MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL11.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL11.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	null	11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,28-UNIMOD:21,39-UNIMOD:267	0.03	57.0	3	1	0
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	77-UNIMOD:267,90-UNIMOD:21,113-UNIMOD:267	0.04	52.0	2	1	0
PRT	sp|Q2M2I8-2|AAK1_HUMAN	Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	20-UNIMOD:21	0.03	51.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	1384-UNIMOD:21,1389-UNIMOD:4	0.01	50.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	846-UNIMOD:21,847-UNIMOD:21	0.04	49.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	5737-UNIMOD:21,5740-UNIMOD:188,5744-UNIMOD:188,5747-UNIMOD:188,207-UNIMOD:267,216-UNIMOD:21,225-UNIMOD:267	0.01	48.0	2	2	2
PRT	sp|Q5VWJ9|SNX30_HUMAN	Sorting nexin-30 OS=Homo sapiens OX=9606 GN=SNX30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	67-UNIMOD:21	0.07	48.0	1	1	1
PRT	sp|Q9BXB5|OSB10_HUMAN	Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	201-UNIMOD:21,203-UNIMOD:4,206-UNIMOD:267	0.03	48.0	2	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	242-UNIMOD:4,250-UNIMOD:21,257-UNIMOD:188,249-UNIMOD:21	0.03	48.0	5	1	0
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	401-UNIMOD:21	0.04	47.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	22-UNIMOD:21,36-UNIMOD:4,20-UNIMOD:188,37-UNIMOD:188,21-UNIMOD:21	0.02	47.0	4	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1171-UNIMOD:21	0.02	47.0	1	1	1
PRT	sp|Q9BVJ6-2|UT14A_HUMAN	Isoform 2 of U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	269-UNIMOD:21	0.05	47.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	127-UNIMOD:21	0.05	47.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	47.0	1	1	1
PRT	sp|Q15742|NAB2_HUMAN	NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	171-UNIMOD:21	0.04	47.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188,692-UNIMOD:21,705-UNIMOD:188,691-UNIMOD:21	0.07	47.0	9	2	0
PRT	sp|Q9UK58-6|CCNL1_HUMAN	Isoform 4 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	335-UNIMOD:21,342-UNIMOD:21	0.07	46.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188	0.05	46.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	566-UNIMOD:267,575-UNIMOD:21,587-UNIMOD:267	0.03	46.0	4	1	0
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	87-UNIMOD:21,92-UNIMOD:267	0.04	46.0	1	1	0
PRT	sp|Q99523|SORT_HUMAN	Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	814-UNIMOD:21	0.03	46.0	1	1	1
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	38-UNIMOD:188	0.11	45.0	2	1	0
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	87-UNIMOD:21,92-UNIMOD:267	0.06	45.0	3	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	225-UNIMOD:21,226-UNIMOD:21,233-UNIMOD:267	0.01	45.0	2	1	0
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	77-UNIMOD:188,82-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188,94-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	356-UNIMOD:188,357-UNIMOD:21,372-UNIMOD:188	0.01	45.0	3	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	830-UNIMOD:21	0.03	45.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	624-UNIMOD:21,629-UNIMOD:188	0.03	44.0	2	1	0
PRT	sp|O75379|VAMP4_HUMAN	Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	30-UNIMOD:21,23-UNIMOD:267,39-UNIMOD:267	0.13	44.0	2	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	308-UNIMOD:21,317-UNIMOD:188,319-UNIMOD:188,2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21	0.01	44.0	5	2	1
PRT	sp|P30740|ILEU_HUMAN	Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	129-UNIMOD:267	0.05	44.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267,181-UNIMOD:21	0.04	44.0	9	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	351-UNIMOD:28,353-UNIMOD:21	0.05	44.0	1	1	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	220-UNIMOD:21,225-UNIMOD:188,228-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	366-UNIMOD:21,383-UNIMOD:188	0.05	43.0	3	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	47-UNIMOD:267,57-UNIMOD:21,67-UNIMOD:267,129-UNIMOD:21	0.34	43.0	5	2	0
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	195-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	247-UNIMOD:21,234-UNIMOD:188,254-UNIMOD:188	0.10	43.0	3	2	1
PRT	sp|P42684-4|ABL2_HUMAN	Isoform 4 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	858-UNIMOD:21,860-UNIMOD:4	0.03	43.0	1	1	1
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	14-UNIMOD:21	0.08	43.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	345-UNIMOD:21,344-UNIMOD:21,347-UNIMOD:188,363-UNIMOD:188	0.05	43.0	2	1	0
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	522-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	364-UNIMOD:21,374-UNIMOD:21,380-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	532-UNIMOD:21,534-UNIMOD:188,539-UNIMOD:188	0.02	42.0	4	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	93-UNIMOD:267	0.05	42.0	2	1	0
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	524-UNIMOD:4	0.03	42.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	182-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	610-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	271-UNIMOD:188,280-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	50-UNIMOD:21	0.09	42.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	204-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|Q15742-2|NAB2_HUMAN	Isoform 2 of NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	171-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	475-UNIMOD:188,478-UNIMOD:21,492-UNIMOD:188,494-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1012-UNIMOD:21,1026-UNIMOD:188	0.01	42.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.07	42.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	1103-UNIMOD:28,1106-UNIMOD:21,1004-UNIMOD:21	0.02	42.0	2	2	2
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q5VZL5|ZMYM4_HUMAN	Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	1232-UNIMOD:385,1232-UNIMOD:4,1241-UNIMOD:21,1243-UNIMOD:267,1264-UNIMOD:4,1265-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	177-UNIMOD:21	0.05	42.0	3	1	0
PRT	sp|Q9NRA0-4|SPHK2_HUMAN	Isoform 4 of Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	425-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1156-UNIMOD:21,1166-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	437-UNIMOD:4	0.03	41.0	1	1	1
PRT	sp|O14595|CTDS2_HUMAN	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens OX=9606 GN=CTDSP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	57-UNIMOD:21	0.10	41.0	1	1	1
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	408-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q8IYB7|DI3L2_HUMAN	DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	396-UNIMOD:4,397-UNIMOD:188,405-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	907-UNIMOD:267,910-UNIMOD:21,922-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	255-UNIMOD:21,263-UNIMOD:188,265-UNIMOD:188,266-UNIMOD:188	0.02	41.0	4	1	0
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	28-UNIMOD:4,31-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	114-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q9UMZ2-4|SYNRG_HUMAN	Isoform 3 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	841-UNIMOD:21,829-UNIMOD:188,850-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	211-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.12	41.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.15	41.0	1	1	1
