MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL13.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL13.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q6IQ22|RAB12_HUMAN	Ras-related protein Rab-12 OS=Homo sapiens OX=9606 GN=RAB12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	10-UNIMOD:267,21-UNIMOD:21,30-UNIMOD:267	0.09	54.0	2	1	0
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	1340-UNIMOD:21,1328-UNIMOD:188,1343-UNIMOD:188,1349-UNIMOD:188	0.02	51.0	5	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	1456-UNIMOD:21,1454-UNIMOD:267,1459-UNIMOD:267,1477-UNIMOD:188	0.01	49.0	3	1	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	283-UNIMOD:21,307-UNIMOD:188	0.08	49.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	49.0	1	1	1
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	277-UNIMOD:267,288-UNIMOD:21,303-UNIMOD:267	0.08	48.0	9	1	0
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	455-UNIMOD:21,452-UNIMOD:267,472-UNIMOD:267	0.04	48.0	5	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	null	496-UNIMOD:28,498-UNIMOD:21,500-UNIMOD:21	0.02	48.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	157-UNIMOD:188,189-UNIMOD:188,193-UNIMOD:188	0.14	47.0	4	2	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188	0.04	47.0	3	1	0
PRT	sp|P07948-2|LYN_HUMAN	Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	11-UNIMOD:21	0.06	46.0	1	1	1
PRT	sp|P07948|LYN_HUMAN	Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	13-UNIMOD:21	0.04	46.0	1	1	1
PRT	sp|O14757-2|CHK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	202-UNIMOD:21	0.08	46.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1027-UNIMOD:188,1029-UNIMOD:21,1040-UNIMOD:188,1044-UNIMOD:188	0.01	46.0	3	1	0
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	134-UNIMOD:21	0.03	46.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	649-UNIMOD:21	0.03	46.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	121-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	561-UNIMOD:188,563-UNIMOD:21,564-UNIMOD:188,578-UNIMOD:188	0.03	45.0	2	1	0
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	315-UNIMOD:21,484-UNIMOD:21	0.08	45.0	2	2	2
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	559-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	229-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|Q8IXM2|BAP18_HUMAN	Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	96-UNIMOD:21	0.12	45.0	1	1	0
PRT	sp|Q92610|ZN592_HUMAN	Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	691-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P17544-4|ATF7_HUMAN	Isoform 4 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	237-UNIMOD:21,245-UNIMOD:21	0.13	44.0	1	1	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	344-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q9Y679|AUP1_HUMAN	Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	277-UNIMOD:267,288-UNIMOD:21,303-UNIMOD:267	0.07	44.0	4	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	44.0	1	1	1
PRT	sp|Q13613-2|MTMR1_HUMAN	Isoform 1A of Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	43-UNIMOD:21,58-UNIMOD:4	0.05	43.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	908-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	254-UNIMOD:21	0.06	43.0	1	1	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	132-UNIMOD:21	0.11	43.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	39-UNIMOD:188	0.07	43.0	2	1	0
PRT	sp|P30989|NTR1_HUMAN	Neurotensin receptor type 1 OS=Homo sapiens OX=9606 GN=NTSR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	403-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|O15056-3|SYNJ2_HUMAN	Isoform 2A of Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1122-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	352-UNIMOD:188,360-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:188	0.04	43.0	2	1	0
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	179-UNIMOD:188,184-UNIMOD:21,190-UNIMOD:188,198-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2668-UNIMOD:21,2626-UNIMOD:21	0.02	43.0	3	2	1
PRT	sp|Q01167-2|FOXK2_HUMAN	Isoform 2 of Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	369-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|O75494-6|SRS10_HUMAN	Isoform 6 of Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	157-UNIMOD:21,163-UNIMOD:267,166-UNIMOD:4,180-UNIMOD:267	0.14	43.0	1	1	1
PRT	sp|O94762-4|RECQ5_HUMAN	Isoform 4 of ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	700-UNIMOD:21,703-UNIMOD:188,704-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	44-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	191-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	197-UNIMOD:267,214-UNIMOD:267	0.05	42.0	2	1	0
