MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL10.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL10.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	null	19-UNIMOD:21,21-UNIMOD:21	0.07	56.0	2	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,39-UNIMOD:267	0.03	51.0	2	1	0
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	127-UNIMOD:21	0.05	51.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188,692-UNIMOD:21,691-UNIMOD:21	0.07	49.0	6	2	0
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	329-UNIMOD:21,336-UNIMOD:267	0.03	48.0	3	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	169-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267,231-UNIMOD:188,232-UNIMOD:21,243-UNIMOD:4,259-UNIMOD:267	0.09	48.0	8	2	0
PRT	sp|Q2M2I8-2|AAK1_HUMAN	Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	18-UNIMOD:21	0.03	48.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	110-UNIMOD:21,108-UNIMOD:188,115-UNIMOD:188	0.05	47.0	4	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	47.0	13	1	0
PRT	sp|Q5VWJ9|SNX30_HUMAN	Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	67-UNIMOD:21,65-UNIMOD:21	0.07	47.0	3	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	47.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	398-UNIMOD:21,401-UNIMOD:267,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4	0.02	46.0	6	2	0
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	226-UNIMOD:21	0.01	46.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	157-UNIMOD:21,159-UNIMOD:21,154-UNIMOD:188,166-UNIMOD:188	0.04	46.0	2	1	0
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	36-UNIMOD:21	0.10	46.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1462-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	48-UNIMOD:267,50-UNIMOD:21,55-UNIMOD:4,63-UNIMOD:267,38-UNIMOD:21	0.05	46.0	26	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	207-UNIMOD:267,218-UNIMOD:21,225-UNIMOD:267	0.00	46.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.14	46.0	1	1	1
PRT	sp|Q5HYK7|SH319_HUMAN	SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	268-UNIMOD:385,268-UNIMOD:4,275-UNIMOD:21,283-UNIMOD:188,295-UNIMOD:188	0.04	46.0	3	1	0
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	674-UNIMOD:4,679-UNIMOD:21	0.03	45.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	129-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|Q9NQS1|AVEN_HUMAN	Cell death regulator Aven OS=Homo sapiens OX=9606 GN=AVEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	94-UNIMOD:21	0.10	45.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	160-UNIMOD:21,164-UNIMOD:21	0.01	45.0	1	1	1
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	106-UNIMOD:188,123-UNIMOD:4,125-UNIMOD:21,131-UNIMOD:188	0.05	44.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	85-UNIMOD:21,93-UNIMOD:188	0.03	44.0	2	1	0
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	87-UNIMOD:21,92-UNIMOD:267	0.06	44.0	2	1	0
PRT	sp|Q9UMN6|KMT2B_HUMAN	Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2348-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	487-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	576-UNIMOD:21,586-UNIMOD:267	0.03	44.0	7	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	214-UNIMOD:21,207-UNIMOD:188,224-UNIMOD:188,186-UNIMOD:21	0.03	44.0	3	2	1
PRT	sp|O75379|VAMP4_HUMAN	Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	23-UNIMOD:267,30-UNIMOD:21,39-UNIMOD:267	0.13	44.0	2	1	0
PRT	sp|Q9P2M7|CING_HUMAN	Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	131-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	686-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|Q8IX07|FOG1_HUMAN	Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	901-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9UPS6|SET1B_HUMAN	Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	1042-UNIMOD:21,1055-UNIMOD:21,1056-UNIMOD:21,1057-UNIMOD:21,1065-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P41212|ETV6_HUMAN	Transcription factor ETV6 OS=Homo sapiens OX=9606 GN=ETV6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	18-UNIMOD:21,39-UNIMOD:267,16-UNIMOD:21	0.06	43.0	4	1	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	247-UNIMOD:21,234-UNIMOD:188,254-UNIMOD:188	0.10	43.0	3	2	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	214-UNIMOD:21,209-UNIMOD:188,217-UNIMOD:21,219-UNIMOD:188	0.03	43.0	2	1	0
PRT	sp|Q9Y5S9|RBM8A_HUMAN	RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	56-UNIMOD:21	0.11	43.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	276-UNIMOD:21	0.06	43.0	1	1	1
PRT	sp|O95613-2|PCNT_HUMAN	Isoform 2 of Pericentrin OS=Homo sapiens OX=9606 GN=PCNT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2232-UNIMOD:267,2234-UNIMOD:21,2256-UNIMOD:267	0.01	43.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	292-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	180-UNIMOD:21,184-UNIMOD:188,197-UNIMOD:188,178-UNIMOD:21,189-UNIMOD:21	0.10	43.0	2	2	2
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	367-UNIMOD:188,370-UNIMOD:21,386-UNIMOD:4,388-UNIMOD:188	0.02	43.0	1	1	0
PRT	sp|Q9Y2K7-4|KDM2A_HUMAN	Isoform 4 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	327-UNIMOD:21	0.06	43.0	1	1	1
PRT	sp|Q7KZ85-2|SPT6H_HUMAN	Isoform 2 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	358-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.05	43.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	925-UNIMOD:188,934-UNIMOD:21,942-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,3-UNIMOD:21,13-UNIMOD:188,19-UNIMOD:188	0.11	43.0	2	1	0
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	363-UNIMOD:21,391-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9UK58-6|CCNL1_HUMAN	Isoform 4 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	335-UNIMOD:21,342-UNIMOD:21,338-UNIMOD:21	0.07	42.0	2	1	0
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	203-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|P29323-2|EPHB2_HUMAN	Isoform 2 of Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	776-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	169-UNIMOD:21,168-UNIMOD:188,196-UNIMOD:188	0.02	42.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2319-UNIMOD:21	0.01	42.0	3	1	0
PRT	sp|Q9NV06|DCA13_HUMAN	DDB1- and CUL4-associated factor 13 OS=Homo sapiens OX=9606 GN=DCAF13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	215-UNIMOD:4	0.04	42.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	244-UNIMOD:21	0.04	42.0	2	1	0
PRT	sp|Q13425-2|SNTB2_HUMAN	Isoform 2 of Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	222-UNIMOD:21,206-UNIMOD:188,235-UNIMOD:188	0.12	42.0	2	1	0
PRT	sp|Q8WUD4|CCD12_HUMAN	Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	144-UNIMOD:188,161-UNIMOD:188,163-UNIMOD:4,165-UNIMOD:21	0.15	42.0	1	1	1
PRT	sp|O60353-2|FZD6_HUMAN	Isoform 2 of Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	583-UNIMOD:4,588-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	670-UNIMOD:4,677-UNIMOD:21,686-UNIMOD:4,669-UNIMOD:267,693-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	54-UNIMOD:21,19-UNIMOD:21	0.16	42.0	2	2	2
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.04	42.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	47-UNIMOD:21,56-UNIMOD:267	0.04	42.0	4	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	22-UNIMOD:21,36-UNIMOD:21	0.17	42.0	2	2	2
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	667-UNIMOD:4,674-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1114-UNIMOD:21,1269-UNIMOD:21,1275-UNIMOD:21	0.05	41.0	2	2	2
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	679-UNIMOD:21,692-UNIMOD:188,678-UNIMOD:21	0.03	41.0	3	1	0
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	229-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	89-UNIMOD:188,92-UNIMOD:188,102-UNIMOD:21,103-UNIMOD:21,36-UNIMOD:21,53-UNIMOD:21	0.43	41.0	14	2	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2280-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q5XUX1-3|FBXW9_HUMAN	Isoform 3 of F-box/WD repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=FBXW9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	59-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	82-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q5JVS0-2|HABP4_HUMAN	Isoform 2 of Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	108-UNIMOD:21	0.08	41.0	1	1	1
PRT	sp|Q7Z3K6-4|MIER3_HUMAN	Isoform 4 of Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	87-UNIMOD:4,93-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	207-UNIMOD:21,232-UNIMOD:267	0.07	41.0	3	1	0
PRT	sp|O75197|LRP5_HUMAN	Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1611-UNIMOD:4,1614-UNIMOD:21	0.01	41.0	3	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	252-UNIMOD:21,256-UNIMOD:267,246-UNIMOD:21	0.06	41.0	4	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2860-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q4KMQ1|TPRN_HUMAN	Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	274-UNIMOD:21,284-UNIMOD:267	0.05	41.0	1	1	1
PRT	sp|Q08999-2|RBL2_HUMAN	Isoform 2 of Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	197-UNIMOD:21,199-UNIMOD:4,201-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q9NRA0|SPHK2_HUMAN	Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	484-UNIMOD:21	0.04	41.0	1	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	41.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	98-UNIMOD:28,100-UNIMOD:21,108-UNIMOD:188,109-UNIMOD:188,121-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	267-UNIMOD:21	0.03	41.0	1	1	0
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	463-UNIMOD:21,472-UNIMOD:267	0.04	41.0	1	1	0
PRT	sp|Q9BWU0|NADAP_HUMAN	Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	466-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	30-UNIMOD:267	0.29	40.0	2	1	0
PRT	sp|Q9NY27-2|PP4R2_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	169-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	90-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	610-UNIMOD:188,614-UNIMOD:21,617-UNIMOD:188,623-UNIMOD:188	0.01	40.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	102-UNIMOD:21	0.12	40.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	156-UNIMOD:21,157-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	306-UNIMOD:21,71-UNIMOD:267,74-UNIMOD:21,86-UNIMOD:267	0.10	40.0	3	2	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	40.0	5	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	1014-UNIMOD:188,1016-UNIMOD:188,1698-UNIMOD:28	0.02	40.0	4	2	0
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	379-UNIMOD:21,331-UNIMOD:188,341-UNIMOD:21,350-UNIMOD:188,384-UNIMOD:188	0.06	40.0	6	2	0
PRT	sp|Q9Y487|VPP2_HUMAN	V-type proton ATPase 116 kDa subunit a isoform 2 OS=Homo sapiens OX=9606 GN=ATP6V0A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	695-UNIMOD:21,718-UNIMOD:4	0.03	40.0	2	1	0
PRT	sp|A7E2V4-5|ZSWM8_HUMAN	Isoform 5 of Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	53-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1576-UNIMOD:21,1461-UNIMOD:21	0.03	40.0	2	2	2
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1783-UNIMOD:21,1774-UNIMOD:267,1788-UNIMOD:267	0.01	40.0	3	1	0
PRT	sp|O15027-5|SC16A_HUMAN	Isoform 5 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2244-UNIMOD:267,2253-UNIMOD:21,2267-UNIMOD:267	0.01	40.0	2	1	0
