MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL15.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL15.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	417-UNIMOD:21	0.06	48.0	1	1	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	162-UNIMOD:267,171-UNIMOD:21,181-UNIMOD:267	0.09	48.0	2	1	0
PRT	sp|Q8IZD4-2|DCP1B_HUMAN	Isoform 2 of mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	45-UNIMOD:21	0.05	47.0	1	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	537-UNIMOD:21	0.04	46.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	62-UNIMOD:21	0.14	46.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	596-UNIMOD:21	0.03	45.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	207-UNIMOD:21,211-UNIMOD:188,217-UNIMOD:188	0.04	45.0	2	1	0
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	277-UNIMOD:267,288-UNIMOD:21,303-UNIMOD:267	0.08	45.0	7	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	164-UNIMOD:21,162-UNIMOD:267,163-UNIMOD:21,179-UNIMOD:267	0.03	44.0	4	1	0
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	261-UNIMOD:267,263-UNIMOD:21,270-UNIMOD:4,275-UNIMOD:267	0.04	44.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2202-UNIMOD:4,2204-UNIMOD:21,2186-UNIMOD:188,2193-UNIMOD:188,2206-UNIMOD:188	0.01	44.0	4	1	0
PRT	sp|P48553|TPC10_HUMAN	Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	708-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1482-UNIMOD:4,1489-UNIMOD:21,558-UNIMOD:21,547-UNIMOD:188,551-UNIMOD:188,556-UNIMOD:21,561-UNIMOD:188	0.02	44.0	3	2	1
PRT	sp|Q9UGN5-2|PARP2_HUMAN	Isoform 2 of Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	34-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	505-UNIMOD:21,1301-UNIMOD:21	0.03	44.0	2	2	2
PRT	sp|Q8N6T3-4|ARFG1_HUMAN	Isoform 4 of ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	235-UNIMOD:21,238-UNIMOD:4	0.07	44.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	336-UNIMOD:267,356-UNIMOD:267	0.01	43.0	2	1	0
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	404-UNIMOD:21,406-UNIMOD:21,407-UNIMOD:21	0.03	43.0	2	2	2
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	4538-UNIMOD:21	0.00	43.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	84-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q9NYZ3|GTSE1_HUMAN	G2 and S phase-expressed protein 1 OS=Homo sapiens OX=9606 GN=GTSE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	575-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	301-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1015-UNIMOD:21	0.02	43.0	2	1	0
PRT	sp|P16333|NCK1_HUMAN	Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	85-UNIMOD:21	0.06	43.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.02	43.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	304-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	280-UNIMOD:188,281-UNIMOD:188,286-UNIMOD:21,300-UNIMOD:188,285-UNIMOD:21	0.03	43.0	3	1	0
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	266-UNIMOD:21,288-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|Q0JRZ9|FCHO2_HUMAN	F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	488-UNIMOD:21	0.04	43.0	3	1	0
PRT	sp|O60238-2|BNI3L_HUMAN	Isoform 2 of BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	80-UNIMOD:21	0.13	42.0	1	1	1
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	429-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	930-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	502-UNIMOD:21,507-UNIMOD:4,497-UNIMOD:188,517-UNIMOD:188	0.05	42.0	5	1	0
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1612-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	925-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	433-UNIMOD:21,429-UNIMOD:267,445-UNIMOD:267	0.03	42.0	2	1	0
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	601-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q5SYE7-2|NHSL1_HUMAN	Isoform 2 of NHS-like protein 1 OS=Homo sapiens OX=9606 GN=NHSL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1467-UNIMOD:4,1468-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9Y679|AUP1_HUMAN	Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	277-UNIMOD:267,288-UNIMOD:21,303-UNIMOD:267	0.07	42.0	1	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188,681-UNIMOD:21	0.04	42.0	3	1	0
PRT	sp|Q9HAU0-5|PKHA5_HUMAN	Isoform 5 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	799-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	287-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|P33981-2|TTK_HUMAN	Isoform 2 of Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	435-UNIMOD:21,433-UNIMOD:188,442-UNIMOD:188	0.03	41.0	2	1	0
PRT	sp|Q08174|PCDH1_HUMAN	Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	962-UNIMOD:21,967-UNIMOD:267	0.02	41.0	13	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1247-UNIMOD:21	0.02	41.0	4	1	0
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	218-UNIMOD:21	0.06	41.0	2	1	0
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	452-UNIMOD:267,455-UNIMOD:21,472-UNIMOD:267,462-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	522-UNIMOD:21,510-UNIMOD:188,525-UNIMOD:188,526-UNIMOD:188	0.04	41.0	2	1	0
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1121-UNIMOD:21,1132-UNIMOD:188,1123-UNIMOD:21	0.02	41.0	3	1	0
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	37-UNIMOD:21,59-UNIMOD:267,143-UNIMOD:21,147-UNIMOD:21	0.16	41.0	4	2	1
PRT	sp|Q9BW04-2|SARG_HUMAN	Isoform 2 of Specifically androgen-regulated gene protein OS=Homo sapiens OX=9606 GN=SARG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	261-UNIMOD:21,262-UNIMOD:21	0.06	41.0	2	1	0
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	485-UNIMOD:188,487-UNIMOD:21,503-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|Q8IZD4|DCP1B_HUMAN	mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	147-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	227-UNIMOD:21,210-UNIMOD:188,215-UNIMOD:188,229-UNIMOD:188	0.01	41.0	3	1	0
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	136-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9P2D0-2|IBTK_HUMAN	Isoform 2 of Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1045-UNIMOD:21,1056-UNIMOD:188,1060-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	83-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	1267-UNIMOD:21,1254-UNIMOD:188,1257-UNIMOD:188,1275-UNIMOD:188,1269-UNIMOD:21	0.02	40.0	4	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	510-UNIMOD:188,514-UNIMOD:188,520-UNIMOD:21,533-UNIMOD:188,569-UNIMOD:21,570-UNIMOD:21,519-UNIMOD:21	0.08	40.0	4	3	2
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	395-UNIMOD:21,402-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	122-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q13415|ORC1_HUMAN	Origin recognition complex subunit 1 OS=Homo sapiens OX=9606 GN=ORC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	199-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1053-UNIMOD:21,1068-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	123-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1000-UNIMOD:188,1008-UNIMOD:21,1013-UNIMOD:188,1016-UNIMOD:4,1020-UNIMOD:188	0.01	40.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1047-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	202-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|O75362|ZN217_HUMAN	Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	793-UNIMOD:188,795-UNIMOD:21,801-UNIMOD:188,819-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	383-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P53367-2|ARFP1_HUMAN	Isoform A of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	39-UNIMOD:21	0.07	39.0	2	1	0
