MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL16.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	2718-UNIMOD:21,2715-UNIMOD:267,2720-UNIMOD:21,2734-UNIMOD:267	0.02	51.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	51.0	30	1	0
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	452-UNIMOD:267,463-UNIMOD:21,472-UNIMOD:267	0.04	49.0	2	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	127-UNIMOD:21,161-UNIMOD:267	0.08	48.0	4	1	0
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	108-UNIMOD:21,125-UNIMOD:188,129-UNIMOD:188	0.03	47.0	1	1	1
PRT	sp|P28290|ITPI2_HUMAN	Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	869-UNIMOD:21,878-UNIMOD:4,887-UNIMOD:4,892-UNIMOD:267,864-UNIMOD:21	0.02	47.0	3	1	0
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	211-UNIMOD:21,213-UNIMOD:21,227-UNIMOD:267,239-UNIMOD:188,241-UNIMOD:188	0.11	47.0	3	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	417-UNIMOD:21,416-UNIMOD:21,411-UNIMOD:267,433-UNIMOD:267	0.06	46.0	4	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	719-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	384-UNIMOD:21,395-UNIMOD:4	0.02	46.0	1	1	1
PRT	sp|Q9UK58|CCNL1_HUMAN	Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	342-UNIMOD:21	0.06	46.0	2	1	0
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	522-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	83-UNIMOD:21	0.04	45.0	2	1	0
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	775-UNIMOD:267,776-UNIMOD:21,788-UNIMOD:4,801-UNIMOD:267	0.02	45.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	407-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2296-UNIMOD:21,2289-UNIMOD:188,2322-UNIMOD:188	0.01	44.0	2	1	0
PRT	sp|Q3KQU3-3|MA7D1_HUMAN	Isoform 3 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	80-UNIMOD:21	0.08	44.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	34-UNIMOD:267,37-UNIMOD:21,59-UNIMOD:267	0.09	44.0	2	1	0
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	505-UNIMOD:21,1301-UNIMOD:21,502-UNIMOD:188,506-UNIMOD:21,509-UNIMOD:188,514-UNIMOD:188	0.03	44.0	4	2	1
PRT	sp|Q6PGQ7|BORA_HUMAN	Protein aurora borealis OS=Homo sapiens OX=9606 GN=BORA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	299-UNIMOD:21,315-UNIMOD:4	0.04	44.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	156-UNIMOD:21,157-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	570-UNIMOD:21,561-UNIMOD:188,564-UNIMOD:188,578-UNIMOD:188,519-UNIMOD:21,520-UNIMOD:21	0.08	43.0	5	3	2
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	108-UNIMOD:21,109-UNIMOD:21,228-UNIMOD:21	0.06	43.0	3	2	1
PRT	sp|Q92794|KAT6A_HUMAN	Histone acetyltransferase KAT6A OS=Homo sapiens OX=9606 GN=KAT6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1113-UNIMOD:21	0.01	43.0	2	1	0
PRT	sp|O95671-3|ASML_HUMAN	Isoform 3 of Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein OS=Homo sapiens OX=9606 GN=ASMTL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	181-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1400-UNIMOD:21,1396-UNIMOD:21	0.01	43.0	2	1	0
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	518-UNIMOD:21,527-UNIMOD:21,530-UNIMOD:21	0.07	43.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	261-UNIMOD:267,263-UNIMOD:21,270-UNIMOD:4,275-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|Q6WKZ4-2|RFIP1_HUMAN	Isoform 4 of Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	209-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1405-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	77-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	177-UNIMOD:188,178-UNIMOD:21,184-UNIMOD:188,197-UNIMOD:188	0.10	42.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1243-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q8N4C8-5|MINK1_HUMAN	Isoform 5 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	706-UNIMOD:21,721-UNIMOD:21,709-UNIMOD:267	0.03	42.0	3	2	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	307-UNIMOD:21,309-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1121-UNIMOD:21,1132-UNIMOD:188,1123-UNIMOD:21	0.02	42.0	2	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	830-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	121-UNIMOD:21,124-UNIMOD:21	0.08	42.0	2	1	0
PRT	sp|Q8N6T3-4|ARFG1_HUMAN	Isoform 4 of ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	230-UNIMOD:21,238-UNIMOD:4	0.07	42.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,295-UNIMOD:21,297-UNIMOD:21,351-UNIMOD:21,353-UNIMOD:21	0.03	42.0	3	3	3
PRT	sp|O00499-6|BIN1_HUMAN	Isoform II2 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	300-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|Q9Y6K9|NEMO_HUMAN	NF-kappa-B essential modulator OS=Homo sapiens OX=9606 GN=IKBKG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	377-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|Q8N9B5|JMY_HUMAN	Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	713-UNIMOD:21,721-UNIMOD:4	0.03	42.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	497-UNIMOD:188,502-UNIMOD:21,507-UNIMOD:4,517-UNIMOD:188,514-UNIMOD:21,508-UNIMOD:21	0.05	41.0	8	2	1
PRT	sp|Q7LBC6-2|KDM3B_HUMAN	Isoform 2 of Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	434-UNIMOD:21,444-UNIMOD:188,451-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	49-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2202-UNIMOD:4,2204-UNIMOD:21,1118-UNIMOD:4,1127-UNIMOD:4	0.02	41.0	2	2	2