PRT	sp|P28749-2|RBL1_HUMAN	Isoform 2 of Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	748-UNIMOD:188,749-UNIMOD:21,762-UNIMOD:21,764-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|P09455-2|RET1_HUMAN	Isoform 2 of Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	20-UNIMOD:21,30-UNIMOD:267	0.14	39.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	493-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	366-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	138-UNIMOD:21,153-UNIMOD:188,154-UNIMOD:188	0.07	39.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	372-UNIMOD:267,384-UNIMOD:21,386-UNIMOD:267	0.01	39.0	2	1	0
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1410-UNIMOD:21,1407-UNIMOD:267,1421-UNIMOD:267	0.01	39.0	2	1	0
PRT	sp|Q8TF44|C2C4C_HUMAN	C2 calcium-dependent domain-containing protein 4C OS=Homo sapiens OX=9606 GN=C2CD4C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	273-UNIMOD:21,277-UNIMOD:267	0.05	39.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	881-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P62070-2|RRAS2_HUMAN	Isoform 2 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	106-UNIMOD:4,109-UNIMOD:21	0.13	39.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	925-UNIMOD:21,913-UNIMOD:188,933-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	677-UNIMOD:21,681-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1121-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q96N67-4|DOCK7_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	862-UNIMOD:21,881-UNIMOD:267	0.01	39.0	2	1	0
PRT	sp|Q9NRA2-2|S17A5_HUMAN	Isoform 2 of Sialin OS=Homo sapiens OX=9606 GN=SLC17A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	17-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q5T5X7|BEND3_HUMAN	BEN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=BEND3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	93-UNIMOD:21,95-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.08	39.0	1	1	1
PRT	sp|Q13286-5|CLN3_HUMAN	Isoform 5 of Battenin OS=Homo sapiens OX=9606 GN=CLN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	10-UNIMOD:267,14-UNIMOD:21,24-UNIMOD:267	0.06	39.0	1	1	1
PRT	sp|P27987-2|IP3KB_HUMAN	Isoform 2 of Inositol-trisphosphate 3-kinase B OS=Homo sapiens OX=9606 GN=ITPKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	81-UNIMOD:267,88-UNIMOD:21,105-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	18-UNIMOD:21	0.10	39.0	1	1	1
PRT	sp|Q9H361|PABP3_HUMAN	Polyadenylate-binding protein 3 OS=Homo sapiens OX=9606 GN=PABPC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	339-UNIMOD:4,342-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9Y2H5|PKHA6_HUMAN	Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	842-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9H609|ZN576_HUMAN	Zinc finger protein 576 OS=Homo sapiens OX=9606 GN=ZNF576 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	20-UNIMOD:21,29-UNIMOD:4,35-UNIMOD:188	0.10	39.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	386-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q16512|PKN1_HUMAN	Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	575-UNIMOD:21,602-UNIMOD:4	0.04	39.0	2	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	225-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|Q8IUD2-5|RB6I2_HUMAN	Isoform 5 of ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	17-UNIMOD:21,21-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|O75475-3|PSIP1_HUMAN	Isoform 3 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	273-UNIMOD:21,275-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	378-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q96SK2-3|TM209_HUMAN	Isoform 3 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	268-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	79-UNIMOD:188,80-UNIMOD:188	0.05	39.0	7	1	0
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	377-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9NPF5|DMAP1_HUMAN	DNA methyltransferase 1-associated protein 1 OS=Homo sapiens OX=9606 GN=DMAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	433-UNIMOD:188,445-UNIMOD:21,449-UNIMOD:267	0.11	39.0	1	1	1
PRT	sp|Q5VV67|PPRC1_HUMAN	Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1479-UNIMOD:4,1480-UNIMOD:21,1481-UNIMOD:21,1493-UNIMOD:21,1494-UNIMOD:21,1498-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q0VG06-3|FP100_HUMAN	Isoform 3 of Fanconi anemia core complex-associated protein 100 OS=Homo sapiens OX=9606 GN=FAAP100	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	516-UNIMOD:21,522-UNIMOD:267,532-UNIMOD:4,533-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q6NWY9-2|PR40B_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	169-UNIMOD:188,175-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	154-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	86-UNIMOD:21,88-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	307-UNIMOD:21,308-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	312-UNIMOD:21,321-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q5TC82-2|RC3H1_HUMAN	Isoform 2 of Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	535-UNIMOD:21,545-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	112-UNIMOD:21,117-UNIMOD:267	0.07	38.0	4	1	0
PRT	sp|O15439-4|MRP4_HUMAN	Isoform 4 of Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	571-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	413-UNIMOD:188,427-UNIMOD:21,445-UNIMOD:188	0.06	38.0	1	1	1
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	80-UNIMOD:188,82-UNIMOD:21,86-UNIMOD:188,95-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	974-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	656-UNIMOD:21,655-UNIMOD:21,662-UNIMOD:267	0.01	38.0	2	1	0
PRT	sp|O95239|KIF4A_HUMAN	Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1224-UNIMOD:4,1225-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	71-UNIMOD:4,72-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	136-UNIMOD:267,143-UNIMOD:21,147-UNIMOD:21,150-UNIMOD:267,35-UNIMOD:21	0.15	38.0	3	2	1
PRT	sp|Q7Z3B3-4|KANL1_HUMAN	Isoform 3 of KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	262-UNIMOD:21,275-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|Q15742-2|NAB2_HUMAN	Isoform 2 of NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	171-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	104-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	255-UNIMOD:21,256-UNIMOD:4,261-UNIMOD:267,278-UNIMOD:267	0.07	38.0	2	1	0
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	870-UNIMOD:188,875-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	214-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	86-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	145-UNIMOD:28,147-UNIMOD:188,151-UNIMOD:188,160-UNIMOD:21,173-UNIMOD:267	0.07	38.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	42-UNIMOD:21,57-UNIMOD:188,65-UNIMOD:188	0.11	38.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	622-UNIMOD:21,638-UNIMOD:4	0.02	38.0	1	1	0
PRT	sp|Q9P2K5|MYEF2_HUMAN	Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q9H063|MAF1_HUMAN	Repressor of RNA polymerase III transcription MAF1 homolog OS=Homo sapiens OX=9606 GN=MAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	46-UNIMOD:28,48-UNIMOD:4,68-UNIMOD:21	0.11	38.0	1	1	1
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1069-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	100-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	102-UNIMOD:188,103-UNIMOD:188	0.14	37.0	2	1	0
PRT	sp|Q9NRA0-4|SPHK2_HUMAN	Isoform 4 of Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	425-UNIMOD:21	0.05	37.0	1	1	0
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	45-UNIMOD:21,52-UNIMOD:21	0.09	37.0	3	1	0
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21,23-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q7Z589-6|EMSY_HUMAN	Isoform 6 of BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1116-UNIMOD:4,1117-UNIMOD:267,1120-UNIMOD:4,1122-UNIMOD:21,1133-UNIMOD:267,190-UNIMOD:21	0.03	37.0	2	2	2
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1452-UNIMOD:21,1448-UNIMOD:21,1464-UNIMOD:267,1451-UNIMOD:21	0.01	37.0	3	1	0
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.10	37.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	8-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q70Z53|F10C1_HUMAN	Protein FRA10AC1 OS=Homo sapiens OX=9606 GN=FRA10AC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	278-UNIMOD:21,283-UNIMOD:21	0.08	37.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2484-UNIMOD:21	0.01	37.0	2	1	0
PRT	sp|Q6KC79-2|NIPBL_HUMAN	Isoform 2 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2658-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	303-UNIMOD:188,307-UNIMOD:21,311-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|Q5T5P2|SKT_HUMAN	Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1650-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	77-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q6NYC8|PPR18_HUMAN	Phostensin OS=Homo sapiens OX=9606 GN=PPP1R18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	489-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q96AD5-2|PLPL2_HUMAN	Isoform 2 of Patatin-like phospholipase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PNPLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:21,88-UNIMOD:4	0.09	37.0	1	1	1
PRT	sp|Q8TEP8|CE192_HUMAN	Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1177-UNIMOD:4,1189-UNIMOD:4,1200-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2029-UNIMOD:21,2037-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	8-UNIMOD:21	0.11	37.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	320-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|O95359-3|TACC2_HUMAN	Isoform 3 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1562-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	83-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	311-UNIMOD:21,315-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q13330-3|MTA1_HUMAN	Isoform 3 of Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	559-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9UJM3|ERRFI_HUMAN	ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	367-UNIMOD:28,369-UNIMOD:21,375-UNIMOD:188,378-UNIMOD:4,387-UNIMOD:188,388-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1268-UNIMOD:21,1278-UNIMOD:21,1280-UNIMOD:267	0.00	37.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	995-UNIMOD:188,1004-UNIMOD:21,1008-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|P80192|M3K9_HUMAN	Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	938-UNIMOD:21,940-UNIMOD:21,948-UNIMOD:21,950-UNIMOD:21,952-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9NQ84|GPC5C_HUMAN	G-protein coupled receptor family C group 5 member C OS=Homo sapiens OX=9606 GN=GPRC5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	423-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	655-UNIMOD:267,663-UNIMOD:21,666-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|Q9Y320-2|TMX2_HUMAN	Isoform 2 of Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	250-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	128-UNIMOD:21,154-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|Q96K17-2|BT3L4_HUMAN	Isoform 2 of Transcription factor BTF3 homolog 4 OS=Homo sapiens OX=9606 GN=BTF3L4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:188,96-UNIMOD:188	0.31	36.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	96-UNIMOD:21,111-UNIMOD:4	0.05	36.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	463-UNIMOD:21,472-UNIMOD:267	0.03	36.0	1	1	0