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	202-UNIMOD:21,208-UNIMOD:267	0.06	39.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	228-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	184-UNIMOD:188,185-UNIMOD:188	0.15	39.0	12	1	0
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	39.0	2	1	0
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2779-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	49-UNIMOD:21	0.24	39.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	214-UNIMOD:21,207-UNIMOD:188,224-UNIMOD:188,226-UNIMOD:188,164-UNIMOD:21	0.03	39.0	3	2	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	145-UNIMOD:4,147-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	62-UNIMOD:21,66-UNIMOD:21	0.12	39.0	2	1	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	237-UNIMOD:267,240-UNIMOD:21,252-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|O15033-2|AREL1_HUMAN	Isoform 2 of Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens OX=9606 GN=AREL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	337-UNIMOD:21,341-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	14-UNIMOD:267,17-UNIMOD:21,37-UNIMOD:267,15-UNIMOD:21	0.14	39.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	307-UNIMOD:21,309-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	108-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q9HCI7-2|MSL2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MSL2 OS=Homo sapiens OX=9606 GN=MSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	269-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q8NCE0-5|SEN2_HUMAN	Isoform 5 of tRNA-splicing endonuclease subunit Sen2 OS=Homo sapiens OX=9606 GN=TSEN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	215-UNIMOD:21,221-UNIMOD:4,222-UNIMOD:4,223-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	12-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:188	0.06	39.0	1	1	1
PRT	sp|O00499-6|BIN1_HUMAN	Isoform II2 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	300-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.15	38.0	1	1	1
PRT	sp|A7MBM2|DISP2_HUMAN	Protein dispatched homolog 2 OS=Homo sapiens OX=9606 GN=DISP2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1252-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	181-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q8WWN8-2|ARAP3_HUMAN	Isoform 2 of Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1093-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	255-UNIMOD:21,263-UNIMOD:188,265-UNIMOD:188,266-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1859-UNIMOD:4,1861-UNIMOD:21,2528-UNIMOD:21	0.01	38.0	2	2	2
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	122-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	17-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1305-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	82-UNIMOD:21	0.16	38.0	1	1	1
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	411-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q8N5G2|MACOI_HUMAN	Macoilin OS=Homo sapiens OX=9606 GN=MACO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	306-UNIMOD:21,315-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1648-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1173-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O94827-4|PKHG5_HUMAN	Isoform 4 of Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	878-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	79-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	343-UNIMOD:21,346-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	674-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	175-UNIMOD:267,183-UNIMOD:21,196-UNIMOD:267	0.07	37.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	295-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	102-UNIMOD:21	0.12	37.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	363-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	127-UNIMOD:267,143-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	74-UNIMOD:21	0.11	37.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	459-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	693-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q7KZI7-10|MARK2_HUMAN	Isoform 10 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	423-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q6P4R8-3|NFRKB_HUMAN	Isoform 3 of Nuclear factor related to kappa-B-binding protein OS=Homo sapiens OX=9606 GN=NFRKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	298-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	63-UNIMOD:188,64-UNIMOD:188,67-UNIMOD:21,79-UNIMOD:188	0.05	37.0	2	2	2
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	677-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	341-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O15014|ZN609_HUMAN	Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	489-UNIMOD:4,491-UNIMOD:21,497-UNIMOD:4,502-UNIMOD:4,504-UNIMOD:188,505-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|O95785-4|WIZ_HUMAN	Isoform 4 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	201-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|P27815-2|PDE4A_HUMAN	Isoform 2 of cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	44-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	553-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	109-UNIMOD:21	0.10	37.0	1	1	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8IV56|PRR15_HUMAN	Proline-rich protein 15 OS=Homo sapiens OX=9606 GN=PRR15 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	49-UNIMOD:21	0.27	37.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1135-UNIMOD:21,1143-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q96L14|C170L_HUMAN	Cep170-like protein OS=Homo sapiens OX=9606 GN=CEP170P1 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	238-UNIMOD:21	0.08	37.0	1	1	1
PRT	sp|Q14181|DPOA2_HUMAN	DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	141-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q8NE01-2|CNNM3_HUMAN	Isoform 2 of Metal transporter CNNM3 OS=Homo sapiens OX=9606 GN=CNNM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	634-UNIMOD:21,644-UNIMOD:267,655-UNIMOD:267	0.04	37.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	303-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	598-UNIMOD:188,602-UNIMOD:267,604-UNIMOD:21,612-UNIMOD:188	0.01	37.0	1	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	96-UNIMOD:188,106-UNIMOD:21,116-UNIMOD:188,117-UNIMOD:267	0.18	37.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	836-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q96II8-3|LRCH3_HUMAN	Isoform 3 of DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	514-UNIMOD:21,531-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	153-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|Q5VZ89-3|DEN4C_HUMAN	Isoform 3 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1601-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	327-UNIMOD:4,328-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1135-UNIMOD:188,1143-UNIMOD:188,1145-UNIMOD:21,1147-UNIMOD:188	0.01	36.0	1	1	1
