scan=18294	81.489	2	1838.7942	1838.7942	R	S	422	437
PSM	NSLEPQTTVVHNATDGIK	374	sp|Q13555-9|KCC2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=15795	70.316	2	2002.9361	2002.9361	K	G	337	355
PSM	NTVSQSISGDPEIDKK	375	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8198	36.926	2	1808.8596	1808.8596	R	I	307	323
PSM	NTVSQSISGDPEIDKK	376	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10938	48.918	2	1808.8596	1808.8596	R	I	307	323
PSM	NYAESDHSEDEDNDNNSATAEESTKK	377	sp|Q9P2R6|RERE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,8-UNIMOD:21,25-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=3845	17.489	3	3071.1229	3071.1229	K	N	49	75
PSM	RISSSSVQPCSEEVSTPQDSLAQCK	378	sp|P42694|HELZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,10-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=14167	63.407	3	2859.2416	2859.2416	R	E	1761	1786
PSM	RPPSPDVIVLSDNEQPSSPR	379	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,4-UNIMOD:21,18-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=17480	77.756	3	2369.0569	2369.0569	R	V	97	117
PSM	RVSVCAETYNPDEEEEDTDPR	380	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=12802	57.355	3	2590.0167	2590.0167	R	V	97	118
PSM	SASPDDDLGSSNWEAADLGNEERK	381	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=18704	83.768	2	2642.077	2642.0770	R	Q	15	39
PSM	SASTEKLEQGTSALIR	382	sp|Q8IWC1-2|MA7D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=16619	73.824	2	1769.8561	1769.8561	R	Q	183	199
PSM	SGCIVNNLAEFTVDPK	383	sp|O75369-8|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=24809	113.73	2	1768.8761	1768.8761	K	D	658	674
PSM	SGCIVNNLAEFTVDPK	384	sp|O75369-8|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4	ms_run[2]:scan=24836	113.88	2	1762.856	1762.8560	K	D	658	674
PSM	SGCSDLEEAVDSGADKK	385	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,3-UNIMOD:4,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=13977	62.619	2	1858.7695	1858.7695	K	F	659	676
PSM	SLLDIISDPDAGTPEDK	386	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=25820	119.25	2	1790.8881	1790.8881	K	M	345	362
PSM	SNSTETLSPAKSPSSSTGSIASSR	387	sp|Q9P0K1-5|ADA22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=9633	43.24	3	2418.0912	2418.0912	R	K	819	843
PSM	SQIFSTASDNQPTVTIK	388	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17127	76.102	2	1835.9265	1835.9265	K	V	448	465
PSM	SQTGDVSPKAQQPSEVTLK	389	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=9890	44.342	2	2078.9885	2078.9885	K	S	1002	1021
PSM	SSGHSSSELSPDAVEK	390	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=7250	31.935	2	1701.719	1701.7190	R	A	1378	1394
PSM	SSLGQSASETEEDTVSVSKK	391	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=11505	51.38	2	2147.9471	2147.9471	R	E	302	322
PSM	SSLGQSASETEEDTVSVSKK	392	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=12209	54.768	2	2147.9471	2147.9471	R	E	302	322
PSM	SSSADFGTFNTSQSHQTASAVSK	393	sp|P52594-2|AGFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=13139	58.832	2	2430.0432	2430.0432	K	V	251	274
PSM	SSSTGNLLDKDDLAIPPPDYGAASR	394	sp|Q9UQB8-3|BAIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=23197	105.42	2	2639.2116	2639.2116	K	A	452	477
PSM	SVIEQGGIQTVDQLIK	395	sp|Q8WUM4-2|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=25014	114.84	2	1726.9465	1726.9465	R	E	428	444
PSM	SYELPDGQVITIGNER	396	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=21212	95.756	2	1799.8929	1799.8929	K	F	239	255
PSM	SYSSPDITQAIQEEEKR	397	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=19791	89.123	2	2059.9099	2059.9099	R	K	610	627
PSM	TCDIVIEGSQSPTSPASSSPKPGSK	398	sp|Q9UK96|FBX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=11763	52.667	3	2596.1728	2596.1728	K	A	308	333
PSM	TEESPASDEAGEKEAK	399	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=1321	7.3585	2	1756.704	1756.7040	K	S	83	99
PSM	TLSDDLDEAAKEFQEK	400	sp|Q9H0A0-2|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=27786	131.15	2	1929.8647	1929.8647	K	H	860	876
PSM	TSDPTQDLHFTPLLSPSSSTSASSTAK	401	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21,27-UNIMOD:188	ms_run[2]:scan=23311	106.02	3	2848.3111	2848.3111	K	T	451	478
PSM	TSEIEPKNSPEDLGLSLTGDSCK	402	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=19864	89.466	2	2556.1302	2556.1302	K	L	492	515