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	484-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	226-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q2TAZ0|ATG2A_HUMAN	Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1309-UNIMOD:21,1320-UNIMOD:267	0.01	36.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	467-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q96Q89-5|KI20B_HUMAN	Isoform 5 of Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	432-UNIMOD:21,439-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	48-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	163-UNIMOD:188,174-UNIMOD:21,176-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	420-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	623-UNIMOD:4,626-UNIMOD:21,635-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	107-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	202-UNIMOD:21,204-UNIMOD:21,208-UNIMOD:267	0.06	36.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1221-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	47-UNIMOD:267,57-UNIMOD:21,67-UNIMOD:267	0.17	36.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	571-UNIMOD:21,576-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	767-UNIMOD:21,775-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	19-UNIMOD:188,21-UNIMOD:21,33-UNIMOD:188	0.06	36.0	1	1	1
PRT	sp|Q9BQ04|RBM4B_HUMAN	RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	86-UNIMOD:21,89-UNIMOD:4,95-UNIMOD:267	0.05	36.0	2	1	0
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1460-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	93-UNIMOD:4,103-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|O95251-4|KAT7_HUMAN	Isoform 4 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	124-UNIMOD:21,127-UNIMOD:267,128-UNIMOD:21,155-UNIMOD:188	0.07	36.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	74-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:267,26-UNIMOD:4,27-UNIMOD:4,28-UNIMOD:21,44-UNIMOD:4,46-UNIMOD:267	0.06	36.0	1	1	1
PRT	sp|Q9BRZ2|TRI56_HUMAN	E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	471-UNIMOD:21,475-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|Q8IWY9|CDAN1_HUMAN	Codanin-1 OS=Homo sapiens OX=9606 GN=CDAN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	265-UNIMOD:21,270-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1004-UNIMOD:21,1011-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|P63267-2|ACTH_HUMAN	Isoform 2 of Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|Q9NZN5-2|ARHGC_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	275-UNIMOD:4,290-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	280-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9BST9-3|RTKN_HUMAN	Isoform 3 of Rhotekin OS=Homo sapiens OX=9606 GN=RTKN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	470-UNIMOD:21,481-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	249-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	1067-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	44-UNIMOD:21,58-UNIMOD:4,70-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|Q5VWQ8|DAB2P_HUMAN	Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	702-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q96Q06|PLIN4_HUMAN	Perilipin-4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	809-UNIMOD:21,812-UNIMOD:21,819-UNIMOD:4,830-UNIMOD:188,835-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9UK58|CCNL1_HUMAN	Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	318-UNIMOD:188,335-UNIMOD:21,339-UNIMOD:188,341-UNIMOD:21,344-UNIMOD:267	0.06	36.0	1	1	0
PRT	sp|Q9UH17-2|ABC3B_HUMAN	Isoform 2 of DNA dC->dU-editing enzyme APOBEC-3B OS=Homo sapiens OX=9606 GN=APOBEC3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	221-UNIMOD:21,227-UNIMOD:21,242-UNIMOD:4	0.11	36.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	3-UNIMOD:21	ms_run[2]:scan=7248	31.689	2	2739.1634	2739.1634	R	A	17	51
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	2	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	5-UNIMOD:21	ms_run[2]:scan=7190	31.52	3	2739.1634	2739.1634	R	A	17	51
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	3	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11421	49.858	3	3088.156	3088.1560	R	A	10	40
PSM	RSSPAAFINPPIGTVTPALK	4	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21	ms_run[2]:scan=23753	109.46	2	2116.1082	2116.1082	K	L	125	145
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	5	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=11391	49.713	3	3098.1643	3098.1643	R	A	10	40
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	6	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22933	105.16608500000001	3	3112.594107	3111.608898	R	A	655	686
PSM	AHLTVGQAAAGGSGNLLTER	7	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:21	ms_run[2]:scan=16183	71.284	2	2001.9633	2001.9633	R	S	317	337
PSM	AHLTVGQAAAGGSGNLLTER	8	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:21	ms_run[2]:scan=16415	72.339	2	2001.9633	2001.9633	R	S	317	337
PSM	NHLSPQQGGATPQVPSPCCR	9	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11151	48.687	2	2269.9722	2269.9722	K	F	166	186
PSM	REQGGSGLGSGSSGGGGSTSGLGSGYIGR	10	sp|Q2M2I8-2|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	10-UNIMOD:21	ms_run[2]:scan=13362	58.48	3	2621.1467	2621.1467	R	V	9	38
PSM	GPPASSPAPAPKFSPVTPK	11	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	14-UNIMOD:21	ms_run[2]:scan=13940	61.096	2	1911.9496	1911.9496	R	F	97	116
PSM	GPPASSPAPAPKFSPVTPK	12	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13726	60.107	2	1923.9898	1923.9898	R	F	97	116
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=25697	119.40368666666667	3	3448.4184	3448.4228	K	L	104	135
PSM	SFGDKDLILPNGGTPAGTSSPASSSSLLNR	14	sp|Q5VWJ9|SNX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	20-UNIMOD:21	ms_run[1]:scan=24025	110.83768166666667	3	3026.424568	3025.439375	R	L	48	78
PSM	SETAPAAPAAPAPAEKTPVKK	15	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8150	36.02985666666667	2	2153.0760	2153.0764	M	K	2	23
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	16	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=17072	75.541	3	2941.3846	2941.3846	R	D	374	402
PSM	HIISATSLSTSPTELGSR	17	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:21	ms_run[2]:scan=16344	72.006	2	1935.9303	1935.9303	R	N	216	234
PSM	IAAPELHKGDSDSEEDEPTK	18	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=8935	39.358	2	2326.9243	2326.9243	K	K	147	167
PSM	KLSGDQITLPTTVDYSSVPK	19	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=22088	100.88	2	2228.0977	2228.0977	R	Q	34	54
PSM	RSDSPEIPFQAAAGPSDGLDASSPGNSFVGLR	20	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=26631	124.31	3	3281.499	3281.4990	R	V	1459	1491
PSM	RSSPAAFINPPIGTVTPALK	21	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=23594	108.45	2	2116.1082	2116.1082	K	L	125	145
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	22	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=18517	82.713	2	2356.0283	2356.0283	R	S	38	64
PSM	TVIRLPSGSGAASPTGSAVDIR	23	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:267,15-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=18634	83.251	2	2211.1163	2211.1163	K	A	204	226
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	24	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=14018	61.431	3	3949.3584	3949.3584	K	A	156	190
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	25	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21177	96.08133666666667	3	3448.4205	3448.4228	K	L	104	135
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	26	sp|Q5HYK7|SH319_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=24014	110.78792666666666	3	3065.4197	3065.4200	K	L	268	296
PSM	CNELKSPGSPPGPELPIETALDDR	27	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=25453	118.16	3	2671.2201	2671.2201	K	E	674	698
PSM	HYEDGYPGGSDNYGSLSR	28	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	15-UNIMOD:21	ms_run[2]:scan=11758	51.409	2	2052.7851	2052.7851	R	V	115	133
PSM	NHLSPQQGGATPQVPSPCCR	29	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=10924	47.676	2	2269.9722	2269.9722	K	F	166	186
PSM	REPGGWGAGASAPVEDDSDAETYGEENDEQGNYSK	30	sp|Q9NQS1|AVEN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:21	ms_run[2]:scan=15930	70.19	3	3766.4816	3766.4816	R	R	77	112
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	31	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23392	107.51	3	2356.0283	2356.0283	R	S	38	64
PSM	SRDESASETSTPSEHSAAPSPQVEVR	32	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=8440	37.345	3	2900.1863	2900.1863	R	T	145	171
PSM	ELLAKPIGPDDAIDALSSDFTCGSPTAAGK	33	sp|P20810-3|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:188,22-UNIMOD:4,24-UNIMOD:21,30-UNIMOD:188	ms_run[2]:scan=29677	141.62	3	3108.4765	3108.4765	R	K	102	132
PSM	FIHQQPQSSSPVYGSSAK	34	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=7827	34.532	2	2026.915	2026.9150	R	T	76	94
PSM	GAGAGHPGAGGAQPPDSPAGVR	35	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=5424	23.845	2	1972.878	1972.8780	R	T	71	93
PSM	GVLDLDRPGEPAGEESPGPLQER	36	sp|Q9UMN6|KMT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21	ms_run[2]:scan=19541	87.874	3	2497.1486	2497.1486	R	S	2333	2356
PSM	KASSPSPLTIGTPESQR	37	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=11328	49.447	2	1834.8826	1834.8826	R	K	482	499
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	38	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14638	64.243	3	3116.2144	3116.2144	K	N	561	587
PSM	NKPGPNIESGNEDDDASFK	39	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=10331	45.209	2	2112.8637	2112.8637	K	I	206	225
PSM	RNLLEDDSDEEEDFFLR	40	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,8-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=27240	127.62	2	2240.9378	2240.9378	R	G	23	40
PSM	SHSQASLAGPGPVDPSNR	41	sp|Q9P2M7|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=8780	38.768	2	1855.8214	1855.8214	R	S	129	147
PSM	SSSPGKLLGSGYGGLTGGSSR	42	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=18114	80.611	2	2003.9313	2003.9313	R	G	686	707
PSM	TPADRGPSPAPAPAASPQPGSR	43	sp|Q8IX07|FOG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=5360	23.532	2	2164.0062	2164.0062	R	G	894	916
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	44	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21419	97.37402	3	3448.4205	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	45	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22497	102.885265	3	3448.4242	3448.4228	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	46	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23170	106.42943166666666	3	3114.599982	3111.608898	R	A	655	686
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	47	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=15356	67.53975166666667	3	3116.202761	3116.214409	K	N	561	587
PSM	ESLSASSSSSASSSSGSSTTSPSSSASDK	48	sp|Q9UPS6|SET1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	4-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=25262	117.18045166666666	3	3041.972537	3038.948221	K	E	1039	1068
PSM	GPPASSPAPAPKFSPVTPK	49	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14047	61.561	2	1923.9898	1923.9898	R	F	97	116