PRT	sp|Q9UKI8-4|TLK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q9UER7-3|DAXX_HUMAN	Isoform 3 of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	589-UNIMOD:4,596-UNIMOD:21,103-UNIMOD:21	0.10	36.0	2	2	2
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	296-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	282-UNIMOD:21,286-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8WVV9-3|HNRLL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	30-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q9HAW0-2|BRF2_HUMAN	Isoform 2 of Transcription factor IIIB 50 kDa subunit OS=Homo sapiens OX=9606 GN=BRF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	330-UNIMOD:21,338-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	182-UNIMOD:21,184-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	494-UNIMOD:267,508-UNIMOD:21,518-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|Q9Y2K7-3|KDM2A_HUMAN	Isoform 3 of Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q6ZRS2-3|SRCAP_HUMAN	Isoform 3 of Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1701-UNIMOD:21,1713-UNIMOD:267,1715-UNIMOD:267	0.01	36.0	1	1	1
PRT	sp|O00273|DFFA_HUMAN	DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	308-UNIMOD:21,315-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	40-UNIMOD:4	0.13	36.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	19-UNIMOD:21	0.18	36.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	378-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9BU64-2|CENPO_HUMAN	Isoform 2 of Centromere protein O OS=Homo sapiens OX=9606 GN=CENPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	25-UNIMOD:21,26-UNIMOD:267,27-UNIMOD:188,45-UNIMOD:188	0.07	36.0	1	1	1
PRT	sp|Q9P0L2-2|MARK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase MARK1 OS=Homo sapiens OX=9606 GN=MARK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	258-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	796-UNIMOD:21,814-UNIMOD:188,817-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|Q5ZPR3-2|CD276_HUMAN	Isoform 2 of CD276 antigen OS=Homo sapiens OX=9606 GN=CD276	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	303-UNIMOD:188,307-UNIMOD:21,308-UNIMOD:188	0.07	36.0	1	1	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1243-UNIMOD:21,1245-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q8IX03|KIBRA_HUMAN	Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	255-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	352-UNIMOD:21	0.02	36.0	1	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	377-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	323-UNIMOD:21,326-UNIMOD:188,331-UNIMOD:188,335-UNIMOD:188	0.02	36.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:21,191-UNIMOD:267,187-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	13-UNIMOD:21,23-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q8NFD4|YI018_HUMAN	Uncharacterized protein FLJ76381 OS=Homo sapiens OX=9606 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	66-UNIMOD:21,77-UNIMOD:21,79-UNIMOD:4,82-UNIMOD:267,83-UNIMOD:21,86-UNIMOD:21	0.15	36.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1	sp|O60784-3|TOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	10-UNIMOD:21	ms_run[2]:scan=15957	74.418	3	2574.2228	2574.2228	K	K	408	434
PSM	RTPAPPEPGSPAPGEGPSGR	2	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:267,10-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=7171	32.592	2	2012.922	2012.9220	R	K	162	182
PSM	AHQGTGAGISPVILNSGEGKEVDILR	3	sp|Q8IZD4-2|DCP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=21562	102.97	3	2697.3487	2697.3487	K	M	36	62
PSM	IQQFDDGGSDEEDIWEEKHIAFTPESQR	4	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	9-UNIMOD:21	ms_run[2]:scan=22411	107.35	3	3385.4412	3385.4412	R	R	529	557
PSM	VYEDSGIPLPAESPKKGPK	5	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:21	ms_run[2]:scan=12802	58.485	2	2091.0289	2091.0289	K	K	50	69
PSM	HGSGADSDYENTQSGDPLLGLEGKR	6	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21	ms_run[2]:scan=17415	81.758	3	2682.1559	2682.1559	R	F	590	615
PSM	LNHVAAGLVSPSLKSDTSSK	7	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=12595	57.466	2	2090.0409	2090.0409	K	E	198	218
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	8	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23411	112.63	3	3031.5031	3031.5031	R	V	276	304
PSM	DRSSPPPGYIPDELHQVAR	9	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=16821	78.708	2	2213.0266	2213.0266	R	N	161	180
PSM	GAQPGRHSVTGYGDCAVGAR	10	sp|Q96IF1|AJUBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:267,8-UNIMOD:21,15-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7274	33.116	2	2114.922	2114.9220	R	Y	256	276
PSM	KLQELSSKADEASELACPTPK	11	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=13269	60.839	2	2381.1186	2381.1186	R	E	2186	2207
PSM	RQESSSSLEMPSGVALEEGAHVLR	12	sp|P48553|TPC10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=22290	106.7	3	2648.2265	2648.2265	R	C	705	729
PSM	RSPDEALPGGLSGCSSGSGHSPYALER	13	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=15887	74.128	3	2823.2283	2823.2283	K	A	1469	1496
PSM	RTPAPPEPGSPAPGEGPSGR	14	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=7151	32.497	2	1992.9055	1992.9055	R	K	162	182
PSM	RVNNGNTAPEDSSPAKK	15	sp|Q9UGN5-2|PARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=954	5.8422	2	1863.8476	1863.8476	K	T	22	39
PSM	SLGNILQAKPTSSPAKGPPQK	16	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=12804	58.498	2	2198.146	2198.1460	K	A	494	515
PSM	TRKSPSSDSWTCADTSTER	17	sp|Q8N6T3-4|ARFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=6836	30.935	2	2250.9213	2250.9213	K	R	227	246
PSM	DRDNDSDDVESNLLLPAGIALR	18	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=26192	128.4	2	2397.1772	2397.1772	R	W	335	357
PSM	GRASSHSSQTQGGGSVTK	19	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=736	5.1786	2	1810.7959	1810.7959	R	K	400	418
PSM	KLQELSSKADEASELACPTPK	20	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,8-UNIMOD:188,17-UNIMOD:4,19-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=13372	61.402	3	2399.1789	2399.1789	R	E	2186	2207
PSM	KNEKAEENTDQASPQEDYAGFER	21	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=10097	45.923	3	2735.1348	2735.1348	R	L	4526	4549
PSM	LHSYSSPSTKNSSGGGESR	22	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=1698	8.2276	2	2016.8538	2016.8538	R	S	79	98
PSM	LNHVAAGLVSPSLKSDTSSK	23	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21,14-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=12593	57.462	2	2102.0812	2102.0812	K	E	198	218
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	24	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=22976	110.25	3	3031.5031	3031.5031	R	V	276	304
PSM	LVDVSPDRGSPPSRVPQALNFSPEESDSTFSK	25	sp|Q9NYZ3|GTSE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=21468	102.51	3	3524.6461	3524.6461	R	S	571	603