PRT	sp|Q6WKZ4-2|RFIP1_HUMAN	Isoform 4 of Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	54-UNIMOD:21,209-UNIMOD:21,210-UNIMOD:21,219-UNIMOD:188	0.11	41.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	214-UNIMOD:21,207-UNIMOD:188,224-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	74-UNIMOD:21,62-UNIMOD:267,77-UNIMOD:267	0.07	41.0	2	1	0
PRT	sp|Q9P2R6|RERE_HUMAN	Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	613-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	223-UNIMOD:267,237-UNIMOD:21,241-UNIMOD:267	0.09	41.0	2	1	0
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	667-UNIMOD:4,674-UNIMOD:21,681-UNIMOD:188,690-UNIMOD:188	0.03	41.0	3	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	525-UNIMOD:21,504-UNIMOD:267,530-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|O15014|ZN609_HUMAN	Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1285-UNIMOD:21,1290-UNIMOD:4,576-UNIMOD:21,578-UNIMOD:21,582-UNIMOD:188,586-UNIMOD:188	0.03	41.0	2	2	2
PRT	sp|Q9UMZ2|SYNRG_HUMAN	Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	907-UNIMOD:188,919-UNIMOD:21,928-UNIMOD:188	0.02	41.0	1	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	244-UNIMOD:28,264-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q9BZZ5-1|API5_HUMAN	Isoform 1 of Apoptosis inhibitor 5 OS=Homo sapiens OX=9606 GN=API5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	390-UNIMOD:21,395-UNIMOD:188,396-UNIMOD:188,402-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	16-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	498-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	85-UNIMOD:21,93-UNIMOD:188,88-UNIMOD:21	0.03	40.0	3	1	0
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	572-UNIMOD:4,576-UNIMOD:188	0.01	40.0	2	1	0
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2683-UNIMOD:21	0.01	40.0	3	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	343-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	767-UNIMOD:21,773-UNIMOD:21,761-UNIMOD:188,785-UNIMOD:188,775-UNIMOD:21	0.03	40.0	4	1	0
PRT	sp|Q9H4L5-5|OSBL3_HUMAN	Isoform 2a of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	304-UNIMOD:21,317-UNIMOD:188,410-UNIMOD:21,415-UNIMOD:188	0.07	40.0	4	3	2
PRT	sp|Q9H694-2|BICC1_HUMAN	Isoform 2 of Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	836-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	576-UNIMOD:21,586-UNIMOD:267	0.03	40.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	15-UNIMOD:21,17-UNIMOD:21	0.14	40.0	2	2	2
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	58-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	419-UNIMOD:21,429-UNIMOD:21,431-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q8IX07|FOG1_HUMAN	Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	909-UNIMOD:21,898-UNIMOD:267,915-UNIMOD:267	0.02	40.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	47-UNIMOD:21,56-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	168-UNIMOD:188,182-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|O75909|CCNK_HUMAN	Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	340-UNIMOD:21,342-UNIMOD:188,346-UNIMOD:188,354-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	987-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	679-UNIMOD:21,692-UNIMOD:188	0.03	39.0	1	1	0
PRT	sp|O14795|UN13B_HUMAN	Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	366-UNIMOD:21,373-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	467-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P22670|RFX1_HUMAN	MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	204-UNIMOD:21,219-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	3539-UNIMOD:21,3538-UNIMOD:188,3542-UNIMOD:188,3554-UNIMOD:188	0.00	39.0	2	1	0
PRT	sp|P16220-3|CREB1_HUMAN	Isoform 3 of Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	142-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1944-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	133-UNIMOD:21,138-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q96AG3-3|S2546_HUMAN	Isoform 3 of Solute carrier family 25 member 46 OS=Homo sapiens OX=9606 GN=SLC25A46	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	45-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	104-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	378-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1000-UNIMOD:188,1003-UNIMOD:21,1013-UNIMOD:188,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:188	0.01	39.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	894-UNIMOD:267,897-UNIMOD:21,907-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1256-UNIMOD:21,1265-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	121-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	888-UNIMOD:21,898-UNIMOD:188,902-UNIMOD:188	0.01	39.0	2	1	0
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	583-UNIMOD:21,587-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	955-UNIMOD:21,963-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1261-UNIMOD:21,1274-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2468-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	463-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	22-UNIMOD:21,116-UNIMOD:21,122-UNIMOD:21,134-UNIMOD:4	0.33	38.0	3	2	1
PRT	sp|Q5T481|RBM20_HUMAN	RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1048-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	623-UNIMOD:4,629-UNIMOD:267,630-UNIMOD:21,634-UNIMOD:21,637-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|Q6IQ23-3|PKHA7_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	116-UNIMOD:4,119-UNIMOD:21,127-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q16514-2|TAF12_HUMAN	Isoform TAFII15 of Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	21-UNIMOD:21	0.17	38.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	82-UNIMOD:188,91-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	549-UNIMOD:188,552-UNIMOD:21,559-UNIMOD:188,568-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	286-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	14-UNIMOD:267,16-UNIMOD:21,27-UNIMOD:267	0.10	38.0	1	1	1
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	599-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P81408-2|F189B_HUMAN	Isoform B of Protein FAM189B OS=Homo sapiens OX=9606 GN=FAM189B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	397-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	207-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	320-UNIMOD:21,248-UNIMOD:21,253-UNIMOD:21	0.05	38.0	2	2	2
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	659-UNIMOD:21,674-UNIMOD:188,675-UNIMOD:188,657-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	883-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	249-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q96BY6|DOC10_HUMAN	Dedicator of cytokinesis protein 10 OS=Homo sapiens OX=9606 GN=DOCK10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	167-UNIMOD:21,171-UNIMOD:21,180-UNIMOD:21,185-UNIMOD:21,190-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	79-UNIMOD:267,80-UNIMOD:21,82-UNIMOD:21,92-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	41-UNIMOD:267	0.06	37.0	1	1	1