PSM	ISYTPPESPVPSYASSTPLHVPVPR	50	sp|P41212|ETV6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=24661	114.18	3	2767.3498	2767.3498	R	A	15	40
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	51	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=8223	36.375	3	3046.23	3046.2300	K	D	234	260
PSM	LAPVPSPEPQKPAPVSPESVK	52	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=14082	61.729	2	2233.1396	2233.1396	K	A	199	220
PSM	LAPVPSPEPQKPAPVSPESVK	53	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:188,19-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=14113	61.858	2	2245.1798	2245.1798	K	A	199	220
PSM	MREDYDSVEQDGDEPGPQR	54	sp|Q9Y5S9|RBM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21	ms_run[2]:scan=9634	42.354	2	2301.8845	2301.8845	R	S	50	69
PSM	NHYLDLAGIENYTSQFGPGSPSVAQK	55	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:21	ms_run[2]:scan=27309	127.99	3	2872.3069	2872.3069	R	S	257	283
PSM	NKPGPNIESGNEDDDASFK	56	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10323	45.175	2	2124.904	2124.9040	K	I	206	225
PSM	SDGSGFGARLSPGSGGPEAQTAGPVTPASISGR	57	sp|O95613-2|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:267,11-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=19240	86.323	3	3127.4475	3127.4475	K	F	2224	2257
PSM	SDKSPDLAPTPAPQSTPR	58	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=8528	37.709	2	1943.899	1943.8990	R	N	289	307
PSM	SPSGPVKSPPLSPVGTTPVK	59	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,7-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=14461	63.469	2	2023.0794	2023.0794	K	L	178	198
PSM	STLESEKPGSPEAAETSPPSNIIDHCEK	60	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:188,10-UNIMOD:21,26-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=14525	63.763	3	3101.3939	3101.3939	K	L	361	389
PSM	TPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAAR	61	sp|Q9Y2K7-4|KDM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	26-UNIMOD:21	ms_run[2]:scan=12329	53.866	3	3772.4141	3772.4141	R	L	302	336
PSM	TRTPASINATPANINLADLTR	62	sp|Q7KZ85-2|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=22401	102.43	3	2289.1478	2289.1478	R	A	349	370
PSM	YKLDEDEDEDDADLSK	63	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10564	46.125	2	1898.7905	1898.7905	K	Y	167	183
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	64	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21598	98.37832	3	3448.4204	3448.4228	K	L	104	135
PSM	TAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGR	65	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	20-UNIMOD:188,29-UNIMOD:21,37-UNIMOD:267	ms_run[1]:scan=25203	116.8897	4	3929.956647	3928.972902	K	V	906	943
PSM	AAPEASSPPASPLQHLLPGK	66	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	7-UNIMOD:21	ms_run[1]:scan=22344	102.155925	2	2048.017912	2047.013957	K	A	686	706
PSM	NHLSPQQGGATPQVPSPCCR	67	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[1]:scan=11204	48.90542833333333	2	2280.980318	2279.980455	K	F	166	186
PSM	ASGVAVSDGVIKVFNDMK	68	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=31509	152.60311333333334	2	1957.9222	1957.9215	M	V	2	20
PSM	VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVR	69	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	3-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=17572	77.96476333333332	3	3346.580018	3346.582048	R	A	361	397
PSM	AHLTVGQAAAGGSGNLLTER	70	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=16189	71.313	2	2011.9716	2011.9716	R	S	317	337
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	71	sp|Q9UK58-6|CCNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=20651	93.468	3	2869.3413	2869.3413	K	E	317	345
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	72	sp|Q9UK58-6|CCNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=21278	96.636	3	2869.3413	2869.3413	K	E	317	345
PSM	AVTIANSPSKPSEKDSVVSLESQK	73	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=13033	57.004	3	2580.2684	2580.2684	K	T	197	221
PSM	FLEDDTSDPTYTSALGGKIPIR	74	sp|P29323-2|EPHB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=23971	110.58	2	2475.1571	2475.1571	R	W	770	792
PSM	FLNKSPEEPSTPGTVVSSPSISTPPIVPDIQK	75	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=24836	115.08	3	3427.7164	3427.7164	K	N	165	197
PSM	FNEEHIPDSPFVVPVASPSGDAR	76	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=25846	120.2	3	2546.1479	2546.1479	K	R	2303	2326
PSM	FNEEHIPDSPFVVPVASPSGDAR	77	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=26035	121.2	3	2546.1479	2546.1479	K	R	2303	2326
PSM	FNPIETFLLGSCASDR	78	sp|Q9NV06|DCA13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:4	ms_run[2]:scan=31670	153.44	2	1825.8669	1825.8669	K	N	204	220
PSM	GAGAGHPGAGGAQPPDSPAGVR	79	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=5417	23.814	2	1962.8698	1962.8698	R	T	71	93
PSM	GPPASSPAPAPKFSPVTPK	80	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=13720	60.084	2	1911.9496	1911.9496	R	F	97	116
PSM	ILQEKLDQPVSAPPSPR	81	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=13774	60.306	2	1953.9925	1953.9925	R	D	230	247
PSM	ISYTPPESPVPSYASSTPLHVPVPR	82	sp|P41212|ETV6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21	ms_run[2]:scan=24712	114.44	3	2757.3415	2757.3415	R	A	15	40
PSM	KPSLVSDLPWEGAAPQSPSFSGSEDSGSPK	83	sp|Q13425-2|SNTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=24741	114.6	3	3123.4074	3123.4074	K	H	206	236
PSM	LKGQEDSLASAVDAATEQKTCDSD	84	sp|Q8WUD4|CCD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:188,19-UNIMOD:188,21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18689	83.479	3	2630.1457	2630.1457	R	-	143	167
PSM	LREQDCGEPASPAASISR	85	sp|O60353-2|FZD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8176	36.143	2	2022.883	2022.8830	R	L	578	596
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	86	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14900	65.383	3	3116.2144	3116.2144	K	N	561	587
PSM	RNLLEDDSDEEEDFFLR	87	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=27232	127.58	2	2220.9212	2220.9212	R	G	23	40
PSM	SEDADRCTLPEHESPSQDISDACEAESTER	88	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4,14-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=14938	65.545	3	3500.3617	3500.3617	K	C	664	694
PSM	SGKNSQEDSEDSEDKDVK	89	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=949	5.8686	2	2075.8168	2075.8168	R	T	50	68
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	90	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19687	88.603	3	2548.2977	2548.2977	K	T	508	533
PSM	TVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLR	91	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22828	104.71	3	3861.5369	3861.5369	R	K	302	335
PSM	VAAAAGSGPSPPGSPGHDR	92	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4110	18.328	2	1776.782	1776.7820	R	E	38	57
PSM	GDVTAEEAAGASPAKANGQENGHVK	93	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	12-UNIMOD:21	ms_run[1]:scan=5227	22.864075	3	2488.088478	2487.102725	R	S	11	36
PSM	SFGDKDLILPNGGTPAGTSSPASSSSLLNR	94	sp|Q5VWJ9|SNX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	20-UNIMOD:21	ms_run[1]:scan=24386	112.70841499999999	3	3026.424777	3025.439375	R	L	48	78
PSM	TLHCEGTEINSDDEQESKEVEETATAK	95	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=14749	64.73566	3	3130.282134	3129.296929	K	N	664	691
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	96	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=12995	56.815	3	3010.371	3010.3710	R	V	1094	1125
PSM	AAPEASSPPASPLQHLLPGK	97	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22724	104.17	2	2053.0341	2053.0341	K	A	673	693
PSM	GPSTPKSPGASNFSTLPK	98	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=12572	54.87	2	1851.8768	1851.8768	R	I	223	241
PSM	KLEKEEEEGISQESSEEEQ	99	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=7061	31.052	2	2407.9596	2407.9596	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	100	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6382	28.056	2	2395.9193	2395.9193	K	-	89	108
PSM	NHLSPQQGGATPQVPSPCCR	101	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10972	47.887	2	2279.9805	2279.9805	K	F	166	186
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	102	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=14642	64.267	3	3106.2061	3106.2061	K	N	561	587
PSM	SALSPSKSPAKLNQSGTSVGTDEESDVTQEEER	103	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=13439	58.818	3	3542.5897	3542.5897	K	D	2273	2306
PSM	SGLAFSRPSQLSTPAASPSASEPR	104	sp|Q5XUX1-3|FBXW9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=17225	76.289	3	2480.1697	2480.1697	K	A	43	67
PSM	SGQGFHGNSEVNAILSPR	105	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=17703	78.593	2	1948.8793	1948.8793	R	S	67	85
PSM	SLPAPVAQRPDSPGGGLQAPGQK	106	sp|Q5JVS0-2|HABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=13972	61.247	2	2307.1373	2307.1373	K	R	97	120
PSM	SNTACDGDKESEVEDVETDSGNSPEDLRK	107	sp|Q7Z3K6-4|MIER3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=13069	57.18	3	3262.3093	3262.3093	R	E	83	112
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	108	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=11655	50.96	3	2686.2501	2686.2501	R	R	207	233
PSM	SRINSSGESGDESDEFLQSR	109	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=12763	55.727	2	2278.9339	2278.9339	R	K	178	198
PSM	SYFHLFPPPPSPCTDSS	110	sp|O75197|LRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=26586	124.1	2	2014.8172	2014.8172	R	-	1599	1616
PSM	SYFHLFPPPPSPCTDSS	111	sp|O75197|LRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=26775	125.11	2	2014.8172	2014.8172	R	-	1599	1616
PSM	THSTSSSLGSGESPFSR	112	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=9327	41.046	2	1802.7472	1802.7472	R	S	240	257
PSM	THSTSSSLGSGESPFSR	113	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=9340	41.092	2	1812.7555	1812.7555	R	S	240	257
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	114	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=10289	45.052	3	2919.2268	2919.2268	R	S	2860	2891
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	115	sp|Q4KMQ1|TPRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	23-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=13390	58.6	3	3266.512	3266.5120	K	Q	252	285
PSM	YIKENSPCVTPVSTATHSLSR	116	sp|Q08999-2|RBL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=16040	70.681	3	2506.0965	2506.0965	R	L	192	213
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	117	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22671	103.90881833333333	3	3448.4209	3448.4228	K	L	104	135
PSM	AAPEASSPPASPLQHLLPGK	118	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:21	ms_run[1]:scan=22546	103.162665	2	2048.017912	2047.013957	K	A	686	706
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	119	sp|Q9NRA0|SPHK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	5-UNIMOD:21	ms_run[1]:scan=24229	111.85043166666667	3	2813.421456	2812.416061	K	V	480	508
PSM	QHEAPSNRPLNELLTPQGPSPR	120	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19633	88.336035	3	2520.2019	2520.2020	R	T	167	189
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	121	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=15126	66.45143333333334	3	3116.202761	3116.214409	K	N	561	587
PSM	QESDPEDDDVKKPALQSSVVATSK	122	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:21,11-UNIMOD:188,12-UNIMOD:188,24-UNIMOD:188	ms_run[1]:scan=13241	57.97375666666667	3	2653.2565	2653.2501	R	E	98	122