PSM	RATASEQPLAQEPPASGGSPATTKEQR	26	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:21	ms_run[2]:scan=7071	32.083	3	2844.3403	2844.3403	K	G	283	310
PSM	RFSADEQFFSVGQAASSSAHSSK	27	sp|P46019|KPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=19293	91.496	3	2510.0863	2510.0863	R	S	1013	1036
PSM	RKPSVPDSASPADDSFVDPGER	28	sp|P16333|NCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=13396	61.544	3	2408.0645	2408.0645	K	L	82	104
PSM	RLDEEEEDNEGGEWER	29	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=9662	43.981	2	1990.8141	1990.8141	K	V	278	294
PSM	SKSQSSGSSATHPISVPGAR	30	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=6957	31.56	2	2019.9375	2019.9375	R	R	304	324
PSM	SLKKDAPTSPASVASSSSTPSSK	31	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:188,4-UNIMOD:188,9-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=6650	29.976	2	2317.1548	2317.1548	R	T	278	301
PSM	TSSIHQLIAPASYSPIQPHSLIK	32	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=23085	110.87	3	2573.335	2573.3350	R	H	266	289
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	33	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	12-UNIMOD:21	ms_run[1]:scan=24057	116.11904166666667	3	3062.559474	3062.559037	K	A	477	506
PSM	DHSSQSEEEVVEGEKEVEALKK	34	sp|O60238-2|BNI3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=17140	80.354	3	2565.1483	2565.1483	R	S	75	97
PSM	ESRPGLVTVTSSQSTPAKAPR	35	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=8910	40.525	3	2248.1213	2248.1213	K	A	415	436
PSM	GPGAPASPSASHPQGLDTTPKPH	36	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=7634	34.791	2	2286.043	2286.0430	R	-	924	947
PSM	HIKEEPLSEEEPCTSTAIASPEK	37	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=13088	59.936	2	2661.1881	2661.1881	K	K	495	518
PSM	IILNSHSPAGSAAISQQDFHPK	38	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=15030	69.842	3	2397.1478	2397.1478	R	C	1606	1628
PSM	KGGEFDEFVNDDTDDDLPISKK	39	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=19739	93.814	3	2563.1003	2563.1003	K	K	913	935
PSM	KLQELSSKADEASELACPTPK	40	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=13188	60.435	3	2381.1186	2381.1186	R	E	2186	2207
PSM	RVPLSPLSLLAGPADAR	41	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=27533	136.84	2	1811.9659	1811.9659	R	R	429	446
PSM	RYPSSISSSPQKDLTQAK	42	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=11103	50.587	2	2071.9939	2071.9939	R	N	594	612
PSM	SLKKDAPTSPASVASSSSTPSSK	43	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=6580	29.585	3	2299.0945	2299.0945	R	T	278	301
PSM	SLKKDAPTSPASVASSSSTPSSK	44	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=6575	29.559	2	2299.0945	2299.0945	R	T	278	301
PSM	SRSEPSPDAPESPSSCSPSKNR	45	sp|Q5SYE7-2|NHSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=3805	16.676	3	2438.0169	2438.0169	R	R	1452	1474
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	46	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[1]:scan=22722	108.931545	3	3033.513340	3031.503138	R	V	276	304
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	47	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22716	108.901665	4	3112.593068	3111.608898	R	A	655	686
PSM	AKSPTPESSTIASYVTLRK	48	sp|Q9HAU0-5|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=17417	81.763	3	2115.0613	2115.0613	R	T	797	816
PSM	FNHDGEEEEEDDDYGSR	49	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=5362	23.462	2	2051.7492	2051.7492	K	T	271	288
PSM	FNHDGEEEEEDDDYGSR	50	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=5340	23.367	2	2041.741	2041.7410	K	T	271	288
PSM	HIKEEPLSEEEPCTSTAIASPEK	51	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12895	58.918	2	2661.1881	2661.1881	K	K	495	518
PSM	HTTFEQPVFSVSKQSPPISTSK	52	sp|P33981-2|TTK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=16728	78.218	3	2511.2047	2511.2047	K	W	421	443
PSM	IHLPLNYPPGSPDLGR	53	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=21569	103	2	1824.8924	1824.8924	R	H	952	968
PSM	IKNENTEGSPQEDGVELEGLKQR	54	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=12547	57.275	3	2649.2283	2649.2283	K	L	1239	1262
PSM	IYHLPDAESDEDEDFKEQTR	55	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=15782	73.612	2	2516.0381	2516.0381	K	L	210	230
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	56	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=23949	115.51	3	3082.5756	3082.5756	K	A	444	473
PSM	NFTKPQDGDVIAPLITPQKK	57	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=16987	79.558	2	2289.177	2289.1770	R	E	507	527
PSM	SLLSHEFQDETDTEEETLYSSKH	58	sp|O75976-2|CBPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=19222	91.157	3	2810.1903	2810.1903	K	-	1111	1134
PSM	SNSAPLIHGLSDTSPVFQAEAPSAR	59	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=23656	113.95	3	2641.2413	2641.2413	R	R	35	60
PSM	TSTSLGKGSFLDKISPSVLR	60	sp|Q9BW04-2|SARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=23735	114.35	2	2172.1191	2172.1191	K	N	259	279
PSM	VNPHKVSPASSVDSNIPSSQGYK	61	sp|Q9UHB7|AFF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:188,7-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=11217	51.092	3	2489.199	2489.1990	K	K	481	504
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	62	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22715	108.89887833333334	3	3112.593135	3111.608898	R	A	655	686
PSM	AHQGTGAGISPVILNSGEGKEVDILR	63	sp|Q8IZD4|DCP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:21	ms_run[1]:scan=21877	104.58953000000001	3	2698.335850	2697.348710	K	M	138	164
PSM	ELEKPIQSKPQSPVIQAAAVSPK	64	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	21-UNIMOD:21	ms_run[1]:scan=13026	59.640455	3	2524.332149	2524.330206	R	F	207	230
PSM	AGKYVDEENSDGETSNHR	65	sp|Q8N9T8|KRI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=2105	9.6105	2	2086.8229	2086.8229	K	L	127	145
PSM	DLQSPDFTTGFHSDKIEAK	66	sp|Q9P2D0-2|IBTK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=16730	78.23	2	2214.9834	2214.9834	R	V	1042	1061
PSM	DRDNDSDDVESNLLLPAGIALR	67	sp|Q9NZM1-5|MYOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=26196	128.42	2	2417.1937	2417.1937	R	W	335	357
PSM	GAQPGRHSVTGYGDCAVGAR	68	sp|Q96IF1|AJUBA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=7259	33.027	2	2094.9055	2094.9055	R	Y	256	276
PSM	IDASKNEEDEGHSNSSPR	69	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=1236	6.6965	2	2050.8229	2050.8229	K	H	68	86
PSM	IHLPLNYPPGSPDLGR	70	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=22364	107.11	2	1834.9007	1834.9007	R	H	952	968
PSM	KLQELSSKADEASELACPTPK	71	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,8-UNIMOD:188,17-UNIMOD:4,19-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=13164	60.343	3	2399.1789	2399.1789	R	E	2186	2207
PSM	KNQKPSQVNGAPGSPTEPAGQK	72	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=3006	13.36	2	2299.0958	2299.0958	K	Q	1254	1276
PSM	KSFSKEELMSSDLEETAGSTSIPK	73	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,5-UNIMOD:188,11-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=18902	89.414	3	2698.2794	2698.2794	K	R	510	534
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	74	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=23475	112.97	3	3011.4866	3011.4866	R	V	276	304