PRT	sp|Q5VZL5-3|ZMYM4_HUMAN	Isoform 3 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	908-UNIMOD:4,916-UNIMOD:21,940-UNIMOD:4	0.03	37.0	1	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	79-UNIMOD:188,80-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|Q71RC2-2|LARP4_HUMAN	Isoform 2 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	484-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	139-UNIMOD:21,146-UNIMOD:267,149-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	302-UNIMOD:188,315-UNIMOD:21,319-UNIMOD:188,321-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	728-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	112-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q9H0X4-2|F234A_HUMAN	Isoform 2 of Protein FAM234A OS=Homo sapiens OX=9606 GN=FAM234A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	833-UNIMOD:4,849-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8IUI4|S29P2_HUMAN	Putative protein SNX29P2 OS=Homo sapiens OX=9606 GN=SNX29P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	191-UNIMOD:21	0.11	37.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	133-UNIMOD:188,134-UNIMOD:21,138-UNIMOD:188,143-UNIMOD:188	0.06	37.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	211-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|Q8TDY2-2|RBCC1_HUMAN	Isoform 2 of RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	266-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P48436|SOX9_HUMAN	Transcription factor SOX-9 OS=Homo sapiens OX=9606 GN=SOX9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	181-UNIMOD:21,183-UNIMOD:188,205-UNIMOD:188	0.05	37.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	725-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:21,82-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	285-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	359-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	568-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	487-UNIMOD:28,503-UNIMOD:188,511-UNIMOD:21,513-UNIMOD:267	0.04	37.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	42-UNIMOD:21,57-UNIMOD:188,65-UNIMOD:188	0.11	37.0	1	1	1
PRT	sp|Q8TF01|PNISR_HUMAN	Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	209-UNIMOD:28,210-UNIMOD:267,211-UNIMOD:21,218-UNIMOD:188,228-UNIMOD:188	0.03	37.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	1	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11401	51.398	3	3088.156	3088.1560	R	A	10	40
PSM	ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGR	2	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	4-UNIMOD:267,17-UNIMOD:21,40-UNIMOD:267	ms_run[2]:scan=18824	86.117	3	3626.6501	3626.6501	R	R	74	114
PSM	REQGGSGLGSGSSGGGGSTSGLGSGYIGR	3	sp|Q2M2I8-2|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	12-UNIMOD:21	ms_run[2]:scan=13272	60.461	3	2621.1467	2621.1467	R	V	9	38
PSM	KGSSSSVCSVASSSDISLGSTKTER	4	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=12814	58.385	3	2596.1688	2596.1688	R	R	1382	1407
PSM	YGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	5	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	19-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=10849	48.949	3	3492.3992	3492.3992	R	I	828	862
PSM	GGVTGSPEASISGSKGDLKSSK	6	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	12-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=8279	37.646	2	2146.0653	2146.0653	K	A	5726	5748
PSM	SFGDKDLILPNGGTPAGTSSPASSSSLLNR	7	sp|Q5VWJ9|SNX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	20-UNIMOD:21	ms_run[2]:scan=23280	108	3	3025.4394	3025.4394	R	L	48	78
PSM	SLTLLPHGTPNSASPCSQR	8	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	14-UNIMOD:21,16-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=15477	70.535	2	2111.9699	2111.9699	R	H	188	207
PSM	HGGVCAPAAVATSPPGAIPK	9	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=13777	62.729193333333335	2	1937.917679	1936.923034	R	E	238	258
PSM	HGGVCAPAAVATSPPGAIPK	10	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=13679	62.320640000000004	2	1937.917679	1936.923034	R	E	238	258
PSM	GSGGSDKAGYSTDESSSSSLHATR	11	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	2-UNIMOD:21	ms_run[2]:scan=5325	24.472	3	2422.9874	2422.9874	R	T	400	424
PSM	HGGVCAPAAVATSPPGAIPK	12	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:4,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=13654	62.216	2	1942.9432	1942.9432	R	E	238	258
PSM	KTSDANETEDHLESLICK	13	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=19322	88.496	2	2168.9297	2168.9297	R	V	20	38
PSM	LKPGGVGAPSSSSPSPSPSAR	14	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	13-UNIMOD:21	ms_run[2]:scan=7119	32.446	2	2001.9521	2001.9521	K	P	1159	1180
PSM	RSELSQDAEPAGSQETKDSGSQEVLSELR	15	sp|Q9BVJ6-2|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21	ms_run[2]:scan=18003	82.366	3	3212.447	3212.4470	K	V	265	294
PSM	RSSPAAFINPPIGTVTPALK	16	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=23678	110.01	2	2116.1082	2116.1082	K	L	125	145
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	17	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21102	97.05123499999999	3	3448.4176	3448.4228	K	L	104	135
PSM	SPLELGEKLSPLPGGPGAGD	18	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	10-UNIMOD:21	ms_run[1]:scan=22760	105.32555333333335	2	1969.9391	1969.9393	K	P	162	182
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	19	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23491	109.02940500000001	3	3112.590565	3111.608898	R	A	655	686
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	20	sp|Q9UK58-6|CCNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=20504	94.252	3	2869.3413	2869.3413	K	E	317	345
PSM	GPPASSPAPAPKFSPVTPK	21	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13608	62.03	2	1923.9898	1923.9898	R	F	97	116
PSM	HGGVCAPAAVATSPPGAIPK	22	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:4,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=13907	63.274	2	1942.9432	1942.9432	R	E	238	258
PSM	RNALFPEVFSPTPDENSDQNSR	23	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:267,10-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=24410	113.79	3	2619.1506	2619.1506	R	S	566	588
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	24	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23278	107.994755	3	3112.591882	3111.608898	R	A	655	686
PSM	GAGAGHPGAGGAQPPDSPAGVR	25	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=5776	26.367638333333336	2	1973.879051	1972.878021	R	T	71	93
PSM	YSVLQQHAEANGVDGVDALDTASHTNK	26	sp|Q99523|SORT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	23-UNIMOD:21	ms_run[1]:scan=17737	81.130015	3	2920.286125	2919.303610	R	S	792	819
PSM	DHDDAAESLIEQTTALNK	27	sp|Q9NVK5-3|FGOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=21635	99.712	2	1969.9229	1969.9229	R	R	21	39
PSM	DHDDAAESLIEQTTALNK	28	sp|Q9NVK5-3|FGOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:188	ms_run[2]:scan=21625	99.672	2	1975.943	1975.9430	R	R	21	39
PSM	GAGAGHPGAGGAQPPDSPAGVR	29	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=6026	27.363	2	1972.878	1972.8780	R	T	71	93
PSM	HIISATSLSTSPTELGSR	30	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=16176	73.788	2	1935.9303	1935.9303	R	N	216	234
PSM	KAQAVSEEEEEEEGKSSSPK	31	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,6-UNIMOD:21,15-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4442	20.072	2	2275.0239	2275.0239	R	K	77	97
PSM	KTSDANETEDHLESLICK	32	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,3-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=19135	87.511	2	2180.97	2180.9700	R	V	20	38