PSM	TSEIEPKNSPEDLGLSLTGDSCK	403	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=19616	88.24	3	2568.1705	2568.1705	K	L	492	515
PSM	TSSKESSPIPSPTSDRK	404	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4404	19.739	2	2042.8	2042.8000	R	A	2159	2176
PSM	TVEVAEGEAVRTPQSVTAK	405	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=11029	49.278	2	2050.9936	2050.9936	R	Q	132	151
PSM	TYVDPHTYEDPNQAVLK	406	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=12962	58.029	2	2068.9143	2068.9143	K	F	587	604
PSM	VASGSDLHLTDIDSDSNR	407	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=15217	67.929	2	1980.8426	1980.8426	K	G	70	88
PSM	VINEPTAAALAYGLDK	408	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=22462	101.7	2	1650.8924	1650.8924	R	S	219	235
PSM	VLQATVVAVGSGSK	409	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188	ms_run[2]:scan=11594	51.843	2	1320.7708	1320.7708	K	G	41	55
PSM	VTLQDYRLPDSDDDEDEETAIQR	410	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=20112	90.667	3	2802.1869	2802.1869	R	V	169	192
PSM	VTLQDYRLPDSDDDEDEETAIQR	411	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:267,11-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=20223	91.199	3	2822.2034	2822.2034	R	V	169	192
PSM	VTQHESDNENEIQIQNK	412	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=7097	31.438	2	2104.9063	2104.9063	R	L	117	134
PSM	VVSSTSEEEEAFTEKFLK	413	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=25527	117.58	2	2151.0063	2151.0063	R	I	131	149
PSM	YQKLPSDEDESGTEESDNTPLLK	414	sp|Q9ULH0-5|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=15519	69.177	3	2674.1535	2674.1535	R	D	288	311
PSM	YRIQEQESSGEEDSDLSPEER	415	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,8-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=11777	52.732	3	2662.0224	2662.0224	K	E	114	135
PSM	YRIQEQESSGEEDSDLSPEER	416	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=12152	54.491	3	2642.0058	2642.0058	K	E	114	135
PSM	CIPALDSLTPANEDQK	417	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=28407	135.23902833333335	2	1753.8209	1753.8187	R	I	447	463
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	418	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=13201	59.13788	3	3173.247129	3173.243468	R	-	738	768
PSM	QSFDDNDSEELEDKDSK	419	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,8-UNIMOD:21,14-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=11664	52.198679999999996	2	2074.7957	2074.7926	K	S	106	123
PSM	SETAPAAPAAAPPAEKAPVK	420	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=9784	43.88579	2	1915.0088	1915.0046	M	K	2	22
PSM	EREESEDELEEANGNNPIDIEVDQNK	421	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21	ms_run[1]:scan=19392	87.20738166666666	3	3095.276577	3094.288807	R	E	256	282
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	422	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,3-UNIMOD:188,7-UNIMOD:188,16-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=8548	38.49972833333333	3	3029.3859	3029.3776	K	S	145	174
PSM	SYSSPDITQAIQEEEKR	423	sp|P40818|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21,16-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=20389	91.95846	2	2075.930376	2075.938343	R	K	716	733
PSM	QGDETPSTNNGSDDEKTGLK	424	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=6538	29.066511666666663	2	2154.8638	2154.8585	R	I	31	51
PSM	NSESESNKVAAETQSPSLFGSTK	425	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	17-UNIMOD:21	ms_run[1]:scan=13811	61.82932333333333	3	2480.103115	2477.095908	R	L	207	230
PSM	LSVSESSHTESDSSPPMTVRR	426	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=20946	94.495235	3	2608.944685	2607.935612	R	R	908	929
PSM	AAVLSDSEDEEKASAK	427	sp|Q96ST2-2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=5831	25.805	2	1728.7455	1728.7455	K	K	69	85
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	428	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=18683	83.65	3	3062.4016	3062.4016	K	S	2194	2221
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	429	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=19292	86.746	3	3062.4016	3062.4016	K	S	2194	2221
PSM	AEASSPVPYLSPETNPASSTSAVNHNVNLTNVR	430	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=21769	98.381	3	3502.6366	3502.6366	K	L	923	956