PSM	ASGVAVSDGVIKVFNDMK	123	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,2-UNIMOD:21,12-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=31508	152.59971833333333	2	1969.9619	1969.9618	M	V	2	20
PSM	GPPASSPAPAPKFSPVTPK	124	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:21	ms_run[1]:scan=14117	61.87501333333333	2	1911.949976	1911.949566	R	F	254	273
PSM	EALGLGPPAAQLTPPPAPVGLR	125	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=25340	117.57736166666668	3	2211.170152	2211.169225	R	G	451	473
PSM	AAPEASSPPASPLQHLLPGK	126	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=22726	104.18	2	2047.014	2047.0140	K	A	673	693
PSM	AKNWEDEDFYDSDDDTFLDR	127	sp|Q9BWU0|NADAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=24662	114.18	3	2574.97	2574.9700	K	T	455	475
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	128	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=15317	67.329	3	3044.152	3044.1520	K	L	595	622
PSM	DLEAEHVEVEDTTLNR	129	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=15156	66.582	2	1878.8835	1878.8835	R	C	15	31
PSM	DLEAEHVEVEDTTLNR	130	sp|Q9H3K6-2|BOLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15128	66.456	2	1868.8752	1868.8752	R	C	15	31
PSM	EANLQQNEEKNHSDSSTSESEVSSVSPLK	131	sp|Q9NY27-2|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	26-UNIMOD:21	ms_run[2]:scan=10715	46.768	3	3239.4103	3239.4103	K	N	144	173
PSM	ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGR	132	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=19039	85.27	3	3606.6336	3606.6336	R	R	74	114
PSM	EVPSKEEPSPVKAEVAEK	133	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:188,9-UNIMOD:21,12-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7876	34.787	2	2050.037	2050.0370	K	Q	606	624
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	134	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=20954	95.055	3	3393.3457	3393.3457	K	F	86	114
PSM	GLRDSHSSEEDEASSQTDLSQTISK	135	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=12809	55.916	3	2866.1543	2866.1543	R	K	150	175
PSM	HASPILPITEFSDIPR	136	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=27646	129.9	2	1871.9183	1871.9183	K	R	304	320
PSM	HTGPNSPDTANDGFVR	137	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=8129	35.937	2	1773.7347	1773.7347	K	L	99	115
PSM	IAEFTTNLTEEEEKSK	138	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=14863	65.232	2	1879.9454	1879.9454	R	S	1001	1017
PSM	IHAESLLLDSPAVAK	139	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=18401	82.097	2	1642.8331	1642.8331	R	S	370	385
PSM	ISYTPPESPVPSYASSTPLHVPVPR	140	sp|P41212|ETV6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=24516	113.42	3	2757.3415	2757.3415	R	A	15	40
PSM	KDSEEEVSLLGSQDIEEGNHQVEDGCR	141	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=18261	81.384	3	3138.3085	3138.3085	R	E	693	720
PSM	KLEKEEEEGISQESSEEEQ	142	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6105	26.754	2	2407.9596	2407.9596	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	143	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=7377	32.219	2	2407.9596	2407.9596	K	-	89	108
PSM	KQSAGPNSPTGGGGGGGSGGTR	144	sp|A7E2V4-5|ZSWM8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=757	5.2963	2	1922.8232	1922.8232	R	M	46	68
PSM	KTSFDQDSDVDIFPSDFPTEPPSLPR	145	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=29161	138.53	3	3016.3379	3016.3379	K	T	1569	1595
PSM	KVEEEQEADEEDVSEEEAESK	146	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=7867	34.737	3	2516.9803	2516.9803	K	E	234	255
PSM	NHLSPQQGGATPQVPSPCCR	147	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11399	49.748	2	2269.9722	2269.9722	K	F	166	186
PSM	RTAFYNEDDSEEEQR	148	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=7935	35.026	2	1967.7534	1967.7534	R	Q	1774	1789
PSM	RTAFYNEDDSEEEQR	149	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,10-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=7949	35.106	2	1987.77	1987.7700	R	Q	1774	1789
PSM	SFGDKDLILPNGGTPAGTSSPASSSSLLNR	150	sp|Q5VWJ9|SNX30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:21	ms_run[2]:scan=23381	107.47	3	3025.4394	3025.4394	R	L	48	78
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	151	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=17958	79.795	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	152	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=31569	152.9	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	153	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=22927	105.14	3	2356.0283	2356.0283	R	S	38	64
PSM	SGRNDGLLALSSPDAEEPQLPDGTGR	154	sp|O15027-5|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:267,12-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=22581	103.38	3	2751.2616	2751.2616	R	E	2242	2268
PSM	THSTSSSLGSGESPFSR	155	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=10996	48.003	2	1802.7472	1802.7472	R	S	240	257
PSM	VAAAAGSGPSPPGSPGHDR	156	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=3913	17.292	2	1776.782	1776.7820	R	E	38	57
PSM	VKSPVSLTAHSLIGASPK	157	sp|P28749-2|RBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,3-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=18027	80.165	2	1962.9984	1962.9984	K	Q	747	765
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	158	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22996	105.51826166666667	3	3448.4196	3448.4228	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	159	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21	ms_run[1]:scan=23112	106.09832333333334	3	3096.565547	3095.580500	R	A	655	686
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	160	sp|Q5HYK7|SH319_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=23816	109.78125166666666	3	3065.4199	3065.4200	K	L	268	296
PSM	AGNPAVAAPQSPLSPEGAHFR	161	sp|P09455-2|RET1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=15759	69.346	2	2163.0138	2163.0138	R	A	10	31
PSM	ASNTSTPTKGNTETSASASQTNHVK	162	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=1565	7.8387	3	2598.1559	2598.1559	K	D	489	514
PSM	ASSPIKQSHEPVPDTSVEK	163	sp|Q9ULM3|YETS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=7330	32.032	2	2114.9885	2114.9885	K	G	365	384
PSM	ATNESEDEIPQLVPIGKK	164	sp|O76021-2|RL1D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=20455	92.433	2	2059.0277	2059.0277	K	T	137	155
PSM	FIHQQPQSSSPVYGSSAK	165	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=7824	34.519	2	2032.9351	2032.9351	R	T	76	94
PSM	FNEEHIPDSPFVVPVASPSGDAR	166	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=26224	122.21	3	2546.1479	2546.1479	K	R	2303	2326
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	167	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:267,14-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=16419	72.359	3	2669.1873	2669.1873	K	S	61	87
PSM	GRNAPAAVDEGSISPR	168	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,14-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7049	31.009	2	1695.7844	1695.7845	R	T	371	387
PSM	GRWESQQDVSQTTVSR	169	sp|Q9NQT8|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=9143	40.24	2	1942.8534	1942.8534	K	G	1406	1422
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	170	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	25-UNIMOD:21	ms_run[2]:scan=17246	76.402	3	2931.3764	2931.3764	R	D	374	402
PSM	HGSLSADDSTPDASPGSR	171	sp|Q8TF44|C2C4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4361	19.415	2	1845.7406	1845.7406	R	R	260	278
PSM	ISYTPPESPVPSYASSTPLHVPVPR	172	sp|P41212|ETV6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=24468	113.17	3	2767.3498	2767.3498	R	A	15	40
PSM	ITKPGSIDSNNQLFAPGGR	173	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=16717	73.795	2	2050.9837	2050.9837	K	L	876	895
PSM	KFQEQECPPSPEPTR	174	sp|P62070-2|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=6568	28.911	2	1908.8077	1908.8077	R	K	100	115
PSM	KGGEFDEFVNDDTDDDLPISK	175	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=22837	104.75	2	2435.0054	2435.0054	K	K	913	934
PSM	KGGEFDEFVNDDTDDDLPISK	176	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,13-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=22858	104.86	2	2447.0456	2447.0456	K	K	913	934
PSM	KLEKEEEEGISQESSEEEQ	177	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5836	25.518	2	2407.9596	2407.9596	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	178	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5659	24.809	2	2395.9193	2395.9193	K	-	89	108
PSM	KRSVAVSDEEEVEEEAER	179	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=13375	58.54	2	2249.909	2249.9090	R	R	675	693
PSM	KVSGDSSHTETTAEEVPEDPLLK	180	sp|Q6W2J9-4|BCOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=16301	71.803	2	2548.1582	2548.1582	R	A	1119	1142
PSM	LKQLMEQDASSSPSAQVIGLK	181	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,12-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=18846	84.318	3	2321.1741	2321.1741	K	N	330	351
PSM	LKQLMEQDASSSPSAQVIGLK	182	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=18860	84.389	3	2309.1338	2309.1338	K	N	330	351
PSM	LPNTYPNSSSPGPGGLGGSVHYATMAR	183	sp|Q96N67-4|DOCK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=19248	86.369	3	2767.2425	2767.2425	R	S	855	882
PSM	NDGEESTDRTPLLPGAPR	184	sp|Q9NRA2-2|S17A5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=14506	63.664	2	2003.895	2003.8950	R	A	11	29
PSM	NRENSSPCQGNGEQAGR	185	sp|Q5T5X7|BEND3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=750	5.2728	2	1939.7592	1939.7592	R	G	88	105
PSM	NSVVEASEAAYKEAFEISK	186	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=26952	126.06	2	2071.011	2071.0110	K	E	144	163
PSM	RFSDSEGEETVPEPR	187	sp|Q13286-5|CLN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,5-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=10309	45.124	2	1833.7685	1833.7685	R	L	10	25
PSM	RLNSSSGSGSGSSGSSVSSPSWAGR	188	sp|P27987-2|IP3KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,8-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=10096	44.281	3	2440.0519	2440.0519	R	L	81	106
PSM	SETAPAETATPAPVEKSPAKK	189	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=4637	20.536	2	2189.0617	2189.0617	M	K	2	23
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	190	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=19919	89.743	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	191	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,11-UNIMOD:267,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23184	106.5	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	192	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=28352	133.86	3	2356.0283	2356.0283	R	S	38	64
PSM	SKGFGFVCFSSPEEATK	193	sp|Q9H361|PABP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=22733	104.22	2	1956.8329	1956.8329	R	A	332	349
PSM	SLQLPASPAPDPSPRPAYK	194	sp|Q9Y2H5|PKHA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=16629	73.384	2	2071.014	2071.0140	R	V	842	861
PSM	SPQSPGGNICHLGAPK	195	sp|Q9H609|ZN576_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=10190	44.652	2	1704.775	1704.7750	R	C	20	36
PSM	SRTGSESSQTGTSTTSSR	196	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=688	5.0569	2	1895.7858	1895.7858	R	N	379	397
PSM	SSRDPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLR	197	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=24289	112.15	3	4356.0105	4356.0105	K	K	566	607
PSM	STTPPPAEPVSLPQEPPKPR	198	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=14929	65.5	2	2204.0878	2204.0878	K	V	225	245