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	171-UNIMOD:21,162-UNIMOD:267,181-UNIMOD:267	0.09	42.0	2	1	0
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	153-UNIMOD:21	0.10	42.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	27-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|Q9NV56|MRGBP_HUMAN	MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	194-UNIMOD:21	0.10	42.0	1	1	1
PRT	sp|Q8NB49-2|AT11C_HUMAN	Isoform 2 of Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	435-UNIMOD:188,445-UNIMOD:21,456-UNIMOD:188,459-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|Q8WY36|BBX_HUMAN	HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	241-UNIMOD:28,243-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q9UKJ3|GPTC8_HUMAN	G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	1105-UNIMOD:188,1107-UNIMOD:21,1118-UNIMOD:188,1122-UNIMOD:188	0.01	42.0	1	1	0
PRT	sp|Q9HAU0-5|PKHA5_HUMAN	Isoform 5 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	799-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4	0.10	41.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	16-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q9BSJ6-2|PIMRE_HUMAN	Isoform 2 of Protein PIMREG OS=Homo sapiens OX=9606 GN=PIMREG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	131-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1257-UNIMOD:21,1358-UNIMOD:21	0.03	41.0	2	2	2
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	652-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	255-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q8IY33-3|MILK2_HUMAN	Isoform 3 of MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	298-UNIMOD:267,301-UNIMOD:21,318-UNIMOD:267	0.05	41.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	575-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	101-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|Q9UBF8|PI4KB_HUMAN	Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	275-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q3T8J9-3|GON4L_HUMAN	Isoform 3 of GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2091-UNIMOD:4,2105-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	215-UNIMOD:188,219-UNIMOD:21,228-UNIMOD:188,229-UNIMOD:188	0.05	41.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	869-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9UKC9-2|FBXL2_HUMAN	Isoform 2 of F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	336-UNIMOD:21,347-UNIMOD:267	0.06	41.0	1	1	1
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	32-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	494-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	583-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	521-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2706-UNIMOD:4,2708-UNIMOD:21,308-UNIMOD:21	0.01	40.0	2	2	2
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1547-UNIMOD:21,1556-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	120-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	5739-UNIMOD:21	0.00	40.0	1	1	1
PRT	sp|Q99081-4|HTF4_HUMAN	Isoform 4 of Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	323-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	567-UNIMOD:21,576-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P51003-2|PAPOA_HUMAN	Isoform 2 of Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	24-UNIMOD:21,32-UNIMOD:188,36-UNIMOD:4,41-UNIMOD:188	0.08	40.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	218-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	547-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.13	40.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1141-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1243-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	23-UNIMOD:21,19-UNIMOD:21	0.08	40.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	129-UNIMOD:21	0.17	40.0	1	1	1
PRT	sp|Q765P7|MTSS2_HUMAN	Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	539-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P10636-6|TAU_HUMAN	Isoform Tau-D of Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	346-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	208-UNIMOD:188,216-UNIMOD:188,220-UNIMOD:21,227-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	113-UNIMOD:188	0.05	40.0	2	1	0
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	730-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	62-UNIMOD:21,64-UNIMOD:188,65-UNIMOD:188,68-UNIMOD:188	0.14	40.0	1	1	0