PSM	AGAIAPCEVTVPAQNTGLGPEK	431	sp|P05388-2|RLA0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=17349	77.124	2	2179.0943	2179.0943	R	T	113	135
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	432	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12900	57.761	3	3183.2517	3183.2517	R	-	502	532
PSM	AGPESDAQYQFTGIK	433	sp|Q96IX5|ATPMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=16167	71.886	2	1616.7778	1616.7778	M	K	2	17
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	434	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,15-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=21045	94.956	3	3664.6141	3664.6141	R	A	360	392
PSM	ANSSGLYKCELCEFNSK	435	sp|Q9UID6|ZN639_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=17795	79.145	2	2085.8537	2085.8537	R	Y	198	215
PSM	ASSKGGGGYTCQSGSGWDEFTK	436	sp|P15924-2|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=16568	73.626	2	2345.926	2345.9260	R	H	164	186
PSM	ATNESEDEIPQLVPIGK	437	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=22090	99.907	2	1844.9463	1844.9463	K	K	357	374
PSM	AYSSDRSGTSNSQSQAK	438	sp|O00444-3|PLK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=781	5.4936	2	1852.7589	1852.7589	R	T	335	352
PSM	CIPALDSLTPANEDQK	439	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=19350	87.009	2	1776.8659	1776.8659	R	I	447	463
PSM	CTLPEHESPSQDISDACEAESTER	440	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15205	67.882	3	2827.095	2827.0950	R	C	670	694
PSM	DASDDLDDLNFFNQK	441	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=27015	126.26	2	1761.7789	1761.7789	K	K	65	80
PSM	DTTKLEPASPPEDTSAEVSR	442	sp|Q9UHL9-2|GT2D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=11036	49.303	2	2208.9788	2208.9788	K	A	440	460
PSM	EKPDSDDDLDIASLVTAK	443	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,5-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=24778	113.58	2	2022.9437	2022.9437	R	L	655	673
PSM	EKPDSDDDLDIASLVTAK	444	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=25066	115.13	2	2010.9035	2010.9035	R	L	655	673
PSM	ESEDKPEIEDVGSDEEEEK	445	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=10142	45.433	2	2271.8792	2271.8792	K	K	373	392
PSM	EVIEIEDASPTKCPITTK	446	sp|P46100-2|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=16499	73.256	2	2109.9905	2109.9905	R	L	1315	1333
PSM	FGYVDFESAEDLEK	447	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=24152	110.28	2	1647.7304	1647.7304	K	A	349	363
PSM	FSKEEPVSSGPEEAVGK	448	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10875	48.625	3	1935.7904	1935.7904	K	S	562	579
PSM	GADDAADADTAIINAEGGQNNSEEKKEYFI	449	sp|Q9BY67-5|CADM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,25-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=23557	107.22	3	3247.4233	3247.4233	K	-	385	415
PSM	GASPNRSTSVSSQAAQAASPQVPATTTPK	450	sp|Q03001|DYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=11657	52.168	3	2876.3665	2876.3665	R	G	7414	7443
PSM	GDSLKEPTSIAESSR	451	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10810	48.363	2	1655.7404	1655.7404	R	H	325	340
PSM	GKLSAEENPDDSEVPSSSGINSTK	452	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=11093	49.538	2	2527.0963	2527.0963	K	S	40	64
PSM	GSLGSQGAKDEPEEELQK	453	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,9-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10250	45.874	2	1992.908	1992.9080	K	G	1368	1386
PSM	GSSQPNLSTSHSEQEYGK	454	sp|O95208-3|EPN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=6647	29.544	2	2014.8269	2014.8269	R	A	132	150
PSM	GVVDSDDLPLNVSR	455	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=19576	88.064	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	456	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=19981	90.089	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	457	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=20197	91.097	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	458	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=20426	92.119	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	459	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=21660	97.886	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	460	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=26867	125.37	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	461	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=29011	139.48	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	462	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=30393	149.58	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	463	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=31800	158.69	2	1494.7554	1494.7554	K	E	435	449