PSM	SAKSEESLTSLHAVDGDSK	33	sp|A7KAX9-2|RHG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:188,4-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=11360	51.221	2	2051.9451	2051.9451	R	L	354	373
PSM	STAQQELDGKPASPTPVIVASHTANK	34	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	13-UNIMOD:21	ms_run[2]:scan=12489	56.819	3	2726.3276	2726.3276	R	E	818	844
PSM	GAGAGHPGAGGAQPPDSPAGVR	35	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=5795	26.44	2	1962.8698	1962.8698	R	T	71	93
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	36	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=11396	51.379	3	3098.1643	3098.1643	R	A	10	40
PSM	HGSGPNIILTGDSSPGFSK	37	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=17355	79.386	2	1955.9086	1955.9086	R	E	611	630
PSM	RNLLEDDSDEEEDFFLR	38	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=26985	128.63	2	2220.9212	2220.9212	R	G	23	40
PSM	SGGSGHAVAEPASPEQELDQNKGK	39	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=9003	40.721	2	2472.0918	2472.0918	K	G	296	320
PSM	SGGSGHAVAEPASPEQELDQNKGK	40	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21,22-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9138	41.31	3	2484.1321	2484.1321	K	G	296	320
PSM	TYGADLASVDFQHASEDAR	41	sp|P30740|ILEU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:267	ms_run[2]:scan=18393	84.053	2	2061.9267	2061.9267	K	K	111	130
PSM	SPLELGEKLSPLPGGPGAGD	42	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	10-UNIMOD:21	ms_run[1]:scan=22764	105.34286333333333	2	1969.9391	1969.9393	K	P	162	182
PSM	QHEAPSNRPLNELLTPQGPSPR	43	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19697	90.28973166666667	3	2520.2007	2520.2020	R	T	167	189
PSM	QHEAPSNRPLNELLTPQGPSPR	44	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19383	88.80122666666668	3	2520.2006	2520.2020	R	T	167	189
PSM	QRSPLLNQPVPELSHASLIANQSPFR	45	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=27399	131.20471166666667	3	2961.4839	2961.4857	R	A	351	377
PSM	AQLGINEDHSEGDEKSEK	46	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5238	24.114	2	2076.904	2076.9040	R	E	211	229
PSM	ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGR	47	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=18833	86.154	3	3606.6336	3606.6336	R	R	74	114
PSM	FASDDEHDEHDENGATGPVK	48	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=5858	26.672	2	2248.8546	2248.8546	K	R	364	384
PSM	GAGAGHPGAGGAQPPDSPAGVR	49	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=6042	27.442	2	1962.8698	1962.8698	R	T	71	93
PSM	HGGVCAPAAVATSPPGAIPK	50	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=13925	63.359	2	1936.923	1936.9230	R	E	238	258
PSM	HIISATSLSTSPTELGSR	51	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=16183	73.814	2	1945.9386	1945.9386	R	N	216	234
PSM	IVRGDQPAASGDSDDDEPPPLPR	52	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:267,13-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=12310	55.918	3	2503.1131	2503.1131	K	L	45	68
PSM	KDLGSTEDGDGTDDFLTDKEDEK	53	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=12604	57.381	3	2609.0542	2609.0542	R	A	179	202
PSM	KTSDANETEDHLESLICK	54	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=19125	87.473	2	2168.9297	2168.9297	R	V	20	38
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	55	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=8332	37.921	3	3046.23	3046.2300	K	D	234	260
PSM	LLQHPSICSDPTEEPTALTAGQSTSETQEGGKK	56	sp|P42684-4|ABL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=16194	73.864	3	3576.6291	3576.6291	R	A	853	886
PSM	TAKDSDDDDDVAVTVDRDR	57	sp|Q16623-3|STX1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=8792	39.894	2	2186.8965	2186.8965	R	F	10	29
PSM	THTDSSEKELEPEAAEEALENGPK	58	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=18387	84.022	3	2690.1596	2690.1596	K	E	340	364
PSM	TVTPASSAKTSPAKQQAPPVR	59	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21	ms_run[2]:scan=5173	23.835	2	2201.1205	2201.1205	K	N	512	533
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	60	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,15-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=20854	95.897	3	3664.6141	3664.6141	R	A	360	392
PSM	AQGEPVAGHESPKIPYEK	61	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10338	46.189	2	2027.9756	2027.9756	R	Q	522	540
PSM	DLIHDQDEDEEEEEGQR	62	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9301	41.988	2	2084.8407	2084.8407	R	F	77	94
PSM	DLIHDQDEDEEEEEGQR	63	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=9296	41.97	2	2094.8489	2094.8489	R	F	77	94
PSM	DTIVLLCKPEPELNAAIPSANPAK	64	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4	ms_run[2]:scan=23629	109.74	3	2560.3571	2560.3571	R	T	518	542
PSM	FLNKSPEEPSTPGTVVSSPSISTPPIVPDIQK	65	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:21	ms_run[2]:scan=23957	111.44	3	3427.7164	3427.7164	K	N	165	197
PSM	GSSSSSPEHSASSDSTKAPQTPR	66	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21	ms_run[2]:scan=3284	15.4	2	2366.9976	2366.9976	R	S	609	632
PSM	IIVDELKQEVISTSSK	67	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=20688	95.125	2	1800.0283	1800.0283	K	A	265	281
PSM	KLSPTEPKNYGSYSTQASAAAATAELLK	68	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=22754	105.3	3	2976.4481	2976.4481	R	K	48	76
PSM	KTEFLDLDNSPLSPPSPR	69	sp|Q8NCF5|NF2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=24157	112.49	2	2091.9878	2091.9878	K	T	189	207
PSM	SPLELGEKLSPLPGGPGAGDPR	70	sp|Q15742-2|NAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=21045	96.776	2	2223.0937	2223.0937	K	I	162	184
PSM	TGKVQSTADIFGDEEGDLFKEK	71	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:188,6-UNIMOD:21,20-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=23766	110.45	3	2511.1916	2511.1916	K	A	473	495
PSM	TPSIQPSLLPHAAPFAK	72	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=22779	105.43	2	1859.9642	1859.9642	R	S	1010	1027
PSM	VDKGVVPLAGTNGETTTQGLDGLSER	73	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18837	86.174	3	2613.3246	2613.3246	K	C	109	135
PSM	QRGSETGSETHESDLAPSDKEAPTPK	74	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=8453	38.385985	3	2816.2109	2816.2133	R	E	1103	1129
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	75	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=8122	36.958395	3	3007.3269	3007.3290	K	S	145	174
PSM	QHEAPSNRPLNELLTPQGPSPR	76	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=19583	89.72654333333334	3	2500.1849	2500.1855	R	T	167	189
PSM	CGGVEQASSSPRSDPLGSTQDHALSQESSEPGCR	77	sp|Q5VZL5|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21,12-UNIMOD:267,33-UNIMOD:4,34-UNIMOD:267	ms_run[1]:scan=15688	71.50429166666666	3	3655.4991	3655.5050	K	V	1232	1266
PSM	IEDVGSDEEDDSGKDKK	78	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	6-UNIMOD:21	ms_run[1]:scan=2439	11.691936666666667	2	1944.783705	1944.783742	K	K	172	189
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	79	sp|Q9NRA0-4|SPHK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=23973	111.53	3	2812.4161	2812.4161	K	V	421	449
PSM	ADHRSSPNVANQPPSPGGK	80	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3277	15.37	2	2074.8623	2074.8623	R	S	1152	1171
PSM	ALDLDSSCKEAADGYQR	81	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4	ms_run[2]:scan=11784	53.256	2	1897.8476	1897.8476	K	C	430	447
PSM	AQGEPVAGHESPKIPYEK	82	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10515	47.207	2	2027.9756	2027.9756	R	Q	522	540