PRT	sp|Q4KMQ1-2|TPRN_HUMAN	Isoform 2 of Taperin OS=Homo sapiens OX=9606 GN=TPRN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	109-UNIMOD:267,111-UNIMOD:21,131-UNIMOD:267	0.06	40.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	1426-UNIMOD:267,1428-UNIMOD:21,1442-UNIMOD:4,1448-UNIMOD:267	0.00	40.0	2	1	0
PRT	sp|P42684-4|ABL2_HUMAN	Isoform 4 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	597-UNIMOD:21,607-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	102-UNIMOD:21	0.12	39.0	1	1	1
PRT	sp|Q9NQX7-2|ITM2C_HUMAN	Isoform 2 of Integral membrane protein 2C OS=Homo sapiens OX=9606 GN=ITM2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	22-UNIMOD:21	0.12	39.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	623-UNIMOD:4,626-UNIMOD:21,630-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	83-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1143-UNIMOD:188,1148-UNIMOD:21,1157-UNIMOD:188,1161-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1701-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	91-UNIMOD:21	0.21	39.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	105-UNIMOD:21,109-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	64-UNIMOD:4,71-UNIMOD:21	0.11	39.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	161-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	334-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	152-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	805-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	50-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	909-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	206-UNIMOD:188,214-UNIMOD:21,218-UNIMOD:188,219-UNIMOD:188	0.08	39.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	538-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	342-UNIMOD:21,346-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:188,21-UNIMOD:188,22-UNIMOD:188	0.10	39.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	540-UNIMOD:385,540-UNIMOD:4,545-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1165-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9UKE5|TNIK_HUMAN	TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	764-UNIMOD:21,765-UNIMOD:188,778-UNIMOD:188	0.01	39.0	1	1	1
PRT	sp|O75976|CBPD_HUMAN	Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1368-UNIMOD:21,1370-UNIMOD:21	0.02	39.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RAGGGGGLGAGSPALSGGQGR	1	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	1-UNIMOD:267,12-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=7301	33.836	2	1838.8652	1838.8652	R	R	10	31
PSM	KLGAGEGGEASVSPEKTSTTSK	2	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	13-UNIMOD:21	ms_run[2]:scan=4975	23.623	2	2200.026	2200.0260	K	G	1328	1350
PSM	RNSVERPAEPVAGAATPSLVEQQK	3	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21	ms_run[2]:scan=12459	57.318	3	2613.2912	2613.2912	R	M	1454	1478
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	4	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=9787	44.794	2	2461.0966	2461.0966	R	S	283	308
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	5	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=8038	37.21187833333333	3	3007.3217	3007.3290	K	S	145	174
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	6	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23644	113.46	3	3031.5031	3031.5031	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	7	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	12-UNIMOD:21	ms_run[2]:scan=24220	116.74	3	3062.559	3062.5590	K	A	444	473
PSM	NLKTEEEEEEEEEEEEDDEEEEGDDEGQK	8	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=11213	51.166	3	3498.3085	3498.3085	R	S	266	295
PSM	QRSPSPAPAPAPAAAAGPPTRK	9	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:28,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=7352	34.074043333333336	3	2238.0290	2238.0343	R	K	496	518
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	10	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21770	103.64	3	3031.5031	3031.5031	R	V	276	304
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	11	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0		ms_run[1]:scan=14460	67.15026166666667	3	4346.612284	4344.611699	K	K	156	194
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	12	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23035	110.13892166666666	3	3112.589239	3111.608898	R	A	655	686
PSM	GKDSLSDDGVDLKTQPVPESQLLPGQR	13	sp|P07948-2|LYN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=20016	95.071	3	2958.4336	2958.4336	K	F	8	35