PSM	RKYSASSGGLCEEATAAK	75	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=7624	34.738	2	1964.8663	1964.8663	K	V	392	410
PSM	RVPLSPLSLLAGPADAR	76	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,5-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=27553	136.95	2	1831.9824	1831.9824	R	R	429	446
PSM	RVTQHESDNENEIQIQNK	77	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=5773	25.097	2	2261.0074	2261.0074	R	L	116	134
PSM	SKSAESPSWTPAEHVAK	78	sp|Q13415|ORC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=9110	41.452	2	1890.8513	1890.8513	K	R	194	211
PSM	SLLSHEFQDETDTEEETLYSSKH	79	sp|O75976-2|CBPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=19309	91.565	3	2804.1702	2804.1702	K	-	1111	1134
PSM	SSLHTPFSPNSETLASAYHANTR	80	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=19262	91.355	3	2577.1525	2577.1525	R	A	1046	1069
PSM	VGGPLAVLGPSRSSEDLAGPLPSSVSSSSTTSSKPK	81	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=22439	107.5	3	3518.7505	3518.7505	R	L	113	149
PSM	VKAQTPPGPSLSGSKSPCPQEK	82	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,10-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7283	33.159	2	2377.1847	2377.1847	K	S	999	1021
PSM	AHQGTGAGISPVILNSGEGKEVDILR	83	sp|Q8IZD4|DCP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:21	ms_run[1]:scan=21838	104.39054166666666	3	2698.335850	2697.348710	K	M	138	164
PSM	KNQKPSQVNGAPGSPTEPAGQK	84	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,22-UNIMOD:188	ms_run[1]:scan=2916	12.978701666666666	3	2318.141106	2317.156176	K	Q	1254	1276
PSM	APLKPYPVSPSDKVLIQEK	85	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=16589	77.497	2	2188.1545	2188.1545	K	T	1039	1058
PSM	FAANPNQNKNVALLSQLYHSPAR	86	sp|Q15717|ELAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=20253	96.501	3	2632.2911	2632.2911	K	R	183	206
PSM	GKQSPPGPGKAPLTSGIDSSTLAPSNLK	87	sp|O75362|ZN217_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,4-UNIMOD:21,10-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=17539	82.396	3	2802.4663	2802.4663	K	S	792	820
PSM	GRAEGEWEDQEALDYFSDKESGK	88	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=19462	92.267	3	2725.1181	2725.1181	K	Q	367	390
PSM	HIKEEPLSEEEPCTSTAIASPEK	89	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=13178	60.396	3	2673.2284	2673.2284	K	K	495	518
PSM	HSLPSGLGLSETQITSHGFDNTK	90	sp|P53367-2|ARFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=21456	102.44	3	2505.1537	2505.1537	K	E	35	58
PSM	IADPEHDHTGFLTEYVATR	91	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16477	76.909	2	2261.0029	2261.0029	R	W	190	209
PSM	IKNENTEGSPQEDGVELEGLKQR	92	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=11674	53.186	3	2649.2283	2649.2283	K	L	1239	1262
PSM	IKNENTEGSPQEDGVELEGLKQR	93	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=12753	58.282	3	2649.2283	2649.2283	K	L	1239	1262
PSM	KAEQGSEEEGEGEEEEEEGGESKADDPYAHLSK	94	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=10422	47.329	4	3658.4592	3658.4592	K	K	223	256
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	95	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=25284	123	3	4005.3218	4005.3218	K	-	184	216
PSM	KLGAGEGGEASVSPEKTSTTSK	96	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=4968	21.782	3	2200.026	2200.0260	K	G	1289	1311
PSM	KNQKPSQVNGAPGSPTEPAGQK	97	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=2998	13.326	2	2317.1562	2317.1562	K	Q	1254	1276
PSM	KPRPSEGDEDCLPASK	98	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4539	19.951	2	1864.8026	1864.8026	K	K	247	263
PSM	KQHYLSSEDEPDDNPDVLDSR	99	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=13943	64.39	3	2538.0548	2538.0548	R	I	2774	2795
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	100	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:21	ms_run[2]:scan=13417	61.625	2	2637.3415	2637.3415	R	R	31	56
PSM	NKPGPNIESGNEDDDASFKIK	101	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=13195	60.473	3	2354.0427	2354.0427	K	T	206	227
PSM	RCATPVIIDEILPSKK	102	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=21674	103.54	2	1918.9951	1918.9951	K	M	144	160
PSM	RIDFTPVSPAPSPTRGFGK	103	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=18102	85.164	2	2189.0072	2189.0072	K	M	55	74
PSM	RPASVSSSAAVEHEQR	104	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,4-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=3703	16.295	2	1809.8274	1809.8274	K	E	237	253
PSM	RPSTAVDEEDEDSPSECHTPEK	105	sp|O15033-2|AREL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=5117	22.45	3	2594.0116	2594.0116	R	V	325	347
PSM	RSASPDDDLGSSNWEAADLGNEER	106	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,4-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=18128	85.303	3	2690.0996	2690.0996	K	K	14	38
PSM	SGPKPFSAPKPQTSPSPK	107	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=8124	37.019	2	1996.9061	1996.9061	R	R	294	312
PSM	SHNNFVAILDLPEGEHQYK	108	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=23643	113.89	2	2290.042	2290.0420	R	F	108	127
PSM	SRSESDSEKVQPLPISTIIR	109	sp|Q9HCI7-2|MSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=20684	98.626	2	2321.1628	2321.1628	R	G	269	289
PSM	SVREDASPLPHVCCCK	110	sp|Q8NCE0-5|SEN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=9207	41.865	2	1993.821	1993.8210	K	Q	209	225
PSM	THDHQLESSLSPVEVFAK	111	sp|Q9H410-4|DSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,11-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=19316	91.588	3	2188.9539	2188.9539	K	T	4	22
PSM	VNHEPEPAGGATPGATLPKSPSQLR	112	sp|O00499-6|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=13225	60.594	3	2590.2541	2590.2541	R	K	281	306
PSM	AAEDDEDDDVDTKKQK	113	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=1224	6.6628	2	1820.7912	1820.7912	R	T	90	106
PSM	ARQDSQGEEAEPLPASPEAPAHSPK	114	sp|A7MBM2|DISP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=9151	41.63	3	2678.1974	2678.1974	R	A	1248	1273
PSM	DKRPLSGPDVGTPQPAGLASGAK	115	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=13338	61.224	2	2298.1369	2298.1369	R	L	176	199
PSM	DLQSPDFTTGFHSDKIEAK	116	sp|Q9P2D0-2|IBTK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=16699	78.083	2	2227.0237	2227.0237	R	V	1042	1061
PSM	DRSSPPPGYIPDELHQVAR	117	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,3-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16803	78.614	2	2233.0432	2233.0432	R	N	161	180
PSM	ELEKPIQSKPQSPVIQAAAVSPK	118	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:21	ms_run[2]:scan=13119	60.09	2	2524.3302	2524.3302	R	F	207	230
PSM	EWTVKPENPLTSQKSLDQPFLSK	119	sp|Q8WWN8-2|ARAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:21	ms_run[2]:scan=23403	112.59	3	2751.3521	2751.3521	R	S	1079	1102
PSM	HSLPSGLGLSETQITSHGFDNTK	120	sp|P53367-2|ARFP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=21656	103.45	3	2505.1537	2505.1537	K	E	35	58
PSM	IEDVGSDEEDDSGKDKK	121	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=2543	11.383	2	1944.7837	1944.7837	K	K	250	267
PSM	IHLPLNYPPGSPDLGR	122	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=20760	99.003	2	1834.9007	1834.9007	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	123	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=21969	105.08	2	1834.9007	1834.9007	R	H	952	968