PSM	GVVDSDDLPLNVSR	464	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18732	83.886	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	465	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20520	92.569	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	466	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21445	96.83	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVPLAGTDGETTTQGLDGLSER	467	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:267	ms_run[2]:scan=21316	96.26	3	2282.1266	2282.1266	K	C	112	135
PSM	IACKSPPPESVDTPTSTK	468	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=6838	30.404	2	1993.9068	1993.9068	K	Q	1127	1145
PSM	IAQLEEELEEEQGNTELINDR	469	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=24049	109.74	3	2471.1664	2471.1664	R	L	1731	1752
PSM	IEDVGSDEEDDSGKDK	470	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3746	17.031	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEVLSPEGSPSKSPSK	471	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:188,14-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=9866	44.239	2	1861.9113	1861.9113	K	K	636	653
PSM	IGSDGSQEDAKEDGFGSEVIK	472	sp|Q9Y462|ZN711_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,11-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=14882	66.573	3	2258.9983	2258.9983	K	V	225	246
PSM	IQVLQQQADDAEER	473	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11162	49.834	2	1641.7958	1641.7958	K	A	14	28
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	474	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:21,28-UNIMOD:188	ms_run[2]:scan=21152	95.483	3	2873.3903	2873.3903	R	A	162	190
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	475	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=21835	98.717	3	2861.3501	2861.3501	R	A	162	190
PSM	KSTAALEEDAQILK	476	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=16433	72.907	2	1595.7808	1595.7808	R	V	524	538
PSM	LALEDSENTASTNCDSSSEGLEKDTATQR	477	sp|Q49AR2|CE022_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=13753	61.61	3	3208.3351	3208.3351	K	S	182	211
PSM	LDDDDEGVPSSALR	478	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11553	51.62	2	1487.674	1487.6740	R	E	37	51
PSM	LLDPEDVNVDQPDEK	479	sp|O15020-2|SPTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16080	71.548	2	1724.8105	1724.8105	K	S	253	268
PSM	LRTNLQPLESTQSQDF	480	sp|Q9Y248|PSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=20375	91.895	2	1955.899	1955.8990	K	-	170	186
PSM	LSEEAECPNPSTPSKAAK	481	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=5301	23.592	2	1994.8656	1994.8656	K	F	941	959
PSM	LSGSNPYTTVTPQIINSK	482	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=18489	82.622	2	1925.0201	1925.0201	K	W	215	233
PSM	LSGSNPYTTVTPQIINSK	483	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18512	82.765	2	1919	1919.0000	K	W	215	233
PSM	LSQSSQDSSPVRNLQSFGTEEPAYSTR	484	sp|O95251|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=19705	88.676	3	3050.3619	3050.3619	R	R	49	76
PSM	LSVPTSDEEDEVPAPKPR	485	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=14264	63.786	2	2124.9018	2124.9018	K	G	104	122
PSM	LSVPTSDEEDEVPAPKPR	486	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=14494	64.794	2	2124.9018	2124.9018	K	G	104	122
PSM	LSVPTSDEEDEVPAPKPR	487	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=14707	65.801	2	2124.9018	2124.9018	K	G	104	122
PSM	LTTTGQVTSPVKGASFVTSTNPR	488	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=16333	72.562	3	2428.1999	2428.1999	K	K	115	138
PSM	LYIGNLNESVTPADLEK	489	sp|Q9NZI8|IF2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=23762	108.28	2	1874.9626	1874.9626	K	V	4	21
PSM	NEEENIYSVPHDSTQGK	490	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=8451	38.08	2	2031.8518	2031.8518	R	I	1099	1116