PSM	AQHVGQSSSSTELAAYKEEANTIAK	83	sp|O14595|CTDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=16281	74.275	3	2699.244	2699.2440	R	S	47	72
PSM	AQLGINEDHSEGDEKSEK	84	sp|Q69YQ0-2|CYTSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=5240	24.119	2	2064.8637	2064.8637	R	E	211	229
PSM	ASPEAASTPRDPIDVDLPEEAERVK	85	sp|P29590-2|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=20201	92.814	3	2771.3015	2771.3015	K	A	402	427
PSM	DLDDALSCKPLADGNFK	86	sp|Q8IYB7|DI3L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4	ms_run[2]:scan=19910	91.328	2	1877.8829	1877.8829	R	V	389	406
PSM	DRPGSPESPLLDAPFSR	87	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=21673	99.912	2	1939.8944	1939.8944	R	A	906	923
PSM	IACRSPQPDPVGTPTIFKPQSK	88	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=16819	76.863	3	2583.1958	2583.1958	K	R	2219	2241
PSM	IEDVGSDEEDDSGKDKK	89	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=3060	14.585	2	1962.8441	1962.8441	K	K	250	267
PSM	IVRGDQPAASGDSDDDEPPPLPR	90	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=12077	54.701	3	2483.0966	2483.0966	K	L	45	68
PSM	KAQAVSEEEEEEEGKSSSPK	91	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:21	ms_run[2]:scan=3085	14.679	3	2256.9635	2256.9635	R	K	77	97
PSM	KFSAACNFSNILVNQER	92	sp|Q7L9B9|EEPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=21745	100.24	2	2076.9452	2076.9452	R	L	23	40
PSM	KGSITEYTAAEEKEDGR	93	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=8763	39.757	2	1962.8572	1962.8572	R	R	112	129
PSM	KLSPFVLSAGSGSPSATSILQK	94	sp|Q9UMZ2-4|SYNRG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=24676	115.16	3	2254.161	2254.1610	R	K	829	851
PSM	KLSSSSEPYEEDEFNDDQSIKK	95	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=12826	58.442	3	2654.1273	2654.1273	R	T	209	231
PSM	KVEEEDEEEEEEEEEEEEEEDE	96	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10589	47.605	3	2797.9945	2797.9945	K	-	179	201
PSM	KVEEEQEADEEDVSEEEAESK	97	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=8009	36.408	3	2516.9803	2516.9803	K	E	234	255
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	98	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12033	54.467	3	4245.5433	4245.5433	K	S	158	195
PSM	NKDSGSDTASAIIPSTTPSVDSDDESVVKDK	99	sp|Q6WKZ4-2|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	22-UNIMOD:21	ms_run[2]:scan=16578	75.711	3	3244.4508	3244.4508	K	K	33	64
PSM	NKPGPNIESGNEDDDASFK	100	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=10452	46.821	2	2112.8637	2112.8637	K	I	206	225
PSM	NKPGPNIESGNEDDDASFK	101	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10454	46.832	2	2124.904	2124.9040	K	I	206	225
PSM	RADLNQGIGEPQSPSR	102	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=7669	34.833	2	1803.8265	1803.8265	R	R	62	78
PSM	RNLLEDDSDEEEDFFLR	103	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,8-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=27026	128.89	2	2240.9378	2240.9378	R	G	23	40
PSM	SSGRNSPSAASTSSNDSKAETVK	104	sp|Q9P2R6|RERE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=1764	9.0699	3	2347.0289	2347.0289	R	K	608	631
PSM	TGRDLFSLDSEDPSPASPPLR	105	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:267,17-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=22836	105.74	2	2356.0851	2356.0851	R	S	221	242
PSM	TLHCEGTEINSDDEQESKEVEETATAK	106	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=14377	65.507	3	3141.3372	3141.3372	K	N	664	691
PSM	VDKGVVPLAGTDGETTTQGLDGLSER	107	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19450	89.13	3	2614.3086	2614.3086	K	C	109	135
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	108	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	23-UNIMOD:21	ms_run[2]:scan=8617	39.102	3	2664.2293	2664.2293	R	R	503	531
PSM	VSGGEDADKARASPSVTCK	109	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=3165	14.956	2	2013.8827	2013.8827	K	S	1273	1292
PSM	KLSPFVLSAGSGSPSATSILQK	110	sp|Q9UMZ2|SYNRG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:188,13-UNIMOD:21,22-UNIMOD:188	ms_run[1]:scan=24642	114.95997333333334	3	2267.202582	2266.201273	R	K	907	929
PSM	QHEAPSNRPLNELLTPQGPSPR	111	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=20054	92.02780833333334	3	2521.1962	2520.2022	R	T	167	189
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	112	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,21-UNIMOD:21	ms_run[1]:scan=21357	98.38593333333334	3	2668.1021	2668.1082	R	G	244	269
PSM	IEDVGSDEEDDSGKDKK	113	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:21	ms_run[1]:scan=2664	12.73064	2	1944.783705	1944.783742	K	K	172	189
PSM	ASEDTTSGSPPKKSSAGPK	114	sp|Q9BZZ5-1|API5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,12-UNIMOD:188,13-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=899	6.108	2	1928.9227	1928.9227	R	R	384	403
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	115	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=4806	22.036	3	2540.1908	2540.1908	R	E	7	32
PSM	DSQDASAEQSDHDDEVASLASASGGFGTKVPAPR	116	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=20712	95.228	3	3481.4907	3481.4907	R	L	489	523
PSM	FIHQQPQSSSPVYGSSAK	117	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=8172	37.156	2	2026.915	2026.9150	R	T	76	94
PSM	GNIQLSYSDGDDCGHGK	118	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9161	41.384	2	1827.7789	1827.7789	K	K	560	577
PSM	HEDEQALLDQNSQTPPPSPFSVQAFNK	119	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=23864	110.97	3	3103.3924	3103.3924	R	G	2670	2697
PSM	HLFSSTENLAAGSWK	120	sp|Q6WKZ4-2|RFIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=20928	96.247	2	1726.7716	1726.7716	K	E	205	220
PSM	HTGPNSPDTANDGFVR	121	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=8265	37.584	2	1773.7347	1773.7347	K	L	99	115
PSM	IEDVGSDEEDDSGKDKK	122	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=3692	16.835	2	1944.7837	1944.7837	K	K	250	267
PSM	KATDGVTLTGINQTGDQSLPSKPSSVSSYEK	123	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:21	ms_run[2]:scan=17784	81.348	3	3274.5606	3274.5606	K	T	319	350
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	124	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18410	84.128	3	2742.2819	2742.2819	K	K	761	786
PSM	LHSSNPNLSTLDFGEEKNYSDGSETSSEFSK	125	sp|Q9H4L5-5|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=20392	93.685	3	3485.4784	3485.4784	R	M	301	332
PSM	LLKEGEEPTVYSDEEEPKDESAR	126	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=11614	52.398	3	2729.1957	2729.1957	K	K	118	141
PSM	NGIGPGSHSEFAASIGSPK	127	sp|Q9H694-2|BICC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=14681	66.895	2	1891.8466	1891.8466	R	R	820	839
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	128	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14493	66.035	3	3116.2144	3116.2144	K	N	561	587
PSM	RADLNQGIGEPQSPSR	129	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,13-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7721	35.009	2	1823.843	1823.8430	R	R	62	78
PSM	RSASPDDDLGSSNWEAADLGNEER	130	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=18771	85.878	3	2670.0831	2670.0831	K	K	14	38
PSM	SGKNSQEDSEDSEDKDVK	131	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=1053	6.6573	2	2075.8168	2075.8168	R	T	50	68
PSM	SRSGSIVELIAGGGSSCSPVLSRK	132	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=22120	102.03	3	2563.1867	2563.1867	R	Q	415	439