PSM	IKNENTEGSPQEDGVELEGLKQR	124	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=12773	58.368	2	2649.2283	2649.2283	K	L	1239	1262
PSM	IYHLPDAESDEDEDFKEQTR	125	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=15788	73.641	3	2516.0381	2516.0381	K	L	210	230
PSM	KFSKEEPVSSGPEEAVGK	126	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=10022	45.628	2	2063.8854	2063.8854	R	S	561	579
PSM	KGGEFDEFVNDDTDDDLPISKK	127	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=19941	94.878	3	2563.1003	2563.1003	K	K	913	935
PSM	KILCKSPQSDPADTPTNTK	128	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=5613	24.519	2	2180.0184	2180.0185	K	Q	1856	1875
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	129	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17602	82.706	3	4005.3218	4005.3218	K	-	184	216
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	130	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24181	116.74	3	4005.3218	4005.3218	K	-	184	216
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	131	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=25914	126.67	3	4005.3218	4005.3218	K	-	184	216
PSM	KQAEKEVPWSPSAEK	132	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=9269	42.175	2	1792.8397	1792.8397	R	A	547	562
PSM	KSFSKEELMSSDLEETAGSTSIPK	133	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=18778	88.749	3	2680.2191	2680.2191	K	R	510	534
PSM	KYEQGFITDPVVLSPKDR	134	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=18460	86.934	2	2171.0664	2171.0664	K	V	109	127
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	135	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23179	111.36	3	3031.5031	3031.5031	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	136	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21850	104.45	3	3031.5031	3031.5031	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	137	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:267,19-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24149	116.58	3	3082.5756	3082.5756	K	A	444	473
PSM	NFTKPQDGDVIAPLITPQKK	138	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:188,16-UNIMOD:21,19-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=17142	80.365	2	2307.2374	2307.2374	R	E	507	527
PSM	NRTPSDVKELVLDNSR	139	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=15858	73.99	2	1921.9259	1921.9259	R	S	13	29
PSM	RAAVGQESPGGLEAGNAKAPK	140	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=7245	32.967	3	2087.0161	2087.0161	K	L	1298	1319
PSM	RAPSTSPSFEGTQETYTVAHEENVR	141	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=14223	65.853	3	2872.2665	2872.2665	R	F	75	100
PSM	RKVSPESSPDQEETEINFTQK	142	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=12529	57.203	3	2528.1432	2528.1432	R	L	408	429
PSM	RLNNDLVGSTENLLKEDSCTASSK	143	sp|Q8N5G2|MACOI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=20059	95.493	3	2730.2532	2730.2532	K	N	297	321
PSM	RPASVSSSAAVEHEQR	144	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=3686	16.238	2	1789.8108	1789.8108	K	E	237	253
PSM	RSNVSSPATPTASSSSSTTPTRK	145	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=2944	13.091	3	2386.1126	2386.1126	R	I	1630	1653
PSM	RTHSDASDDEAFTTSK	146	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=3859	16.871	2	1846.7371	1846.7371	R	T	1170	1186
PSM	SFSKEELMSSDLEETAGSTSIPKR	147	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=18643	87.945	3	2708.2252	2708.2252	K	K	511	535
PSM	SKSEASLLQLLAGAGTHGTPSAPSR	148	sp|O94827-4|PKHG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=25349	123.37	3	2515.2432	2515.2432	K	S	876	901
PSM	TSTSLGKGSFLDKISPSVLR	149	sp|Q9BW04-2|SARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=23769	114.54	2	2172.1191	2172.1191	K	N	259	279
PSM	WEETRTPESQPDTPPGTPLVSQDEKR	150	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=13632	62.731	3	3059.3873	3059.3873	R	D	67	93
PSM	WPFSGKTSPPCSPANLSR	151	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=19275	91.409	2	2067.9238	2067.9238	R	H	336	354
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	152	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=21078	100.55717166666666	3	4006.320515	4005.321784	K	-	184	216
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	153	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:21	ms_run[1]:scan=23872	115.114775	3	3062.559474	3062.559037	K	A	477	506
PSM	PRSPGSNSKVPEIEVTVEGPNNNNPQTSAVR	154	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21	ms_run[1]:scan=16326	76.21971666666666	3	3354.582117	3353.600126	R	T	672	703
PSM	AFKESPKQILDPAASVTGSR	155	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=17769	83.591	3	2181.0831	2181.0831	K	R	2524	2544
PSM	ARVVNTDHGSPEQLQIPVTDSGR	156	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,10-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=13973	64.54	3	2575.2295	2575.2295	R	H	174	197
PSM	DRSSPPPGYIPDELHQVAR	157	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,4-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16876	78.962	3	2233.0432	2233.0432	R	N	161	180
PSM	DRSSPPPGYIPDELHQVAR	158	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,4-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=17293	81.164	3	2233.0432	2233.0432	R	N	161	180
PSM	ELEAIFGRPVVDGEEGEPHSISPR	159	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	22-UNIMOD:21	ms_run[2]:scan=21105	100.69	3	2699.2592	2699.2592	K	P	274	298
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	160	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=19946	94.895	3	3393.3457	3393.3457	K	F	86	114
PSM	GHTDTEGRPPSPPPTSTPEK	161	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=4958	21.742	2	2166.9583	2166.9583	R	C	353	373
PSM	GIRPFPSEETTENDDDVYR	162	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=14538	67.413	2	2259.0195	2259.0195	K	S	125	144
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	163	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=15749	73.415	3	2649.1708	2649.1708	K	S	61	87
PSM	GRASSHSSQTQGGGSVTKK	164	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=683	4.9875	2	2018.8572	2018.8572	R	R	400	419
PSM	HIKEEPLSEEEPCTSTAIASPEK	165	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=12889	58.897	3	2673.2284	2673.2284	K	K	495	518
PSM	HQDGLPYIDDSPSSSPHLSSK	166	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=16244	75.778	3	2346.0165	2346.0165	R	G	449	470
PSM	HTTFEQPVFSVSKQSPPISTSK	167	sp|P33981-2|TTK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:188,15-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=16924	79.23	3	2523.2449	2523.2449	K	W	421	443
PSM	IHLPLNYPPGSPDLGR	168	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=21172	101.02	2	1834.9007	1834.9007	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	169	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=22173	106.09	2	1834.9007	1834.9007	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	170	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=21762	104.01	2	1824.8924	1824.8924	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	171	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=22444	107.52	2	1824.8924	1824.8924	R	H	952	968