PSM	GKDSLSDDGVDLKTQPVR	14	sp|P07948|LYN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=12192	55.962	2	2008.9467	2008.9467	K	N	8	26
PSM	HIQSNLDFSPVNSASSEENVKYSSSQPEPR	15	sp|O14757-2|CHK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=17576	82.869	3	3412.5209	3412.5209	K	T	199	229
PSM	KPSVSEEVQATPNKAGPK	16	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,3-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6181	28.892	2	1964.0114	1964.0114	R	L	1027	1045
PSM	RASEEEENKASEEYIQR	17	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=7469	34.581	2	2146.9168	2146.9168	R	L	132	149
PSM	RNSVERPAEPVAGAATPSLVEQQK	18	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=12660	58.325	3	2613.2912	2613.2912	R	M	1454	1478
PSM	SPEKIEEVLSPEGSPSKSPSK	19	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:21	ms_run[2]:scan=13054	60.305	2	2291.0934	2291.0934	K	K	632	653
PSM	VTKNEEPSEEEIDAPKPK	20	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:21	ms_run[2]:scan=7126	33.029	2	2118.9722	2118.9722	K	K	114	132
PSM	KFSKEEPVSSGPEEAVGK	21	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,3-UNIMOD:21,4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9302	42.621	2	2001.9794	2001.9794	R	S	561	579
PSM	KPSVSEEVQATPNKAGPK	22	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=6194	28.939	2	1945.951	1945.9510	R	L	1027	1045
PSM	KVEEEGSPGDPDHEASTQGR	23	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21	ms_run[2]:scan=2799	12.92	2	2203.9019	2203.9019	R	T	309	329
PSM	SPRPTSAPAITQGQVAEGGVLDASAKK	24	sp|P11171-7|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21	ms_run[2]:scan=15183	70.699	3	2715.3593	2715.3593	R	T	555	582
PSM	TVFPGAVPVLPASPPPKDSLR	25	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	13-UNIMOD:21	ms_run[2]:scan=22362	106.62	2	2224.1657	2224.1657	K	S	217	238
PSM	VYEDSGIPLPAESPKKGPK	26	sp|Q8IXM2|BAP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	13-UNIMOD:21	ms_run[1]:scan=12573	57.88751833333333	2	2092.028232	2091.028938	K	K	84	103
PSM	HGLTSGSASPPPPALPLYPDPVR	27	sp|Q92610|ZN592_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=21916	104.36	2	2405.1781	2405.1781	K	L	683	706
PSM	KPSVSEEVQATPNKAGPK	28	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=6443	30.003	2	1945.951	1945.9510	R	L	1027	1045
PSM	KTQGYLESPKESSEPTGSPAPVIQHSSATAPSNGLSVR	29	sp|P17544-4|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=15672	73.128	4	4053.8722	4053.8722	K	S	230	268
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	30	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23232	111.18	3	3031.5031	3031.5031	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	31	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=24450	118.04	3	3062.559	3062.5590	K	A	444	473
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	32	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24277	117.07	3	3082.5756	3082.5756	K	A	444	473
PSM	RDSLGAYASQDANEQGQDLGKR	33	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=11815	53.976	3	2458.0874	2458.0874	K	D	342	364
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	34	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[1]:scan=22003	104.827795	3	3031.502226	3031.503138	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	35	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	13-UNIMOD:21	ms_run[1]:scan=23360	111.875685	3	3012.486889	3011.486600	R	V	276	304
PSM	QHEAPSNRPLNELLTPQGPSPR	36	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=18916	89.49954833333332	3	2520.2032	2520.2020	R	T	167	189
PSM	AAGGATAGSRQPSVETLDSPTGSHVEWCK	37	sp|Q13613-2|MTMR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=15272	71.147	3	3035.3444	3035.3444	R	Q	31	60
PSM	ALPTSKPEGSLHSSPVGPSSSK	38	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=8545	39.344	2	2229.0678	2229.0678	R	G	895	917
PSM	ARQEEGADASEEDPTPAGEEDVKDAR	39	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=8061	37.334	3	2851.1781	2851.1781	R	E	245	271
PSM	EILAGKPAAQKSPSDLLDASAVSATSR	40	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:21	ms_run[2]:scan=18241	86.227	3	2762.3852	2762.3852	R	Y	121	148
PSM	FSGWYDADLSPAGHEEAK	41	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:188	ms_run[2]:scan=18263	86.33	2	1984.8898	1984.8898	R	R	22	40
PSM	KADSVSSNHTLSSNATR	42	sp|P30989|NTR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=3129	14.175	2	1853.8269	1853.8269	R	E	398	415
PSM	KSASDASISSGTHGQYSILQTAR	43	sp|O15056-3|SYNJ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:21	ms_run[2]:scan=13783	63.804	2	2444.1333	2444.1333	K	L	1121	1144