PSM	TPADRGPSPAPAPAASPQPGSR	133	sp|Q8IX07|FOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=5542	25.441	3	2164.0062	2164.0062	R	G	894	916
PSM	TVIRLPSGSGAASPTGSAVDIR	134	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:267,13-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=18567	84.901	3	2211.1163	2211.1163	K	A	204	226
PSM	VAAAAGSGPSPPGSPGHDR	135	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4505	20.406	2	1776.782	1776.7820	R	E	38	57
PSM	VAAAAGSGPSPPGSPGHDR	136	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=4704	21.49	2	1766.7737	1766.7737	R	E	38	57
PSM	YKLDEDEDEDDADLSK	137	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10672	48.08	2	1910.8308	1910.8308	K	Y	167	183
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	138	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23827	110.79753000000001	3	3112.590565	3111.608898	R	A	655	686
PSM	CGGVEQASSSPRSDPLGSTQDHALSQESSEPGCR	139	sp|Q5VZL5|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=15678	71.45544333333333	3	3635.4787	3635.4885	K	V	1232	1266
PSM	AVVVSPKEENKAAEPPPPK	140	sp|O75909|CCNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:21	ms_run[1]:scan=7367	33.575473333333335	2	2067.044774	2066.044923	R	I	336	355
PSM	RNALFPEVFSPTPDENSDQNSR	141	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:21	ms_run[1]:scan=24300	113.24337166666666	2	2600.133719	2599.134025	R	S	566	588
PSM	AAITETQRKPSEDEVLNK	142	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=9044	40.882	2	2108.0151	2108.0151	K	G	977	995
PSM	AAPEASSPPASPLQHLLPGK	143	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22504	103.92	2	2053.0341	2053.0341	K	A	673	693
PSM	AQGEPVAGHESPKIPYEK	144	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=10330	46.137	2	2015.9354	2015.9354	R	Q	522	540
PSM	DHFLGPQESFPEENASSPFTQAR	145	sp|O14795|UN13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=21911	101.03	3	2670.1388	2670.1388	K	A	351	374
PSM	ESKEEETSIDVAGKPNEVTK	146	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=8723	39.566	2	2269.0363	2269.0363	K	A	460	480
PSM	GGQVSLTVHGTQQVHSPPEQSPVQANSSSSK	147	sp|P22670|RFX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21,31-UNIMOD:188	ms_run[2]:scan=11941	54.027	3	3243.5253	3243.5253	K	T	189	220
PSM	GNIQLSYSDGDDCGHGK	148	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4	ms_run[2]:scan=9141	41.316	2	1821.7588	1821.7588	K	K	560	577
PSM	GSKSPAKVSDGGSSSTDFK	149	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=3707	16.893	2	1920.8466	1920.8466	K	M	3536	3555
PSM	IIVDELKQEVISTSSK	150	sp|P63244|RACK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=20681	95.094	2	1787.988	1787.9880	K	A	265	281
PSM	KILNDLSSDAPGVPR	151	sp|P16220-3|CREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=16082	73.334	2	1660.8186	1660.8186	R	I	136	151
PSM	KLSPFVLSAGSGSPSATSILQK	152	sp|Q9UMZ2-4|SYNRG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,13-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=24844	116.05	3	2266.2013	2266.2013	R	K	829	851
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	153	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,7-UNIMOD:21,13-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=18153	83.063	3	2754.3222	2754.3222	K	K	761	786
PSM	KTEFLDLDNSPLSPPSPR	154	sp|Q8NCF5|NF2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=23964	111.48	2	2091.9878	2091.9878	K	T	189	207
PSM	RLQDSFASETNLDFR	155	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=20821	95.738	2	1877.8309	1877.8309	R	S	1935	1950
PSM	RNALFPEVFSPTPDENSDQNSR	156	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=24257	113.01	3	2599.134	2599.1340	R	S	566	588
PSM	SAKSEESLTSLHAVDGDSK	157	sp|A7KAX9-2|RHG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=11354	51.202	2	2039.9049	2039.9049	R	L	354	373
PSM	SASAKSIDSKVADAATEVQHK	158	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=15677	71.453	3	2302.0243	2302.0243	K	T	133	154
PSM	SFSTGSDLGHWVTTPPDIPGSR	159	sp|Q96AG3-3|S2546_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=24914	116.41	2	2393.0689	2393.0689	R	N	32	54
PSM	SGGSGHAVAEPASPEQELDQNKGK	160	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=8927	40.428	3	2472.0918	2472.0918	K	G	296	320
PSM	TAHNSEADLEESFNEHELEPSSPK	161	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=17971	82.216	3	2776.1501	2776.1501	K	S	100	124
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	162	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19553	89.592	3	2548.2977	2548.2977	K	T	508	533
PSM	TGRDLFSLDSEDPSPASPPLR	163	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=22786	105.47	2	2336.0686	2336.0686	R	S	221	242
PSM	TKEYVSNDAAQSDDEEKLQSQPTDTDGGR	164	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=9397	42.35	3	3263.3739	3263.3739	R	L	367	396
PSM	VKAQTPPGPSLSGSKSPCPQEK	165	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,5-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7856	35.673	3	2457.151	2457.1510	K	S	999	1021
PSM	VSIRLPSTSGSEGVPFR	166	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:267,7-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=21822	100.6	3	1887.9359	1887.9359	R	T	891	908
PSM	VSPSKSPSLSPSPPSPLEKTPLGER	167	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=18666	85.366	3	2733.3027	2733.3027	K	S	1251	1276
PSM	VTKNEEPSEEEIDAPKPK	168	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=7178	32.723	2	2118.9722	2118.9722	K	K	114	132
PSM	YGLQDSDEEEEEHPSKTSTK	169	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=6893	31.469	2	2387.9642	2387.9642	K	K	883	903
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	170	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=23057	106.87253	3	3096.565246	3095.580500	R	A	655	686
PSM	DLDDALSCKPLADGNFK	171	sp|Q8IYB7|DI3L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:4,9-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=19907	91.312065	2	1889.921323	1889.923187	R	V	389	406
PSM	QHEAPSNRPLNELLTPQGPSPR	172	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,8-UNIMOD:267,15-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=17610	80.50617333333332	3	2520.2014	2520.2020	R	T	167	189
PSM	AVVVSPKEENKAAEPPPPK	173	sp|O75909|CCNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:21,7-UNIMOD:188,11-UNIMOD:188,19-UNIMOD:188	ms_run[1]:scan=7472	34.07525666666667	2	2085.103984	2084.105310	R	I	336	355
PSM	RTATYNGPPASPSLSHEATPLSQTR	174	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=14874	67.76922166666667	3	2799.242664	2798.242604	R	S	573	598
PSM	AASSDQLRDNSPPPAFKPEPPK	175	sp|Q9UDY2-3|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13448	61.289	3	2508.1087	2508.1087	R	A	953	975
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	176	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=21600	99.555	3	3427.6114	3427.6114	R	E	1242	1275
PSM	AKTGGAYGEDLGADYNLSQVCDGK	177	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:4	ms_run[2]:scan=17726	81.085	3	2488.1176	2488.1176	R	V	2448	2472
PSM	AQGEPVAGHESPKIPYEK	178	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=10506	47.152	2	2015.9354	2015.9354	R	Q	522	540
PSM	DHFLGPQESFPEENASSPFTQAR	179	sp|O14795|UN13B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=21912	101.03	3	2680.147	2680.1470	K	A	351	374
PSM	EALGLGPPAAQLTPPPAPVGLR	180	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=25178	117.87	3	2201.161	2201.1610	R	G	451	473
PSM	FIHQQPQSSSPVYGSSAK	181	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=8132	37.004	2	2032.9351	2032.9351	R	T	76	94