PSM	SVGKVEPSSQSPGRSPR	199	sp|Q8IUD2-5|RB6I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=2097	9.7758	2	1913.8398	1913.8398	R	L	7	24
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	200	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=19643	88.373	3	2536.2574	2536.2574	K	T	508	533
PSM	TGSGSPFAGNSPAREGEQDAASLKDVFK	201	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=24582	113.77	3	2982.2798	2982.2798	K	G	1265	1293
PSM	TGVTSTSDSEEEGDDQEGEKKR	202	sp|O75475-3|PSIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1715	8.3368	2	2542.9586	2542.9586	K	K	267	289
PSM	TKEYVSNDAAQSDDEEKLQSQPTDTDGGR	203	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=9271	40.816	4	3263.3739	3263.3739	R	L	367	396
PSM	TKEYVSNDAAQSDDEEKLQSQPTDTDGGR	204	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=9272	40.818	3	3263.3739	3263.3739	R	L	367	396
PSM	VKAQTPPGPSLSGSKSPCPQEK	205	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7798	34.355	3	2439.0906	2439.0906	K	S	999	1021
PSM	VKLGSPDSTSPSSSPTFWNYSR	206	sp|Q96SK2-3|TM209_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=20681	93.606	3	2479.1057	2479.1057	R	S	256	278
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	207	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23202	106.59983666666668	3	3448.4199	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	208	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23932	110.39408666666667	3	3448.4198	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	209	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22083	100.86369499999999	3	3448.4223	3448.4228	K	L	104	135
PSM	QAQQERDELADEIANSSGKGALALEEK	210	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28	ms_run[1]:scan=24142	111.40814666666665	3	2882.3822	2882.3888	R	R	1698	1725
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	211	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,11-UNIMOD:267,18-UNIMOD:4,26-UNIMOD:267	ms_run[1]:scan=30069	144.00693	3	2357.035040	2356.028280	R	S	38	64
PSM	DASDDLDDLNFFNQKK	212	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=24300	112.19708500000002	2	1895.894615	1895.893995	K	K	65	81
PSM	DASDDLDDLNFFNQKK	213	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=24475	113.196285	2	1883.855096	1883.853737	K	K	65	81
PSM	VGVEASEETPQTSSSSARPGTPSDHQSQEASQFER	214	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21	ms_run[1]:scan=11465	50.06831666666667	4	3782.632288	3782.629314	R	K	362	397
PSM	AGVLGGPATPASGPGPASAEPAVTEPGLGPDPKDTIIDVVGAPLTPNSR	215	sp|Q9NPF5|DMAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	33-UNIMOD:188,45-UNIMOD:21,49-UNIMOD:267	ms_run[1]:scan=29438	140.16448333333332	4	4666.345573	4666.350231	R	K	401	450
PSM	RCSSSSSSSSSSSSSSSSSSSSR	216	sp|Q5VV67|PPRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	2-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=4580	20.314283333333336	3	2630.691137	2630.715659	R	S	1478	1501
PSM	AAPEASSPPASPLQHLLPGK	217	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22301	101.95	2	2053.0341	2053.0341	K	A	673	693
PSM	APSPLGPTRDPVATFLETCR	218	sp|Q0VG06-3|FP100_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,9-UNIMOD:267,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=27510	129.14	3	2284.0826	2284.0826	R	E	514	534
PSM	DASDDLDDLNFFNQKK	219	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=24669	114.22	2	1895.894	1895.8940	K	K	65	81
PSM	DASDDLDDLNFFNQKK	220	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24670	114.22	2	1883.8537	1883.8537	K	K	65	81
PSM	DLDDLEVLVKQEAAGK	221	sp|Q6NWY9-2|PR40B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=26721	124.81	2	1741.9098	1741.9098	K	Q	160	176
PSM	FSGFSAKPNNSGEAPSSPTPK	222	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=10659	46.547	3	2185.9681	2185.9681	K	R	139	160
PSM	FTDKDQQPSGSEGEDDDAEAALKK	223	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10056	44.086	3	2740.079	2740.0790	K	E	78	102
PSM	GRASSHSSQTQGGGSVTK	224	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=712	5.1433	2	1890.7622	1890.7622	R	K	301	319
PSM	HSPIAPSSPSPQVLAQK	225	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=12431	54.297	2	1828.918	1828.9180	R	Y	305	322
PSM	HTGPNSPDTANDGFVR	226	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7900	34.883	2	1773.7347	1773.7347	K	L	99	115
PSM	IAAPELHKGDSDSEEDEPTK	227	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:188,11-UNIMOD:21,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=8989	39.583	2	2338.9646	2338.9646	K	K	147	167
PSM	IDHLSSSAPGSPPDLLESVPK	228	sp|Q5TC82-2|RC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=22737	104.24	3	2231.0818	2231.0818	K	S	525	546
PSM	IHIDPEIQDGSPTTSR	229	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=13199	57.747	2	1844.8306	1844.8306	R	R	102	118
PSM	ILQEKLDQPVSAPPSPR	230	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=13529	59.279	2	1953.9925	1953.9925	R	D	230	247
PSM	KDNEESEQPPVPGTPTLR	231	sp|O15439-4|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=11599	50.704	2	2072.9416	2072.9416	K	N	558	576
PSM	KILDPNTGEPAPVLSSPPPADVSTFLAFPSPEK	232	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,15-UNIMOD:21,33-UNIMOD:188	ms_run[2]:scan=30252	145.07	3	3509.7774	3509.7774	R	L	413	446
PSM	KLEKEEEEGISQESSEEEQ	233	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6759	29.722	2	2395.9193	2395.9193	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	234	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6975	30.735	2	2395.9193	2395.9193	K	-	89	108
PSM	KTSEEEKNGSEELVEK	235	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,3-UNIMOD:21,7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3492	15.249	2	1932.9063	1932.9063	R	K	80	96
PSM	KVEEEQEADEEDVSEEEAESK	236	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,14-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=7879	34.801	3	2529.0206	2529.0206	K	E	234	255
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	237	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=29533	140.73	3	2919.3732	2919.3732	R	E	968	993
PSM	LHQSASSSTSSLSTR	238	sp|O15085|ARHGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=2573	11.723	2	1627.7203	1627.7203	R	S	648	663
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	239	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=14914	65.434	3	3106.2061	3106.2061	K	N	561	587
PSM	RALASNTSFFSGCSPIEEEAH	240	sp|O95239|KIF4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=19882	89.565	3	2389.0046	2389.0046	K	-	1212	1233
PSM	RCSDNTEVEVSNLENKQPVESTSAK	241	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=13679	59.89	3	2900.2859	2900.2859	K	S	70	95
PSM	RIDFIPVSPAPSPTR	242	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,8-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=21746	99.038	2	1831.8538	1831.8538	K	G	136	151
PSM	RIDFIPVSPAPSPTR	243	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=21744	99.027	2	1811.8373	1811.8373	K	G	136	151
PSM	RTAFYNEDDSEEEQR	244	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,10-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=8050	35.592	2	1987.77	1987.7700	R	Q	1774	1789
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	245	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=17979	79.911	2	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	246	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=18177	80.931	2	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	247	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=20338	91.891	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	248	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=20800	94.224	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	249	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=31160	150.58	3	2356.0283	2356.0283	R	S	38	64
PSM	SPISPELHSAPLTPVAR	250	sp|Q7Z3B3-4|KANL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=18617	83.173	2	1860.9374	1860.9374	R	D	259	276
PSM	SPLELGEKLSPLPGGPGAGDPR	251	sp|Q15742-2|NAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=21089	95.693	3	2223.0937	2223.0937	K	I	162	184
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	252	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=11885	52.017	3	2696.2583	2696.2583	R	R	207	233
PSM	TAHNSEADLEESFNEHELEPSSPK	253	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=18064	80.351	3	2776.1501	2776.1501	K	S	100	124
PSM	TCFSPNRVIGLSSDLQQVGGASAR	254	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=25767	119.77	3	2599.2214	2599.2214	K	I	255	279
PSM	THSTSSSLGSGESPFSR	255	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=10997	48.006	2	1812.7555	1812.7555	R	S	240	257
PSM	TLSDDLDEAAKEFQEK	256	sp|Q9H0A0-2|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=25485	118.31	2	1849.8984	1849.8984	K	H	860	876
PSM	TPHDILEDINASPEMR	257	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=21058	95.548	2	1916.8339	1916.8339	K	Q	203	219
PSM	VAAAAGSGPSPPGSPGHDR	258	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=3887	17.162	2	1766.7737	1766.7737	R	E	38	57
PSM	VKAQTPPGPSLSGSKSPCPQEK	259	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7696	33.822	2	2439.0906	2439.0906	K	S	999	1021
PSM	VTKSPQKSTVLTNGEAAMQSSNSESK	260	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=11155	48.703	3	2788.295	2788.2950	K	K	83	109
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	261	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,3-UNIMOD:188,7-UNIMOD:188,16-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=8055	35.61283666666667	3	3029.3778	3029.3776	K	S	145	174
PSM	WTPKSPLDPDSGLLSCTLPNGFGGQSGPEGER	262	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:188,5-UNIMOD:21,16-UNIMOD:4,32-UNIMOD:267	ms_run[1]:scan=29579	141.00817833333335	3	3452.554633	3451.572649	R	S	228	260
PSM	GIPLATGDTSPEPELLPGAPLPPPKEVINGNIK	263	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:21,25-UNIMOD:188,33-UNIMOD:188	ms_run[1]:scan=28209	133.0387	3	3423.795988	3422.814098	K	T	33	66
PSM	STLESEKPGSPEAAETSPPSNIIDHCEK	264	sp|Q96T23|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=14539	63.819005000000004	3	3090.354599	3089.353656	K	L	613	641
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEPR	265	sp|Q9P2K5|MYEF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=14885	65.31535333333333	3	2986.3484	2986.3453	M	R	2	31
PSM	QFCQEGQPHVLEALSPPQTSGLSPSR	266	sp|Q9H063|MAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,3-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=25832	120.12378333333332	3	2914.3212	2912.3162	K	L	46	72
PSM	NDISPPGRFFSSQIPSSVNK	267	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21	ms_run[1]:scan=22169	101.26783499999999	3	2258.042473	2256.057613	K	S	1066	1086
PSM	IGGDAATTVNNSTPDFGFGGQKR	268	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	13-UNIMOD:21	ms_run[1]:scan=18172	80.90509833333333	3	2390.054571	2389.069968	K	Q	88	111
PSM	AAEDDEDDDVDTKK	269	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1291	6.9669	2	1576.6779	1576.6779	R	Q	90	104
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	270	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=24015	110.79	3	2812.4161	2812.4161	K	V	421	449
PSM	APVPEPGLDLSLSPRPDSPQPR	271	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=21433	97.451	2	2404.1788	2404.1788	R	H	35	57
PSM	ARTDEVPAGGSRSEAEDEDDEDYVPYVPLR	272	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=22099	100.94	3	3496.4345	3496.4345	R	Q	11	41
PSM	CRESCSSPSTVGSSLTTR	273	sp|Q7Z589-6|EMSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,2-UNIMOD:267,5-UNIMOD:4,7-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=8612	38.069	2	2070.8615	2070.8615	K	K	1116	1134