PSM	KSEAGHASSPDSEVTSLCQK	44	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,9-UNIMOD:21,18-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=8967	41.105	2	2208.9761	2208.9761	K	E	352	372
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	45	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21061	100.1	3	3031.5031	3031.5031	R	V	276	304
PSM	NKPLEQSVEDLSKGPPSSVPK	46	sp|O95466|FMNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,7-UNIMOD:21,13-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=15134	70.489	2	2333.2014	2333.2014	K	S	178	199
PSM	NRPDYVSEEEEDDEDFETAVKK	47	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21	ms_run[2]:scan=16838	79.126	3	2723.1123	2723.1123	K	L	2662	2684
PSM	SAPASPNHAGVLSAHSSGAQTPESLSR	48	sp|Q01167-2|FOXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=11375	51.835	3	2695.2351	2695.2351	R	E	369	396
PSM	SHSDNDRPNCSWNTQYSSAYYTSR	49	sp|O75494-6|SRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,7-UNIMOD:267,10-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=14252	66.103	3	2995.1732	2995.1732	R	K	157	181
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	50	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,34-UNIMOD:188,38-UNIMOD:188	ms_run[2]:scan=14499	67.349	3	4362.6721	4362.6721	K	K	156	194
PSM	FSGWYDADLSPAGHEEAK	51	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18285	86.425	2	1978.8697	1978.8697	R	R	22	40
PSM	GEVPGGSAHYGGPSPEKK	52	sp|O94762-4|RECQ5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5863	27.515	2	1844.8497	1844.8497	R	A	687	705
PSM	KGLPLGSAVSSPVLFSPVGR	53	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=24824	120.25	2	2047.0867	2047.0867	R	R	35	55
PSM	LQALAEEPSQPHTRSPAK	54	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=7787	36.076	2	2038.9837	2038.9837	K	N	177	195
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	55	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=23547	112.9	3	3011.4866	3011.4866	R	V	276	304
PSM	NKPLEQSVEDLSKGPPSSVPK	56	sp|O95466|FMNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=15058	70.069	2	2315.141	2315.1410	K	S	178	199
PSM	RAEDGSVIDYELIDQDAR	57	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=19031	90.058	2	2083.9925	2083.9925	R	D	197	215
PSM	RTPAPPEPGSPAPGEGPSGR	58	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=7308	33.865	2	1992.9055	1992.9055	R	K	162	182
PSM	SKSYNTPLLNPVQEHEAEGAAAGGTSIR	59	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=18005	85.047	3	2976.3978	2976.3978	R	R	151	179
PSM	TKEVYELLDSPGKVLLQSK	60	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=24769	119.91	2	2226.1549	2226.1549	K	D	18	37
PSM	VTDKVLTANSNPSSPSAAKR	61	sp|Q9NV56|MRGBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=6422	29.916	2	2122.042	2122.0420	R	R	182	202
PSM	YKGVTQEVDGLSQTDGTLTYFDKVDK	62	sp|Q8NB49-2|AT11C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:188,12-UNIMOD:21,23-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=23368	111.93	3	3004.4453	3004.4453	K	N	434	460
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	63	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23075	110.34539833333334	4	3112.591790	3111.608898	R	A	655	686
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	64	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[1]:scan=22747	108.63253833333333	3	3033.5402	3031.5022	R	V	276	304
PSM	QKSPLFQFAEISSSTSHSDASTK	65	sp|Q8WY36|BBX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=23457	112.42939666666666	3	2545.1358	2545.1369	R	Q	241	264
PSM	KPSVSEEVQATPNKAGPK	66	sp|Q9UKJ3|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:188,3-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=6448	30.022473333333334	2	1965.007740	1964.011409	R	L	1105	1123
PSM	AKSPTPESSTIASYVTLRK	67	sp|Q9HAU0-5|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=17443	82.19	3	2115.0613	2115.0613	R	T	797	816
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	68	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=14976	69.655	3	3213.342	3213.3420	K	F	173	200
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	69	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=4747	22.561	3	2540.1908	2540.1908	R	E	7	32
PSM	GAQKGSGSPTHSLSQK	70	sp|Q9BSJ6-2|PIMRE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=1529	8.1136	2	1648.757	1648.7570	R	S	124	140
PSM	GEVPGGSAHYGGPSPEKK	71	sp|O94762-4|RECQ5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=5838	27.412	2	1832.8094	1832.8094	R	A	687	705
PSM	GHTASESDEQQWPEEKR	72	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=6545	30.423	2	2092.8487	2092.8487	R	L	1253	1270
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	73	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=22185	105.75	3	3095.5805	3095.5805	R	A	642	673