PSM	GDVTAEEAAGASPAKANGQENGHVK	182	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=5680	25.977	2	2487.1027	2487.1027	R	S	11	36
PSM	GVESSDVHPAPTVQQMSSPKPAEER	183	sp|Q5T481|RBM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=11113	50.168	3	2742.232	2742.2320	K	A	1031	1056
PSM	HCAPSPDRSPELSSSR	184	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,8-UNIMOD:267,9-UNIMOD:21,13-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=4736	21.68	2	1961.7607	1961.7607	R	D	622	638
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	185	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=11414	51.441	4	3098.1643	3098.1643	R	A	10	40
PSM	HEDEQALLDQNSQTPPPSPFSVQAFNK	186	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=24059	111.98	3	3103.3924	3103.3924	R	G	2670	2697
PSM	HEDEQALLDQNSQTPPPSPFSVQAFNK	187	sp|O75592-2|MYCB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=23999	111.66	4	3103.3924	3103.3924	R	G	2670	2697
PSM	HGSGPNIILTGDSSPGFSK	188	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=17350	79.367	2	1949.8884	1949.8884	R	E	611	630
PSM	HGSPTAPICLGSPEFTDQGR	189	sp|Q6IQ23-3|PKHA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=18950	86.677	3	2215.9597	2215.9597	R	S	108	128
PSM	HLFSSTENLAAGSWK	190	sp|Q6WKZ4-2|RFIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=20927	96.243	2	1732.7917	1732.7917	K	E	205	220
PSM	IEDVGSDEEDDSGKDKK	191	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2272	11.006	2	1962.8441	1962.8441	K	K	250	267
PSM	IPGTPGAGGRLSPENNQVLTK	192	sp|Q16514-2|TAF12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=14198	64.553	2	2185.0892	2185.0892	K	K	10	31
PSM	IVADKDYSVTANSK	193	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=6186	28.093	2	1509.7675	1509.7675	K	I	78	92
PSM	KADSVANQGTKVEGITNQGK	194	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,4-UNIMOD:21,11-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=8326	37.89	3	2142.0816	2142.0816	K	K	549	569
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	195	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18166	83.117	3	2742.2819	2742.2819	K	K	761	786
PSM	KTSDANETEDHLESLICK	196	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,2-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=19329	88.535	2	2180.97	2180.9700	R	V	20	38
PSM	LGGPKETPPNGNLSPAPR	197	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=9100	41.153	2	1880.9146	1880.9146	K	L	991	1009
PSM	LHSSNPNLSTLDFGEEK	198	sp|Q9H4L5-5|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=18533	84.76	2	1972.8875	1972.8875	R	N	301	318
PSM	PSPSESPEPWKPFPAVSPEPR	199	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=22083	101.87	3	2397.1042	2397.1042	K	R	281	302
PSM	RASGQAFELILSPR	200	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,3-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=23499	109.07	2	1643.8299	1643.8299	K	S	14	28
PSM	RNALFPEVFSPTPDENSDQNSR	201	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=24063	111.99	3	2599.134	2599.1340	R	S	566	588
PSM	SAKSEESLTSLHAVDGDSK	202	sp|A7KAX9-2|RHG32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=11592	52.291	2	2039.9049	2039.9049	R	L	354	373
PSM	SASPDDDLGSSNWEAADLGNEERK	203	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=18563	84.883	3	2642.077	2642.0770	R	Q	15	39
PSM	SDAEEDGGTVSQEEEDRKPK	204	sp|P27824-2|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=4591	20.873	2	2284.9333	2284.9333	K	A	589	609
PSM	SHSDPGITTSSDTADFRDLYTK	205	sp|P81408-2|F189B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=18390	84.037	3	2493.0697	2493.0697	R	V	395	417
PSM	SIQEIQELDKDDESLR	206	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17363	79.421	2	1916.9327	1916.9327	K	K	34	50
PSM	SLTLLPHGTPNSASPCSQR	207	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=15468	70.491	2	2101.9616	2101.9616	R	H	188	207
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	208	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11913	53.88	3	2686.2501	2686.2501	R	R	207	233
PSM	SPVGKSPPSTGSTYGSSQKEESAASGGAAYTK	209	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=9675	43.416	3	3153.4139	3153.4139	K	R	315	347
PSM	SQSESSDEVTELDLSHGKK	210	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11298	50.96	2	2166.9721	2166.9721	R	D	657	676
PSM	TGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	211	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=16499	75.361	4	3734.7313	3734.7313	K	V	868	903
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	212	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=19512	89.406	3	2536.2574	2536.2574	K	T	508	533
PSM	THTDSSEKELEPEAAEEALENGPK	213	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,8-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=18402	84.091	3	2702.1999	2702.1999	K	E	340	364
PSM	TLHCEGTEINSDDEQESKEVEETATAK	214	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=14195	64.539	3	3129.2969	3129.2969	K	N	664	691
PSM	TYSAPAINAIQVPKPFSGPVR	215	sp|Q9H4L5-6|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=25317	118.67	2	2292.1668	2292.1668	R	L	249	270
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	216	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,23-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=8624	39.126	3	2684.2459	2684.2459	R	R	503	531
PSM	YGLQDSDEEEEEHPSKTSTK	217	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=6897	31.486	2	2400.0045	2400.0045	K	K	883	903
PSM	AAPEASSPPASPLQHLLPGK	218	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=22298	102.91110166666667	2	2054.035080	2053.034086	K	A	686	706
PSM	NRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	219	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:21,15-UNIMOD:21,27-UNIMOD:4	ms_run[1]:scan=9219	41.62472666666667	3	3970.524606	3970.532118	R	A	108	145
PSM	QHEAPSNRPLNELLTPQGPSPR	220	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=17611	80.50870666666667	3	2500.1838	2500.1855	R	T	167	189
PSM	QHEAPSNRPLNELLTPQGPSPR	221	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19792	90.76322333333333	3	2520.2007	2520.2020	R	T	167	189
PSM	IEDVGSDEEDDSGKDKK	222	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21	ms_run[1]:scan=2857	13.736915	2	1944.782920	1944.783742	K	K	172	189
PSM	DEDTTSHSSSKGGGGAGGTGVFKSGWLYK	223	sp|Q96BY6|DOC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,10-UNIMOD:21,19-UNIMOD:21,24-UNIMOD:21,29-UNIMOD:188	ms_run[1]:scan=25115	117.48806	3	3199.201616	3198.211833	K	G	162	191
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	224	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	13-UNIMOD:267,14-UNIMOD:21,16-UNIMOD:21,26-UNIMOD:188	ms_run[1]:scan=19332	88.548875	3	2943.290640	2941.275478	R	R	67	93
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	225	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23427	108.69078166666667	4	3112.591599	3111.608898	R	A	655	686
PSM	AVTEQGHELSNEER	226	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=3981	17.969	2	1607.7415	1607.7415	K	N	28	42
PSM	CGGVEQASSSPRSDPLGSTQDHALSQESSEPGCR	227	sp|Q5VZL5-3|ZMYM4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4,9-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=12821	58.423	3	3652.5155	3652.5155	K	V	908	942
PSM	DASDDLDDLNFFNQKK	228	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=24325	113.36	2	1895.894	1895.8940	K	K	65	81
PSM	DLIEDSSVQKDGLNQTTIPVSPPSTTKPSR	229	sp|Q71RC2-2|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:21	ms_run[2]:scan=19585	89.737	4	3289.6079	3289.6079	K	E	464	494