PSM	DLDDLEVLVKQEAAGK	274	sp|Q6NWY9-2|PR40B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=26710	124.75	2	1753.9501	1753.9501	K	Q	160	176
PSM	DVDEAYMNKVELESR	275	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16174	71.256	2	1796.8251	1796.8251	K	L	199	214
PSM	EHYPVSSPSSPSPPAQPGGVSR	276	sp|O75179-4|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=10184	44.63	3	2299.027	2299.0270	K	N	1443	1465
PSM	EHYPVSSPSSPSPPAQPGGVSR	277	sp|O75179-4|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=10532	45.993	3	2309.0353	2309.0353	K	N	1443	1465
PSM	ETKDTDIVDEAIYYFK	278	sp|O15145|ARPC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29458	140.27	2	1948.9306	1948.9306	R	A	35	51
PSM	EVPSKEEPSPVKAEVAEK	279	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:188,9-UNIMOD:21,12-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=7647	33.574	2	2050.037	2050.0370	K	Q	606	624
PSM	FLNKSPEEPSTPGTVVSSPSISTPPIVPDIQK	280	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:188,5-UNIMOD:21,32-UNIMOD:188	ms_run[2]:scan=24833	115.07	3	3439.7566	3439.7566	K	N	165	197
PSM	FLNKSPEEPSTPGTVVSSPSISTPPIVPDIQK	281	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=24834	115.07	4	3427.7164	3427.7164	K	N	165	197
PSM	GLLSQGSPLSWEETKR	282	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=21007	95.304	2	1866.8877	1866.8877	M	H	2	18
PSM	GLLYDSDEEDEERPAR	283	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=13417	58.727	2	1972.8051	1972.8051	R	K	134	150
PSM	GRNAPAAVDEGSISPR	284	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=7071	31.09	2	1675.7679	1675.7679	R	T	371	387
PSM	GRWESQQDVSQTTVSR	285	sp|Q9NQT8|KI13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,5-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=9179	40.396	2	1962.87	1962.8700	K	G	1406	1422
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	286	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	25-UNIMOD:21	ms_run[2]:scan=17040	75.394	3	2931.3764	2931.3764	R	D	374	402
PSM	HTGPNSPDTANDGFVR	287	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=7999	35.361	2	1763.7264	1763.7264	K	L	99	115
PSM	IAEFTTNLTEEEEKSK	288	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14857	65.21	2	1867.9051	1867.9051	R	S	1001	1017
PSM	IHAESLLLDSPAVAK	289	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=18599	83.104	2	1642.8331	1642.8331	R	S	370	385
PSM	IHAESLLLDSPAVAK	290	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=18397	82.073	2	1648.8533	1648.8533	R	S	370	385
PSM	IHAESLLLDSPAVAK	291	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=18602	83.119	2	1648.8533	1648.8533	R	S	370	385
PSM	IHIDPEIQDGSPTTSR	292	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=12856	56.114	2	1854.8388	1854.8388	R	R	102	118
PSM	KLEKEEEEGISQESSEEEQ	293	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5337	23.428	2	2407.9596	2407.9596	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	294	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6349	27.881	2	2407.9596	2407.9596	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	295	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=7344	32.098	2	2395.9193	2395.9193	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	296	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=8151	36.032	3	2395.9193	2395.9193	K	-	89	108
PSM	KPSLVSDLPWEGAAPQSPSFSGSEDSGSPK	297	sp|Q13425-2|SNTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,17-UNIMOD:21,30-UNIMOD:188	ms_run[2]:scan=24869	115.22	3	3135.4477	3135.4477	K	H	206	236
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	298	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=15078	66.275	3	2717.3078	2717.3078	R	R	31	56
PSM	KSEDSLLRNSDEEESASESELWK	299	sp|Q70Z53|F10C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=19940	89.842	3	2827.1474	2827.1474	K	G	269	292
PSM	KVVDYSQFQESDDADEDYGR	300	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=14526	63.765	3	2444.9646	2444.9646	R	D	9	29
PSM	LVSFHDDSDEDLLHI	301	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=26362	122.96	2	1833.7822	1833.7822	K	-	2477	2492
PSM	NKAITSLLGGGSPK	302	sp|Q6KC79-2|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=15984	70.427	2	1421.7279	1421.7279	R	N	2647	2661
PSM	PFSAPKPQTSPSPK	303	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:188,10-UNIMOD:21,14-UNIMOD:188	ms_run[2]:scan=7055	31.03	2	1559.7788	1559.7788	K	R	298	312
PSM	RQEQPSIESTSPISR	304	sp|Q5T5P2|SKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=8858	39.047	2	1793.8309	1793.8309	R	T	1640	1655
PSM	RSDLDLGYEPEGSASPTPPYLK	305	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=21912	99.919	3	2471.1258	2471.1258	R	W	63	85
PSM	RSVPPATPATPTSPATVDAAVPGAGK	306	sp|Q6NYC8|PPR18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=14719	64.593	3	2495.2421	2495.2421	R	K	478	504
PSM	RVQSLPSVPLSCAAYR	307	sp|Q96AD5-2|PLPL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=19658	88.466	2	1882.9125	1882.9125	R	E	77	93
PSM	SEDDSAKFDSNEEDSASVFSPSFGLK	308	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=24847	115.12	3	2874.1757	2874.1757	K	Q	1452	1478
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	309	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=19219	86.214	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	310	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=19686	88.601	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	311	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,11-UNIMOD:267,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=24367	112.57	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	312	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=25387	117.82	3	2356.0283	2356.0283	R	S	38	64
PSM	SGLSCQVGSATSHPVSCQEPIDEDQRISPK	313	sp|Q8TEP8|CE192_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4,17-UNIMOD:4,28-UNIMOD:21	ms_run[2]:scan=14801	64.969	3	3348.4752	3348.4752	K	D	1173	1203
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	314	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=18016	80.112	3	3159.3475	3159.3475	R	G	2020	2049
PSM	SLSTSGESLYHVLGLDK	315	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=28899	137.02	2	1884.887	1884.8870	R	N	8	25
PSM	SPRPASPASNVVVLPSGSTVYVK	316	sp|Q7Z589-6|EMSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=19720	88.764	3	2391.2199	2391.2199	K	S	182	205
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	317	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=11906	52.102	3	2686.2501	2686.2501	R	R	207	233
PSM	SPVGKSPPSTGSTYGSSQKEESAASGGAAYTK	318	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=9604	42.215	3	3153.4139	3153.4139	K	R	315	347
PSM	SRQELASGLPSPAATQELPVER	319	sp|O95359-3|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=19698	88.647	3	2415.1795	2415.1795	R	A	1552	1574
PSM	SSRDPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLR	320	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=24195	111.68	4	4356.0105	4356.0105	K	K	566	607
PSM	STTPPPAEPVSLPQEPPKPR	321	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=14456	63.45	2	2204.0878	2204.0878	K	V	225	245
PSM	SYFHLFPPPPSPCTDSS	322	sp|O75197|LRP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=26964	126.13	2	2014.8172	2014.8172	R	-	1599	1616
PSM	TDSREDEISPPPPNPVVK	323	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=12012	52.527	2	2055.9514	2055.9514	R	G	75	93
PSM	TSSAFVGKTPEASPEPKDQTLK	324	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=10795	47.092	3	2477.1128	2477.1128	K	M	303	325
PSM	VAAAAGSGPSPPGSPGHDR	325	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=4074	18.173	2	1766.7737	1766.7737	R	E	38	57
PSM	VAPVINNGSPTILGKR	326	sp|Q13330-3|MTA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=15232	66.945	2	1714.9131	1714.9131	K	S	551	567
PSM	VKAQTPPGPSLSGSKSPCPQEK	327	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7608	33.353	3	2439.0906	2439.0906	K	S	999	1021
PSM	VKSPVSLTAHSLIGASPK	328	sp|P28749-2|RBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=18093	80.484	2	1950.9581	1950.9581	K	Q	747	765
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	329	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=24851	115.142675	3	3449.4192	3448.4232	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	330	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=22916	105.09404833333333	3	3096.565547	3095.580500	R	A	655	686
PSM	QAQQERDELADEIANSSGKGALALEEK	331	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28	ms_run[1]:scan=24166	111.524165	3	2882.3822	2882.3888	R	R	1698	1725
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	332	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[1]:scan=25816	120.03752	3	2357.033226	2356.028280	R	S	38	64
PSM	DASDDLDDLNFFNQKK	333	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=24297	112.18333999999999	2	1883.855096	1883.853737	K	K	65	81
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	334	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:21	ms_run[1]:scan=15274	67.13305	3	3107.200116	3106.206140	K	N	561	587
PSM	QNSEGSASKVPCILPIIENGKK	335	sp|Q9UJM3|ERRFI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,3-UNIMOD:21,9-UNIMOD:188,12-UNIMOD:4,21-UNIMOD:188,22-UNIMOD:188	ms_run[1]:scan=24160	111.49602	3	2449.2414	2449.2417	R	V	367	389
PSM	HGSFHEDEDPIGSPR	336	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:267	ms_run[1]:scan=10335	45.22548833333334	2	1848.675243	1848.674493	R	L	1266	1281
PSM	LGGPKETPPNGNLSPAPR	337	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:188,14-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=9426	41.44453166666666	2	1897.929176	1896.942975	K	L	991	1009
PSM	SPSSNGLSPSPGAGMLKTPSPSR	338	sp|P80192|M3K9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=989	5.99559	3	2611.920705	2610.927036	R	D	931	954
PSM	AAEDDEDDDVDTKK	339	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1281	6.9307	2	1564.6377	1564.6377	R	Q	90	104
PSM	AEDMYSAQSHQAATPPKDGK	340	sp|Q9NQ84|GPC5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=5049	22.164	2	2210.9304	2210.9304	R	N	410	430
PSM	AFTGREFDELNPSAQR	341	sp|P16615-5|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:267,13-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=16796	74.117	2	1936.8583	1936.8583	K	D	651	667
PSM	AGDNIPEEQPVASTPTTVSDGENKKDK	342	sp|Q9Y320-2|TMX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:21	ms_run[2]:scan=10544	46.043	3	2906.3183	2906.3183	K	-	232	259
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	343	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,30-UNIMOD:21	ms_run[2]:scan=24119	111.29	4	3693.7917	3693.7917	R	Q	125	162
PSM	APKPEDIDEEDDDVPDLVENFDEASKNEAN	344	sp|Q96K17-2|BT3L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=26068	121.38	3	3370.4887	3370.4887	K	-	71	101
PSM	APVPEPGLDLSLSPRPDSPQPR	345	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=21515	97.964	3	2404.1788	2404.1788	R	H	35	57
PSM	APVPEPGLDLSLSPRPDSPQPR	346	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=21733	98.977	3	2404.1788	2404.1788	R	H	35	57
PSM	ASGSLSPPILAPLSPGAEISPHDLSLESCR	347	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,29-UNIMOD:4	ms_run[2]:scan=28863	136.83	3	3137.5104	3137.5104	R	V	83	113
PSM	EALGLGPPAAQLTPPPAPVGLR	348	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=25273	117.23	3	2211.1692	2211.1692	R	G	451	473
PSM	EHSPYGPSPLGWPSSETR	349	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=19004	85.109	2	2062.8786	2062.8786	R	A	477	495