PSM	IEDVGSDEEDDSGKDKK	74	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=2663	12.385	2	1944.7837	1944.7837	K	K	250	267
PSM	KFSKEEPVSSGPEEAVGK	75	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=9096	41.729	2	1983.9191	1983.9191	R	S	561	579
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	76	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=24503	118.36	3	2896.3631	2896.3631	K	A	2621	2646
PSM	KLGAGEGGEASVSPEKTSTTSK	77	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=6319	29.449	3	2200.026	2200.0260	K	G	1328	1350
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	78	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=21080	100.19	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	79	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=21567	102.58	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	80	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=22018	104.89	3	3011.4866	3011.4866	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	81	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=24046	115.73	3	3062.559	3062.5590	K	A	444	473
PSM	PGRPLSPANVPALPGETVTSPVR	82	sp|Q8IY33-3|MILK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:267,6-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=20792	98.774	3	2411.2477	2411.2477	K	L	296	319
PSM	RNALFPEVFSPTPDENSDQNSR	83	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=23566	113.02	3	2599.134	2599.1340	R	S	566	588
PSM	RVSVCAETYNPDEEEEDTDPR	84	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4	ms_run[2]:scan=11493	52.361	3	2510.0503	2510.0503	R	V	97	118
PSM	SKSDATASISLSSNLKR	85	sp|Q9UBF8|PI4KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=11474	52.261	2	1843.9041	1843.9041	R	T	275	292
PSM	TCPVHESPSGIDTSETSPKAPR	86	sp|Q3T8J9-3|GON4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=8731	40.071	3	2432.0679	2432.0679	R	G	2090	2112
PSM	TQDPAKAPNTPDILEIEFKK	87	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:188,10-UNIMOD:21,19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=20431	97.053	3	2352.2112	2352.2112	K	G	210	230
PSM	VASEAPLEHKPQVEASSPR	88	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=7879	36.468	2	2111.0048	2111.0048	K	L	853	872
PSM	VHAYFAPVTPPTAVAGSGQR	89	sp|Q9UKC9-2|FBXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=17939	84.714	3	2115.0178	2115.0178	K	L	328	348
PSM	WKEPGSGGPQNLSGPGGR	90	sp|Q9H0W8-2|SMG9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=10571	48.351	2	1859.8316	1859.8316	R	E	20	38
PSM	RNSVERPAEPVAGAATPSLVEQQK	91	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,3-UNIMOD:21,6-UNIMOD:267,24-UNIMOD:188	ms_run[1]:scan=13313	61.546735	3	2639.311175	2639.327862	R	M	1454	1478
PSM	AKAGLESGAEPGDGDSDTTKK	92	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=3256	14.71	2	2112.9212	2112.9212	K	K	479	500
PSM	AQESGQGSTAGPLRPPPPGAGGPATPSK	93	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:21	ms_run[2]:scan=9554	43.773	3	2649.2548	2649.2548	K	A	559	587
PSM	AQNEFKDEAQSLSHSPK	94	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=10267	46.847	2	1994.8735	1994.8735	R	R	507	524
PSM	ATKIPCESPPLEVVDTTASTKR	95	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=16252	76.049	3	2479.203	2479.2030	K	H	2701	2723
PSM	FHALSSPQSPFPSTPTSR	96	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=15807	73.844	2	2032.9283	2032.9283	K	R	1539	1557
PSM	GITINAAHVEYSTAAR	97	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=13636	63.065	2	1682.8616	1682.8616	R	H	105	121
PSM	GKGGVTGSPEASISGSKGDLK	98	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=8333	38.439	2	2010.9623	2010.9623	K	S	5724	5745
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	99	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=22292	106.27	3	3095.5805	3095.5805	R	A	642	673
PSM	GRTSSTNEDEDLNPEQKIER	100	sp|Q99081-4|HTF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=10181	46.479	2	2397.0445	2397.0445	R	E	319	339
PSM	HGGPGPGGPEPELSPITEGSEAR	101	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=14891	69.243	3	2317.0251	2317.0251	R	A	554	577
PSM	HGGPGPGGPEPELSPITEGSEAR	102	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=14921	69.385	3	2317.0251	2317.0251	R	A	554	577
PSM	HGGPGPGGPEPELSPITEGSEAR	103	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=14910	69.328	3	2307.0169	2307.0169	R	A	554	577
PSM	HIKEEPLSEEEPCTSTAIASPEK	104	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=13064	60.35	2	2741.1544	2741.1544	K	K	495	518
PSM	HYGITSPISLAAPKETDCVLTQK	105	sp|P51003-2|PAPOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=20994	99.752	3	2620.3011	2620.3011	K	L	19	42