PSM	NEEPSEEEIDAPKPK	491	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,13-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=7510	33.35	2	1802.8014	1802.8014	K	K	49	64
PSM	NQDLAPNSAEQASILSLVTK	492	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27156	127.07	2	2098.0906	2098.0906	R	I	61	81
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	493	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=5878	26.04	3	3336.3553	3336.3553	R	R	157	186
PSM	PEIVDTCSLASPASVCR	494	sp|P09960-2|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=17399	77.377	2	1860.871	1860.8710	M	T	2	19
PSM	QTSNRSEPSGEINIDSSGETVGSGER	495	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=12660	56.76	3	2772.1836	2772.1836	R	C	515	541
PSM	RIPSIVSSPLNSPLDR	496	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=23894	108.95	2	1909.9064	1909.9064	K	S	327	343
PSM	RVSVCAETYNPDEEEEDTDPR	497	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=12806	57.37	2	2610.0332	2610.0332	R	V	97	118
PSM	SCGSSTPDEFPTDIPGTK	498	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4	ms_run[2]:scan=17000	75.536	2	1894.8255	1894.8255	R	G	104	122
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	499	sp|Q01831-2|XPC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=9170	41.24	3	2977.2086	2977.2086	K	I	832	862
PSM	SELPDSIESALQGDER	500	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=23418	106.55	2	1754.8198	1754.8198	R	C	300	316
PSM	SENQEFYQDTFGQQWK	501	sp|O60506-2|HNRPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=22493	101.86	3	2033.8755	2033.8755	K	-	573	589
PSM	SFEVEEVETPNSTPPR	502	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:267	ms_run[2]:scan=15675	69.822	2	1826.8562	1826.8562	R	R	11	27
PSM	SGKQGSPDQVSPVSEMTSTSLYQDK	503	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=19824	89.259	3	2735.1997	2735.1997	K	Q	1433	1458
PSM	SNSTETLSPAKSPSSSTGSIASSR	504	sp|Q9P0K1-5|ADA22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=9140	41.115	3	2418.0912	2418.0912	R	K	819	843
PSM	SSVKTPETVVPAAPELQPSTSTDQPVTPEPTSR	505	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=19146	86.005	3	3512.6924	3512.6924	R	A	1522	1555
PSM	STVTGERQSGDGQESTEPVENK	506	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=3879	17.62	2	2414.0235	2414.0235	K	V	140	162
PSM	STVTNEVKTEVLSPNSK	507	sp|Q8NEZ4-2|KMT2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=13319	59.684	2	1911.9191	1911.9191	K	V	1877	1894
PSM	SYLEGSSDNQLKDSESTPVDDR	508	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=13717	61.476	3	2521.0494	2521.0494	K	I	672	694
PSM	TCEERPAEDGSDEEDPDSMEAPTR	509	sp|Q9H6Y2|WDR55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,5-UNIMOD:267,11-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=9256	41.627	3	2822.0435	2822.0435	R	I	4	28
PSM	TCSDGGPSSELAHSPTNSGK	510	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=5224	23.273	2	2067.8205	2067.8205	R	K	769	789
PSM	TDEVPAGGSRSEAEDEDDEDYVPYVPLR	511	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,10-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=22863	103.78	3	3209.3465	3209.3465	R	Q	13	41
PSM	TFQEDSSPVVHQSLQEVSEPLTATK	512	sp|Q15678|PTN14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=19717	88.767	3	2836.3168	2836.3168	K	H	608	633
PSM	TGAIVDVPVGEELLGR	513	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25938	119.9	2	1623.8832	1623.8832	R	V	134	150
PSM	TKSENGLEFTSSGSANTETTK	514	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,2-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=10170	45.549	2	2280.0197	2280.0197	K	V	33	54
PSM	TLQEVTQLSQEAQR	515	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16061	71.464	2	1629.8322	1629.8322	K	I	112	126
PSM	TSDFNTFLAQEGCTK	516	sp|Q9UHD1-2|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=19577	88.066	2	1723.7819	1723.7819	K	G	180	195
PSM	TSEIEPKNSPEDLGLSLTGDSCK	517	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=19898	89.673	3	2568.1705	2568.1705	K	L	492	515
PSM	TSSKESSPIPSPTSDRK	518	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4090	18.495	2	2042.8	2042.8000	R	A	2159	2176
PSM	TSSTDEVLSLEEKDLR	519	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=20036	90.311	2	1900.8667	1900.8667	R	D	528	544
PSM	TTKSPSDSGYSYETIGK	520	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=10658	47.654	2	1899.8139	1899.8139	R	T	1912	1929