PSM	EHYPVSSPSSPSPPAQPGGVSR	350	sp|O75179-4|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=10441	45.651	3	2299.027	2299.0270	K	N	1443	1465
PSM	EKEISDDEAEEEKGEK	351	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=2737	12.299	2	1943.7885	1943.7885	R	E	222	238
PSM	ELAQPSGGHLPQASPISVYLFPGER	352	sp|Q2TAZ0|ATG2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=27303	127.96	3	2739.3297	2739.3297	R	S	1296	1321
PSM	ESKEEETSIDVAGKPNEVTK	353	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=8505	37.618	2	2269.0363	2269.0363	K	A	460	480
PSM	FGDFLQHSPSILQSK	354	sp|Q96Q89-5|KI20B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=22368	102.27	2	1788.8543	1788.8543	K	A	425	440
PSM	GDVTAEEAAGASPAKANGQENGHVKSNGDLSPK	355	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=8615	38.083	3	3365.4562	3365.4562	R	G	11	44
PSM	GKGFSVVADTPELQR	356	sp|Q14847-3|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=15322	67.349	2	1682.8029	1682.8029	K	I	39	54
PSM	GLGKPGGQGDAIQLSPK	357	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,15-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=12129	52.988	2	1713.8854	1713.8854	K	L	160	177
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	358	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,14-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=16668	73.571	3	2669.1873	2669.1873	K	S	61	87
PSM	GVGSGPHPPDTQQPSPSK	359	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=4457	19.831	2	1851.8153	1851.8153	R	A	406	424
PSM	HCAPSPDRSPELSSSR	360	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4225	18.851	2	1941.7442	1941.7442	R	D	622	638
PSM	HSGPNSADSANDGFVR	361	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=6092	26.703	2	1709.6795	1709.6795	K	L	99	115
PSM	HTGPNSPDTANDGFVR	362	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6843	30.14	2	1773.7347	1773.7347	K	L	99	115
PSM	HTGPNSPDTANDGFVR	363	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=7796	34.344	2	1763.7264	1763.7264	K	L	99	115
PSM	IADPEHDHTGFLTEYVATR	364	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,15-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=18231	81.213	2	2340.9693	2340.9693	R	W	190	209
PSM	IDIFPAKENGDLSPFSGTSLR	365	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=26737	124.91	2	2343.1148	2343.1148	K	E	1209	1230
PSM	IHIDPEIQDGSPTTSR	366	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=13279	58.138	2	1854.8388	1854.8388	R	R	102	118
PSM	IHIDPEIQDGSPTTSR	367	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=12860	56.13	2	1844.8306	1844.8306	R	R	102	118
PSM	IVRGDQPAASGDSDDDEPPPLPR	368	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:267,13-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=12523	54.683	3	2503.1131	2503.1131	K	L	45	68
PSM	KDSEEEVSLLGSQDIEEGNHQVEDGCR	369	sp|Q9Y487|VPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=18468	82.436	3	3138.3085	3138.3085	R	E	693	720
PSM	KGVSASAVPFTPSSPLLSCSQEGSR	370	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=20413	92.265	3	2628.2255	2628.2255	R	H	558	583
PSM	KLEKEEEEGISQESSEEEQ	371	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5891	25.834	2	2395.9193	2395.9193	K	-	89	108
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	372	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=18245	81.296	3	2742.2819	2742.2819	K	K	761	786
PSM	KQSLGELIGTLNAAK	373	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,3-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=24296	112.18	2	1633.8843	1633.8843	R	V	19	34
PSM	KSPSGPVKSPPLSPVGTTPVK	374	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=13234	57.937	3	2219.1004	2219.1004	R	L	177	198
PSM	KTSEEEKNGSEELVEK	375	sp|Q9H0C8|ILKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=3478	15.19	2	1914.8459	1914.8459	R	K	80	96
PSM	LHQSASSSTSSLSTR	376	sp|O15085|ARHGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=2616	11.879	2	1637.7286	1637.7286	R	S	648	663
PSM	LHVGNISPTCTNQELR	377	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=14821	65.063	2	1927.8851	1927.8851	K	A	80	96
PSM	LHVGNISPTCTNQELR	378	sp|Q9BQ04|RBM4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=14847	65.17	2	1917.8768	1917.8768	K	A	80	96
PSM	LPNTYPNSSSPGPGGLGGSVHYATMAR	379	sp|Q96N67-4|DOCK7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,27-UNIMOD:267	ms_run[2]:scan=19235	86.299	3	2777.2508	2777.2508	R	S	855	882
PSM	LTAGVPDTPTRLVFSALGPTSLR	380	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=31216	150.94	2	2448.2778	2448.2778	R	V	1453	1476
PSM	LVSFHDDSDEDLLHI	381	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=26172	121.94	2	1833.7822	1833.7822	K	-	2477	2492
PSM	NGFPHPEPDCNPSEAASEESNSEIEQEIPVEQK	382	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=20237	91.34	3	3773.5676	3773.5676	K	E	84	117
PSM	NTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAK	383	sp|O95251-4|KAT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,11-UNIMOD:267,12-UNIMOD:21,39-UNIMOD:188	ms_run[2]:scan=15256	67.066	4	4249.7933	4245.8052	K	D	117	156
PSM	RADLNQGIGEPQSPSR	384	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=7320	31.989	2	1803.8265	1803.8265	R	R	62	78
PSM	RALASNTSFFSGCSPIEEEAH	385	sp|O95239|KIF4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=19949	89.874	3	2389.0046	2389.0046	K	-	1212	1233
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	386	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,5-UNIMOD:4,6-UNIMOD:4,7-UNIMOD:21,23-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=19639	88.357	3	2881.141	2881.1410	R	L	22	47
PSM	SEDADRCTLPEHESPSQDISDACEAESTER	387	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:267,7-UNIMOD:4,14-UNIMOD:21,23-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=14959	65.665	3	3520.3783	3520.3783	K	C	664	694
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	388	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=18798	84.043	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	389	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=22215	101.5	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	390	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=24083	111.13	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	391	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=25157	116.65	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	392	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=26027	121.16	3	2356.0283	2356.0283	R	S	38	64
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	393	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=31368	151.79	3	2356.0283	2356.0283	R	S	38	64
PSM	SGRNDGLLALSSPDAEEPQLPDGTGR	394	sp|O15027-5|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=22616	103.58	3	2731.245	2731.2450	R	E	2242	2268
PSM	SISREPSPALGPNLDGSGLLPR	395	sp|Q9BRZ2|TRI56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=23028	105.68	3	2312.1526	2312.1526	K	P	469	491
PSM	SISREPSPALGPNLDGSGLLPR	396	sp|Q9BRZ2|TRI56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=23223	106.71	3	2312.1526	2312.1526	K	P	469	491
PSM	SKQLQQSPTPTCPTPELGSPLPSR	397	sp|Q8IWY9|CDAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16280	71.715	3	2685.2833	2685.2833	R	T	259	283
PSM	SLLGLDSGELQSGPESSSSPGVHVR	398	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=21982	100.32	3	2584.2046	2584.2046	R	Q	987	1012
PSM	SNSAPLIHGLSDTSPVFQAEAPSAR	399	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=24587	113.8	3	2631.233	2631.2330	R	R	35	60
PSM	SYELPDGQVITIGNER	400	sp|P63267-2|ACTH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=23424	107.67	2	1789.8846	1789.8846	K	F	197	213
PSM	TCFSPNRVIGLSSDLQQVGGASAR	401	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,2-UNIMOD:4,7-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=25719	119.52	3	2619.2379	2619.2379	K	I	255	279
PSM	TDCSSGDASRPSSDNADSPKSGPK	402	sp|Q9NZN5-2|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=1047	6.1808	3	2501.9966	2501.9966	R	E	273	297
PSM	TDSREDEISPPPPNPVVK	403	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=12503	54.606	2	2055.9514	2055.9514	R	G	75	93
PSM	TEVALAKDMESPTKLDVTLAK	404	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=21794	99.306	2	2339.1695	2339.1695	K	D	270	291
PSM	TFSLDAVPPDHSPR	405	sp|Q9BST9-3|RTKN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=16226	71.483	2	1627.7271	1627.7271	R	A	468	482
PSM	VGQFGQHYQSSASSSSSSSFPSPQR	406	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:21	ms_run[2]:scan=12547	54.783	3	2709.1457	2709.1457	R	F	228	253
PSM	YLSFTPPEKDGFPSGTPALNAK	407	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=24359	112.53	3	2416.1352	2416.1352	K	G	139	161
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	408	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22831	104.72228166666666	3	3448.4200	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	409	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=31256	151.15498666666667	3	3448.4195	3448.4228	K	L	104	135
PSM	SILKPSTPIPPQEGEEVGESSEEQDNAPK	410	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	20-UNIMOD:21	ms_run[1]:scan=16032	70.64810833333334	3	3172.453388	3171.449665	R	S	1048	1077
PSM	TAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGR	411	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	20-UNIMOD:188,29-UNIMOD:21,37-UNIMOD:267	ms_run[1]:scan=24692	114.32344499999999	4	3929.957459	3928.972902	K	V	906	943
PSM	WTPKSPLDPDSGLLSCTLPNGFGGQSGPEGER	412	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=29571	140.958005	3	3436.526020	3435.544251	R	S	228	260
PSM	WTPKSPLDPDSGLLSCTLPNGFGGQSGPEGER	413	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=28925	137.17284166666667	3	3436.525604	3435.544251	R	S	228	260
PSM	DASDDLDDLNFFNQKK	414	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=24477	113.20553500000001	2	1895.894615	1895.893995	K	K	65	81
PSM	PPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	415	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	18-UNIMOD:21,32-UNIMOD:4,44-UNIMOD:267	ms_run[1]:scan=26925	125.90657	4	3957.938383	3956.948357	R	R	27	71
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	416	sp|Q5HYK7|SH319_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:188,28-UNIMOD:188	ms_run[1]:scan=23965	110.55029166666668	3	3077.4588	3077.4603	K	L	268	296
PSM	DASDDLDDLNFFNQKK	417	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=23538	108.19340666666666	2	1896.878378	1895.893995	K	K	65	81
PSM	LPSPTPENKDLFFVTR	418	sp|Q5VWQ8|DAB2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=23012	105.60622833333335	2	1940.945249	1939.944480	R	S	700	716
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	419	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,11-UNIMOD:267,18-UNIMOD:4,26-UNIMOD:267	ms_run[1]:scan=27441	128.760435	3	2359.053798	2356.028280	R	S	38	64
PSM	TVLTGTKDTVCSGVTGAANVAKGAVQTGLK	420	sp|Q96Q06|PLIN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:4,22-UNIMOD:188,27-UNIMOD:21	ms_run[1]:scan=17244	76.38970166666667	4	3150.450976	3149.457744	K	T	809	839
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	421	sp|Q9UK58|CCNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:188,19-UNIMOD:21,23-UNIMOD:188,25-UNIMOD:21,28-UNIMOD:267	ms_run[1]:scan=20808	94.25663	3	2891.391934	2891.389782	K	E	317	345
PSM	PRSTGSLGSSPGAPASPGAVPGKCVR	422	sp|Q9UH17-2|ABC3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,9-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=21553	98.15916999999999	3	2612.208490	2609.182252	R	S	219	245