PSM	IYHLPDAESDEDEDFKEQTR	106	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=15686	73.197	2	2516.0381	2516.0381	K	L	210	230
PSM	IYHLPDAESDEDEDFKEQTR	107	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=15900	74.259	2	2516.0381	2516.0381	K	L	210	230
PSM	KASPEPPDSAEGALKLGEEQQR	108	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=14032	65.04	3	2416.1271	2416.1271	R	Q	545	567
PSM	KLGAGEGGEASVSPEKTSTTSK	109	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,13-UNIMOD:21,16-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=29791	152.65	3	2218.0864	2218.0864	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	110	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,13-UNIMOD:21,16-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=31373	162.53	3	2218.0864	2218.0864	K	G	1328	1350
PSM	KNEPEDEEEEEEEEDEDEEEEDEDEE	111	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=9963	45.568	3	3255.1026	3255.1026	K	-	184	210
PSM	KSEAGHASSPDSEVTSLCQK	112	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8982	41.164	2	2196.9358	2196.9358	K	E	352	372
PSM	KTLLSESSSQSSKSPSLSSK	113	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=8188	37.862	2	2147.0359	2147.0359	K	Q	1128	1148
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	114	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:21	ms_run[2]:scan=14207	65.911	3	3053.4455	3053.4455	R	A	460	493
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	115	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	24-UNIMOD:21	ms_run[2]:scan=11377	51.839	3	2868.339	2868.3390	R	S	1220	1248
PSM	LGAGGGSPEKSPSAQELKEQGNR	116	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=7254	33.632	2	2376.1071	2376.1071	R	L	13	36
PSM	LLKEGEEPTVYSDEEEPKDESAR	117	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=11306	51.555	3	2729.1957	2729.1957	K	K	118	141
PSM	NRPDYVSEEEEDDEDFETAVKK	118	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=17078	80.336	3	2723.1123	2723.1123	K	L	2662	2684
PSM	RPASTAGLPTAGLPTATGLPSGAPPGVATIR	119	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=23767	114.17	3	2934.5328	2934.5328	K	R	535	566
PSM	RTPAPPEPGSPAPGEGPSGR	120	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,10-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=7306	33.855	2	2012.922	2012.9220	R	K	162	182
PSM	SGGSGHAVAEPASPEQELDQNKGK	121	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=9074	41.643	3	2472.0918	2472.0918	K	G	296	320
PSM	TDHGAEIVYKSPVVSGDTSPR	122	sp|P10636-6|TAU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:21	ms_run[2]:scan=12259	56.35	3	2294.058	2294.0580	K	H	328	349
PSM	TGNSEKETALPSTKAEFTSPPSLFK	123	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:188,14-UNIMOD:188,18-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=21289	101.23	3	2764.3706	2764.3706	R	T	203	228
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	124	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=18884	89.36	3	2548.2977	2548.2977	K	T	508	533
PSM	VAPEEHPVLLTEAPLNPK	125	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=17513	82.553	2	1959.0773	1959.0773	R	A	96	114
PSM	VQAYEEPSVASSPNGKESDLRR	126	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=10240	46.739	2	2498.1439	2498.1439	R	S	719	741
PSM	VYEDSGIPLPAESPKKGPK	127	sp|Q8IXM2-2|BAP18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=12705	58.595	2	2109.0893	2109.0893	K	K	50	69
PSM	WQRPSSPPPFLPAASEEAEPAEGLR	128	sp|Q4KMQ1-2|TPRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:267,5-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=23112	110.54	3	2818.323	2818.3230	R	V	107	132
PSM	RVSTDLPEGQDVYTAACNSVIHR	129	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,17-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=20246	96.13028166666666	3	2689.232557	2687.227768	R	C	1426	1449
PSM	AQQRAESPESSAIESTQSTPQKGR	130	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=6818	31.567	3	2652.2141	2652.2141	R	G	1352	1376
PSM	DKSPSSLLEDAKETCFTR	131	sp|P42684-4|ABL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=19494	92.445	2	2162.9555	2162.9555	R	D	593	611
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	132	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=20093	95.436	3	3393.3457	3393.3457	K	F	86	114
PSM	GDKADKASASAPAPASATEILLTPAR	133	sp|Q9NQX7-2|ITM2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=18760	88.792	3	2588.2847	2588.2847	K	L	15	41
PSM	HCAPSPDRSPELSSSR	134	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=4675	22.207	2	1941.7442	1941.7442	R	D	622	638
PSM	IDASKNEEDEGHSNSSPR	135	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=1216	7.0676	2	2050.8229	2050.8229	K	H	68	86