PSM	INNYLTVPAHKLDSPTMSR	172	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=16462	76.852	2	2236.0712	2236.0712	K	A	680	699
PSM	KASSTAKVPASPLPGLER	173	sp|Q7KZI7-10|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=12083	55.113	2	1887.9819	1887.9819	R	K	413	431
PSM	KGSLAALYDLAVLKK	174	sp|Q6P4R8-3|NFRKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=24893	120.77	2	1668.9216	1668.9216	R	K	296	311
PSM	KKDASDDLDDLNFFNQK	175	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,2-UNIMOD:188,5-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21861	104.51	2	2109.9754	2109.9754	R	K	63	80
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	176	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16669	77.936	3	4005.3218	4005.3218	K	-	184	216
PSM	KRSVAVSDEEEVEEEAER	177	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=11537	52.558	3	2169.9427	2169.9427	R	R	675	693
PSM	LKTEKEPDATPPSPR	178	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=4555	20.013	2	1744.8397	1744.8397	K	T	329	344
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	179	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,13-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=20789	99.135	3	3031.5031	3031.5031	R	V	276	304
PSM	NCPSPVLIDCPHPNCNKK	180	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,4-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9546	43.477	2	2240.9933	2240.9933	R	Y	488	506
PSM	NKPGPNIESGNEDDDASFKIK	181	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=14585	67.628	3	2372.1031	2372.1031	K	T	206	227
PSM	NPEDKSPQLSLSPRPASPK	182	sp|O95785-4|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=10666	48.518	2	2127.0361	2127.0361	K	A	185	204
PSM	PRSPPSSPVFFASPSPTFR	183	sp|P27815-2|PDE4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=22240	106.43	3	2140.0143	2140.0143	R	R	42	61
PSM	RIDFIPVSPAPSPTRGIGK	184	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=20803	99.202	3	2167.0592	2167.0592	K	Q	136	155
PSM	RIDFIPVSPAPSPTRGIGK	185	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=20916	99.737	2	2167.0592	2167.0592	K	Q	136	155
PSM	RIDFTPVSPAPSPTRGFGK	186	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=18236	85.833	3	2189.0072	2189.0072	K	M	55	74
PSM	RKASPEPPDSAEGALK	187	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=5838	25.331	2	1731.8193	1731.8193	K	L	544	560
PSM	RLEEPEEPKVLTPEEQLADK	188	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=15765	73.517	3	2429.1727	2429.1727	K	L	98	118
PSM	RTSSTLDSEGTFNSYRK	189	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10118	46.008	2	2027.895	2027.8950	R	E	41	58
PSM	SKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSR	190	sp|Q8IV56|PRR15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	26-UNIMOD:21	ms_run[2]:scan=17736	83.43	3	3441.6242	3441.6242	K	E	24	58
PSM	SLLSHEFQDETDTEEETLYSSKH	191	sp|O75976-2|CBPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=19105	90.527	3	2804.1702	2804.1702	K	-	1111	1134
PSM	SRPALSPLGDIDFCPPNPGPDGPR	192	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=24522	118.62	3	2611.189	2611.1890	R	R	1130	1154
PSM	SSPVNNHHSPGQTPTLGQPEAR	193	sp|Q96L14|C170L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=7629	34.764	2	2390.0764	2390.0765	K	A	230	252
PSM	SVSTRSPHQLLSPSSFSPSATPSQK	194	sp|Q14181|DPOA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=16413	76.641	2	2692.2858	2692.2858	R	Y	136	161
PSM	TTTAAGSSHSRPGVPVEGSPGRNPGV	195	sp|Q8NE01-2|CNNM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,11-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9400	42.797	3	2574.2091	2574.2091	K	-	634	660
PSM	VKLESPTVSTLTPSSPGKLLTR	196	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=20786	99.121	3	2390.2822	2390.2822	R	S	290	312
PSM	TFLDKDAQRLSPIPEEVPK	197	sp|Q96T23|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:188,9-UNIMOD:267,11-UNIMOD:21,19-UNIMOD:188	ms_run[1]:scan=18473	87.00624499999999	3	2284.177073	2284.178242	K	S	594	613
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	198	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=15643	72.89644	3	4007.324672	4005.321784	K	-	184	216
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	199	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=24248	117.12687166666666	3	3062.559474	3062.559037	K	A	477	506
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKR	200	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:188,28-UNIMOD:21,38-UNIMOD:188,39-UNIMOD:267	ms_run[1]:scan=20247	96.45501333333333	4	4281.727294	4281.730843	K	L	79	118
PSM	KGGEFDEFVNDDTDDDLPISKK	201	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=20379	97.150795	3	2564.084611	2563.100325	K	K	913	935
PSM	KNQKPSQVNGAPGSPTEPAGQK	202	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:21	ms_run[1]:scan=3735	16.42513166666667	2	2300.078847	2299.095789	K	Q	1254	1276
PSM	VVGKPAQLGTQRSQEADVQDWEFR	203	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=18393	86.58923666666666	3	2824.337647	2823.334122	R	K	824	848
PSM	ASQSPQKQHPLLDGVDGECPFPSR	204	sp|Q96II8-3|LRCH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=17774	83.617	3	2729.2269	2729.2269	K	R	513	537
PSM	AVGPASILKEVEDKESEGEEEDEDEDLSK	205	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=23588	113.58	3	3255.4079	3255.4079	K	Y	138	167
PSM	DASDDLDDLNFFNQK	206	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=25734	125.56	2	1761.7789	1761.7789	K	K	65	80
PSM	ELEAIFGRPVVDGEEGEPHSISPR	207	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:21	ms_run[2]:scan=20903	99.683	3	2699.2592	2699.2592	K	P	274	298
PSM	ELEKPIQSKPQSPVIQAAAVSPK	208	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,9-UNIMOD:188,21-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=13112	60.051	2	2542.3906	2542.3906	R	F	207	230
PSM	GKQSPPGPGKAPLTSGIDSSTLAPSNLK	209	sp|O75362|ZN217_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=17582	82.587	3	2784.4059	2784.4059	K	S	792	820
PSM	HNQIITEETGSAVEPSDEIKR	210	sp|Q5VZ89-3|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=12716	58.082	3	2432.1221	2432.1221	K	A	1591	1612
PSM	HSEEAEFTPPLKCSPK	211	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=11608	52.856	2	1935.8438	1935.8438	K	R	315	331
PSM	IEDVGSDEEDDSGKDKK	212	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=2562	11.465	2	1962.8441	1962.8441	K	K	250	267
PSM	IHLPLNYPPGSPDLGR	213	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=20972	100.02	2	1834.9007	1834.9007	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	214	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=21776	104.07	2	1834.9007	1834.9007	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	215	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=20939	99.855	2	1824.8924	1824.8924	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	216	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=22355	107.07	2	1824.8924	1824.8924	R	H	952	968
PSM	IHLPLNYPPGSPDLGR	217	sp|Q08174|PCDH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=22167	106.06	2	1824.8924	1824.8924	R	H	952	968
PSM	ISKLEVTEIVKPSPK	218	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:188,11-UNIMOD:188,13-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=14995	69.668	2	1765.0136	1765.0136	K	R	1133	1148