PSM	TTSLGDSLNAHSAAEK	521	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=8850	39.848	2	1686.7557	1686.7557	R	A	845	861
PSM	VAGTGEGGLEEMVEELNSGK	522	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:188	ms_run[2]:scan=27990	132.45	2	2010.9511	2010.9511	R	V	42	62
PSM	VDPSLMEDSDDGPSLPTK	523	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=17534	78.018	2	1907.8766	1907.8766	K	Q	87	105
PSM	VDSSTNSSPSPQQSESLSPAHTSDFR	524	sp|Q9BQE9-2|BCL7B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:21	ms_run[2]:scan=12083	54.227	3	2827.1934	2827.1934	K	T	45	71
PSM	VIPEDASESEEKLDQK	525	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10856	48.551	2	1907.8804	1907.8804	K	E	915	931
PSM	VIVVGNPANTNCLTASK	526	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=15143	67.597	2	1762.9343	1762.9343	K	S	37	54
PSM	VKEPSVQEATSTSDILK	527	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=15751	70.132	2	1910.9238	1910.9238	K	V	230	247
PSM	VNVEAPDVNLEGLGGK	528	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=20659	93.176	2	1615.8513	1615.8513	K	L	664	680
PSM	VVDLLAQDADIVCR	529	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=23431	106.61	2	1585.8134	1585.8134	K	C	46	60
PSM	VVDLLAQDADIVCR	530	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=23448	106.68	2	1595.8217	1595.8217	K	C	46	60
PSM	VVSSTSEEEEAFTEKFLK	531	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=25541	117.66	2	2138.9661	2138.9661	R	I	131	149
PSM	VYEIQDIYENSWTK	532	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=25146	115.56	2	1792.8615	1792.8615	K	L	88	102
PSM	YESQNTELKTQSPEFEAQSSK	533	sp|Q9H5H4|ZN768_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=10981	49.077	3	2510.085	2510.0850	R	F	149	170
PSM	YESQNTELKTQSPEFEAQSSK	534	sp|Q9H5H4|ZN768_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:188,12-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=11035	49.301	3	2522.1253	2522.1253	R	F	149	170
PSM	YNLDASEEEDSNKK	535	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=6490	28.854	2	1720.6829	1720.6829	K	K	183	197
PSM	YRIQEQESSGEEDSDLSPEER	536	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=12374	55.498	3	2642.0058	2642.0058	K	E	114	135
PSM	YRIQEQESSGEEDSDLSPEER	537	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=12605	56.534	3	2642.0058	2642.0058	K	E	114	135
PSM	YYSPCEEHPAETNQNEGSESGTIR	538	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9843	44.119	3	2834.1127	2834.1127	R	Q	182	206
PSM	CIPALDSLTPANEDQK	539	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=28552	136.25551666666667	2	1753.8204	1753.8187	R	I	447	463
PSM	STNGDTFLGGEDFDQALLR	540	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=28060	132.89767	2	2055.942729	2054.954513	K	H	266	285
PSM	QSFDDNDSEELEDKDSK	541	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,8-UNIMOD:21,14-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=11890	53.280765	2	2074.7957	2074.7926	K	S	106	123
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	542	sp|Q5T5Y3|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=15580	69.41803166666666	3	2910.302072	2909.304004	R	V	1396	1425
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	543	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7009	31.130886666666665	3	3007.3358	3007.3290	K	S	145	174
PSM	QFSSADEAALKEPIIK	544	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=22489	101.83927833333333	2	1728.8930	1728.8929	K	K	496	512
PSM	EKPDSDDDLDIASLVTAK	545	sp|Q86V48|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:27,5-UNIMOD:21	ms_run[1]:scan=26337	122.19743666666668	2	1992.8948	1992.8924	R	L	655	673
PSM	SGEENPASKPTPVQDVQGDGR	546	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=9689	43.48226666666667	2	2209.0320	2209.0242	M	W	2	23
PSM	LSVPTSDEEDEVPAPKPR	547	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=14242	63.69576166666667	2	2126.909775	2124.901763	K	G	104	122
PSM	AHSLLPVDDAINGLSEEQR	548	sp|P26440|IVD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=26029	120.40389666666665	2	2143.983788	2142.994678	R	Q	32	51
PSM	SSTSSIDSNISSKSAGLPVPK	549	sp|Q8IVL1|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,4-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=4076	18.428796666666667	3	2460.870962	2460.890634	R	L	1232	1253