PSM	ERSPALKSPLQSVVVR	230	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=16298	74.34	2	1924.9537	1924.9537	R	R	246	262
PSM	FASDDEHDEHDENGATGPVK	231	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=5867	26.708	2	2254.8747	2254.8747	K	R	364	384
PSM	FIHQQPQSSSPVYGSSAK	232	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=6951	31.748	2	2026.915	2026.9150	R	T	76	94
PSM	GLLYDSDEEDEERPAR	233	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,13-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=13070	59.58	2	1992.8217	1992.8217	R	K	134	150
PSM	GSDASWKNDQEPPPEALDFSDDEKEK	234	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:188,20-UNIMOD:21,24-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=17295	79.138	3	3031.3106	3031.3106	K	E	296	322
PSM	GSKSPAKVSDGGSSSTDFK	235	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,4-UNIMOD:21,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=3828	17.35	2	1938.907	1938.9070	K	M	3536	3555
PSM	GTDTQTPAVLSPSKTQATLKPK	236	sp|P46087-2|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=12954	59.043	2	2348.1989	2348.1989	K	D	718	740
PSM	GVVDSDDLPLNVSR	237	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18096	82.782	2	1484.7471	1484.7471	K	E	435	449
PSM	IEDVGSDEEDDSGKDKK	238	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3119	14.804	2	1944.7837	1944.7837	K	K	250	267
PSM	IHAESLLLDSPAVAK	239	sp|Q9H4L5-5|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=18419	84.166	2	1648.8533	1648.8533	R	S	401	416
PSM	IHAESLLLDSPAVAK	240	sp|Q9H4L5-5|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=18391	84.04	2	1642.8331	1642.8331	R	S	401	416
PSM	IHIDPEIQDGSPTTSR	241	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=12646	57.589	2	1844.8306	1844.8306	R	R	102	118
PSM	IVADKDYSVTANSK	242	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=6185	28.091	2	1521.8077	1521.8077	K	I	78	92
PSM	IVRGDQPAASGDSDDDEPPPLPR	243	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,13-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=12097	54.793	3	2503.1131	2503.1131	K	L	45	68
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	244	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=17949	82.11	3	2742.2819	2742.2819	K	K	761	786
PSM	KQSLGELIGTLNAAK	245	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=24295	113.22	2	1621.844	1621.8440	R	V	19	34
PSM	KSQENLGNPSKNEDNVK	246	sp|Q9H0X4-2|F234A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21	ms_run[2]:scan=3258	15.298	2	1979.895	1979.8950	R	S	20	37
PSM	KVEEEQEADEEDVSEEEAESK	247	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,14-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=8026	36.482	3	2529.0206	2529.0206	K	E	234	255
PSM	LCDFGSASHVADNDITPYLVSR	248	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=22179	102.29	3	2516.1043	2516.1043	K	F	832	854
PSM	LDVKSIDDEDVDENEDDVYGNSSGRK	249	sp|Q8IUI4|S29P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=16219	73.988	3	2992.2459	2992.2459	K	H	187	213
PSM	LLKEGEEPTVYSDEEEPKDESAR	250	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=11816	53.41	3	2729.1957	2729.1957	K	K	118	141
PSM	LSMEDSKSPPPKATEEK	251	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:188,8-UNIMOD:21,12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5234	24.097	2	1970.9406	1970.9406	K	K	127	144
PSM	LVEPHSPSPSSKFSTK	252	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8547	38.797	2	1898.8619	1898.8619	R	G	571	587
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	253	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=14502	66.074	3	3106.2061	3106.2061	K	N	561	587
PSM	RWDQTADQTPGATPK	254	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7049	32.152	2	1750.7676	1750.7676	R	K	199	214
PSM	SGGSGHAVAEPASPEQELDQNKGK	255	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,22-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=9076	41.045	2	2484.1321	2484.1321	K	G	296	320
PSM	SLYYYIQQDTKGDYQK	256	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18861	86.276	2	2011.9527	2011.9527	K	A	314	330
PSM	SQSESSDEVTELDLSHGKK	257	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=11267	50.819	2	2154.9318	2154.9318	R	D	657	676
PSM	SVEHVSPDTADAESGKEIR	258	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=8825	40.022	3	2105.9267	2105.9267	K	E	261	280
PSM	SVKNGQAEAEEATEQTHISPNAIFK	259	sp|P48436|SOX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,3-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19682	90.222	3	2790.3264	2790.3264	K	A	181	206
PSM	TADSQETKESQKVELSESR	260	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=7255	33.073	2	2230.9955	2230.9955	K	L	725	744
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGKR	261	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=17469	79.887	3	3081.3482	3081.3482	R	L	67	94
PSM	TVKQEQINTEPLEDTVLSPTKK	262	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:21	ms_run[2]:scan=17377	79.48	3	2577.2939	2577.2939	K	R	268	290
PSM	VNQQPNTSDKKSSPQK	263	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=685	5.2626	2	1864.868	1864.8680	K	E	347	363
PSM	VSPSKSPSLSPSPPSPLEKTPLGER	264	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=18896	86.449	3	2733.3027	2733.3027	K	S	1251	1276
PSM	VSSPLSPLSPGIKSPTIPR	265	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=21305	98.138	2	2012.0707	2012.0707	K	A	555	574
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	266	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=23253	107.88023666666668	3	3096.565246	3095.580500	R	A	655	686
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	267	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=23850	110.90523333333333	3	3096.563923	3095.580500	R	A	655	686
PSM	AAPEASSPPASPLQHLLPGK	268	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21	ms_run[1]:scan=22522	104.00107333333332	2	2048.016162	2047.013957	K	A	686	706
PSM	QGPVSQSATQQPVTADKQQGHEPVSPR	269	sp|Q9BTA9|WAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,17-UNIMOD:188,25-UNIMOD:21,27-UNIMOD:267	ms_run[1]:scan=10528	47.275686666666665	3	2935.3769	2935.3791	K	S	487	514
PSM	GIPLATGDTSPEPELLPGAPLPPPKEVINGNIK	270	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21,25-UNIMOD:188,33-UNIMOD:188	ms_run[1]:scan=27502	131.88910166666665	3	3423.792749	3422.814098	K	T	33	66
PSM	QHEAPSNRPLNELLTPQGPSPR	271	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=19788	90.742335	3	2500.1848	2500.1855	R	T	167	189
PSM	QHEAPSNRPLNELLTPQGPSPR	272	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=19366	88.71820166666667	3	2500.1849	2500.1855	R	T	167	189
PSM	TPADRGPSPAPAPAASPQPGSR	273	sp|Q8IX07|FOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:267,16-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=5539	25.425776666666668	3	2184.022802	2184.022784	R	G	894	916
PSM	QRSPIALPVKQEPPQIDAVK	274	sp|Q8TF01|PNISR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,2-UNIMOD:267,3-UNIMOD:21,10-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=19773	90.67728000000001	3	2298.2394	2298.2410	R	R	209	229
PSM	TLHCEGTEINSDDEQESKEVEETATAK	275	sp|Q9BPX3|CND3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:188,27-UNIMOD:188	ms_run[1]:scan=14686	66.922675	3	3142.321448	3141.337187	K	N	664	691
PSM	FASDDEHDEHDENGATGPVK	276	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=6061	27.52920333333333	2	2255.855703	2254.874744	K	R	364	384
PSM	GDVTAEEAAGASPAKANGQENGHVK	277	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=5568	25.558004999999998	3	2488.086022	2487.102725	R	S	11	36