PSM	KAENQNESSQGKSIGGR	219	sp|Q9UKI8-4|TLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=1182	6.5281	2	1868.8378	1868.8378	R	G	30	47
PSM	KEEEEEEDDDDDSKEPK	220	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1113	6.3255	3	2064.8131	2064.8131	R	S	133	150
PSM	KICTLPSPPSPLASLAPVADSSTR	221	sp|Q9UER7-3|DAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=24118	116.42	3	2544.2659	2544.2659	K	V	587	611
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	222	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22368	107.13	3	4005.3218	4005.3218	K	-	184	216
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	223	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=25498	124.2	3	4005.3218	4005.3218	K	-	184	216
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	224	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=25685	125.28	3	4005.3218	4005.3218	K	-	184	216
PSM	KLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR	225	sp|Q9UER7-3|DAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	37-UNIMOD:21	ms_run[2]:scan=17757	83.541	4	4091.9186	4091.9186	K	T	67	106
PSM	KNSTGSGHSAQELPTIR	226	sp|O94763-2|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=8676	39.466	2	1861.8684	1861.8684	R	T	294	311
PSM	KPRPSEGDEDCLPASK	227	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4317	18.953	2	1864.8026	1864.8026	K	K	247	263
PSM	KPSPSESPEPWKPFPAVSPEPR	228	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=20480	97.635	3	2605.1655	2605.1655	R	R	280	302
PSM	KQAEKEVPWSPSAEK	229	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,5-UNIMOD:188,10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=9201	41.842	2	1810.9001	1810.9001	R	A	547	562
PSM	LKTEEGEIDYSAEEGENRR	230	sp|Q8WVV9-3|HNRLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=9822	44.742	2	2303.9907	2303.9907	R	E	20	39
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	231	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=23238	111.71	3	3011.4866	3011.4866	R	V	276	304
PSM	NPEDKSPQLSLSPRPASPK	232	sp|O95785-4|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=10627	48.3	2	2127.0361	2127.0361	K	A	185	204
PSM	RFSADEQFFSVGQAASSSAHSSK	233	sp|P46019|KPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=21192	101.14	3	2510.0863	2510.0863	R	S	1013	1036
PSM	RIDFIPVSPAPSPTRGIGK	234	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=21015	100.22	3	2167.0592	2167.0592	K	Q	136	155
PSM	RPASPALLLPPCMLK	235	sp|Q9HAW0-2|BRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=24354	117.7	2	1742.8977	1742.8977	K	S	327	342
PSM	RRGSSGSVDETLFALPAASEPVIR	236	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=25787	125.88	3	2674.2517	2674.2517	K	S	178	202
PSM	RTATYNGPPASPSLSHEATPLSQTR	237	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,15-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=14294	66.21	3	2738.2928	2738.2928	R	S	494	519
PSM	RYEDDGISDDEIEGKR	238	sp|Q9Y2K7-3|KDM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=9845	44.842	2	1975.816	1975.8160	R	T	21	37
PSM	SGPPSPPSTATSFGGPRPR	239	sp|Q6ZRS2-3|SRCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,17-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=11957	54.501	2	1951.9056	1951.9056	R	R	1697	1716
PSM	SISASKASPPGDLQNPKR	240	sp|O00273|DFFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=7244	32.964	2	1931.9466	1931.9466	R	A	308	326
PSM	SKLTFSCLGGSDNFK	241	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=16936	79.282	2	1659.7927	1659.7927	K	H	34	49
PSM	SNKKWDGSEEDEDNSK	242	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=1997	9.286	2	1946.7531	1946.7531	K	K	157	173
PSM	SPPKVPIVIQDDSLPAGPPPQIR	243	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=23513	113.17	3	2500.3091	2500.3091	K	I	19	42
PSM	SQGDEAGGHGEDRPEPLSPK	244	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=5186	22.754	2	2141.9015	2141.9015	R	E	361	381
PSM	SRKQSEELQSVQAQEGALGTK	245	sp|Q9BU64-2|CENPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,2-UNIMOD:267,3-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=11723	53.443	3	2375.176	2371.1879	R	I	25	46
PSM	SRPSSDLNNSTLQSPAHLK	246	sp|Q9P0L2-2|MARK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=11567	52.684	3	2131.0059	2131.0059	R	V	255	274
PSM	SSQQPSTPQQAPPGQPQQGTFVAHKEIK	247	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,25-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=9576	43.62	3	3092.5119	3092.5119	K	L	790	818
PSM	TALQPLKHSDSKEDDGQEIA	248	sp|Q5ZPR3-2|CD276_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,11-UNIMOD:21,12-UNIMOD:188	ms_run[2]:scan=10152	46.127	2	2273.0615	2273.0615	K	-	297	317
PSM	TASRPDDIPDSPSSPKVALLPPVLK	249	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=23929	115.39	3	2759.3548	2759.3548	R	K	1233	1258
PSM	TDRGSHSDLWSSSSSLESSSFPLPK	250	sp|Q8IX03|KIBRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=23306	112.07	3	2773.2232	2773.2232	R	Q	251	276
PSM	TFLDKDAQRLSPIPEEVPK	251	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=19133	90.686	3	2262.1297	2262.1297	K	S	342	361
PSM	TGSNISGASSDISLDEQYKHQLEETKK	252	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=15418	71.751	3	3044.3976	3044.3976	R	E	377	404
PSM	TPISPLKTGVSKPIVK	253	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,7-UNIMOD:188,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=13226	60.596	2	1762.0504	1762.0504	K	S	320	336
PSM	TSSIHQLIAPASYSPIQPHSLIK	254	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=23093	110.91	3	2567.3149	2567.3149	R	H	266	289
PSM	VADPDHDHTGFLTEYVATR	255	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=15347	71.425	2	2232.9716	2232.9716	R	W	173	192
PSM	VADPDHDHTGFLTEYVATR	256	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=15359	71.476	2	2222.9634	2222.9634	R	W	173	192
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	257	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:188,2-UNIMOD:188	ms_run[1]:scan=12721	58.10872166666667	3	4019.363774	4017.362042	K	-	184	216
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	258	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:188,2-UNIMOD:188	ms_run[1]:scan=14943	69.42015833333333	3	4017.357207	4017.362042	K	-	184	216
PSM	RVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAK	259	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=21994	105.19301666666668	3	3430.586378	3429.605806	R	N	11	44
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	260	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:267,27-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22926	110.02101833333333	3	3112.593135	3111.608898	R	A	655	686
PSM	HIKEEPLSEEEPCTSTAIASPEK	261	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188	ms_run[1]:scan=14046	64.93851333333333	3	2674.214749	2673.228353	K	K	495	518
PSM	RSASPDDDLGSSNWEAADLGNEER	262	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:21	ms_run[1]:scan=18100	85.15849166666666	3	2671.079597	2670.083112	K	K	14	38
PSM	SISASKASPPGDLQNPKR	263	sp|O00273|DFFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=7452	33.969413333333335	2	1932.949541	1931.946606	R	A	308	326
PSM	TVVATATGAEVSACAGRSAGTR	264	sp|Q8NFD4|YI018_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:267,18-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=7973	36.406016666666666	3	2422.922600	2421.906708	R	V	66	88