PSM	KAGLASPEEEDAVGKEPLK	136	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,6-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=11762	53.689	3	2065.0479	2065.0479	K	A	1143	1162
PSM	KEESDEEETASKAER	137	sp|Q9BY89|K1671_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=2157	10.429	2	1816.7364	1816.7364	R	T	1698	1713
PSM	KLEKEEEEGISQESSEEEQ	138	sp|P17096-2|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=6168	28.842	2	2315.953	2315.9530	K	-	78	97
PSM	KLGAGEGGEASVSPEKTSTTSK	139	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=7336	33.994	3	2200.026	2200.0260	K	G	1328	1350
PSM	KLSVPTSDEEDEVPAPKPR	140	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12949	59.802	2	2252.9967	2252.9967	K	G	103	122
PSM	KSSGEIVYCGQVFEKSPLR	141	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=16563	77.645	2	2263.0708	2263.0708	K	V	56	75
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	142	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12004	54.871	3	4245.5433	4245.5433	K	S	158	195
PSM	LGAGGGSPEKSPSAQELKEQGNR	143	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=7882	36.483	2	2376.1071	2376.1071	R	L	13	36
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	144	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=21317	101.38	3	3011.4866	3011.4866	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	145	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24101	116.06	3	3082.5756	3082.5756	K	A	444	473
PSM	RAEDGSVIDYELIDQDAR	146	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19056	90.184	2	2063.976	2063.9760	R	D	197	215
PSM	RAGGGGGLGAGSPALSGGQGR	147	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=7007	32.469	2	1818.8486	1818.8486	R	R	10	31
PSM	REEDEPEERSGDETPGSEVPGDK	148	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=6561	30.477	2	2623.0559	2623.0559	K	A	152	175
PSM	RIPSIVSSPLNSPLDR	149	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=21556	102.53	2	1829.9401	1829.9401	K	S	327	343
PSM	RNDDISELEDLSELEDLKDAK	150	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=25024	121.43	3	2526.1374	2526.1374	R	L	141	162
PSM	RVSTDLPEGQDVYTAACNSVIHR	151	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=20206	95.956	3	2667.2112	2667.2112	R	C	1426	1449
PSM	SAPTAPTPPPPPPPATPR	152	sp|Q14202-2|ZMYM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=10471	47.881	2	1827.892	1827.8921	R	K	799	817
PSM	SQRYSGAYGASVSDEELKR	153	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=11284	51.465	2	2181.9692	2181.9692	K	R	46	65
PSM	SRGVSQEKEAQISSAIVSSVQSK	154	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=17976	84.911	3	2484.2221	2484.2221	R	I	905	928
PSM	TPSPKEEDEEPESPPEKK	155	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:188,13-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3200	14.435	2	2149.9802	2149.9802	K	T	202	220
PSM	VAPEEHPVLLTEAPLNPK	156	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17323	81.538	2	1953.0571	1953.0571	R	A	96	114
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	157	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14251	66.101	3	4344.6117	4344.6117	K	K	156	194
PSM	VRQLSGQSTSSDTTYKGGASEK	158	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=4580	21.671	3	2366.0751	2366.0751	R	A	534	556
PSM	WPFSGKTSPPCSPANLSR	159	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=19519	92.587	2	2067.9238	2067.9238	R	H	336	354
PSM	SETAPAAPAAPAPAEKTPVKK	160	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,16-UNIMOD:188,20-UNIMOD:188,21-UNIMOD:188	ms_run[1]:scan=8088	37.438315	2	2091.1622	2091.1705	M	K	2	23
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	161	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22836	109.0938	3	3112.589239	3111.608898	R	A	655	686
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	162	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[1]:scan=23031	110.122325	3	3033.5402	3031.5022	R	V	276	304
PSM	CHAEHTPEEEIDHTGAK	163	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=6572	30.510906666666664	2	2022.7709	2022.7774	K	T	540	557
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	164	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	14-UNIMOD:21	ms_run[1]:scan=19761	93.81430666666667	3	2772.222904	2771.217480	R	N	1152	1176
PSM	ANSKSEGSPVLPHEPAK	165	sp|Q9UKE5|TNIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21,4-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=6996	32.42725	2	1838.880100	1838.896652	R	V	762	779
PSM	SLLSHEFQDETDTEEETLYSSKH	166	sp|O75976|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=19704	93.454885	3	2885.131330	2884.136527	K	-	1358	1381