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1267-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q08495-3|DEMA_HUMAN	Isoform 3 of Dematin OS=Homo sapiens OX=9606 GN=DMTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	201-UNIMOD:21	0.06	41.0	1	1	0
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	62-UNIMOD:21,66-UNIMOD:21	0.12	41.0	2	1	0
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	453-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	433-UNIMOD:21,429-UNIMOD:267,445-UNIMOD:267	0.03	41.0	3	1	0
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2048-UNIMOD:21	0.01	41.0	3	1	0
PRT	sp|P28370|SMCA1_HUMAN	Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	101-UNIMOD:28,116-UNIMOD:21,115-UNIMOD:188,124-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|P10636-3|TAU_HUMAN	Isoform Tau-A of Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	271-UNIMOD:21,279-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q9NZM4-2|BICRA_HUMAN	Isoform 2 of BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1171-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9P1Z0|ZBTB4_HUMAN	Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	795-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q14160-3|SCRIB_HUMAN	Isoform 3 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	22-UNIMOD:4,33-UNIMOD:267,35-UNIMOD:21,36-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	114-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	373-UNIMOD:188,375-UNIMOD:188,379-UNIMOD:21,387-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	925-UNIMOD:21	0.02	40.0	4	2	1
PRT	sp|Q9UER7-3|DAXX_HUMAN	Isoform 3 of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	589-UNIMOD:4,596-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	695-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	151-UNIMOD:21,155-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	436-UNIMOD:21,438-UNIMOD:188,448-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	297-UNIMOD:21,308-UNIMOD:188,323-UNIMOD:188,326-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q9UHB6-3|LIMA1_HUMAN	Isoform 3 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	302-UNIMOD:21,60-UNIMOD:21,63-UNIMOD:21	0.08	40.0	4	2	0
PRT	sp|Q14186|TFDP1_HUMAN	Transcription factor Dp-1 OS=Homo sapiens OX=9606 GN=TFDP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	23-UNIMOD:21,26-UNIMOD:188,44-UNIMOD:188	0.07	40.0	1	1	1
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	672-UNIMOD:21,673-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q5HYK7|SH319_HUMAN	SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	268-UNIMOD:385,268-UNIMOD:4,275-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	64-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	187-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	202-UNIMOD:21,204-UNIMOD:21,208-UNIMOD:267	0.06	39.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	83-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	17-UNIMOD:188,24-UNIMOD:188,25-UNIMOD:21,35-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	316-UNIMOD:21,327-UNIMOD:4,328-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9P2D0-2|IBTK_HUMAN	Isoform 2 of Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	993-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	575-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	341-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|Q8TF61|FBX41_HUMAN	F-box only protein 41 OS=Homo sapiens OX=9606 GN=FBXO41 PE=2 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	476-UNIMOD:267,478-UNIMOD:21,492-UNIMOD:267	0.02	39.0	3	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.06	39.0	2	1	0
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1279-UNIMOD:21,1287-UNIMOD:4	0.02	39.0	2	1	0
PRT	sp|Q8IUD2-5|RB6I2_HUMAN	Isoform 5 of ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	14-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UMR2-2|DD19B_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	21-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	113-UNIMOD:21,118-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q6PJF5-2|RHDF2_HUMAN	Isoform 2 of Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	296-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	194-UNIMOD:188,203-UNIMOD:21,208-UNIMOD:188,205-UNIMOD:21	0.05	38.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	383-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1268-UNIMOD:21,1280-UNIMOD:267,1213-UNIMOD:188,1222-UNIMOD:21,1226-UNIMOD:188	0.01	38.0	4	2	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	178-UNIMOD:188,179-UNIMOD:188	0.12	38.0	8	1	0
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	62-UNIMOD:188,78-UNIMOD:188,79-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1093-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q92887|MRP2_HUMAN	Canalicular multispecific organic anion transporter 1 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	281-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	225-UNIMOD:21	0.06	38.0	2	1	0
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	17-UNIMOD:21	0.07	38.0	3	1	0
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	347-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P48551|INAR2_HUMAN	Interferon alpha/beta receptor 2 OS=Homo sapiens OX=9606 GN=IFNAR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	400-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	150-UNIMOD:267,155-UNIMOD:21,163-UNIMOD:267,165-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|Q9HCH0-2|NCK5L_HUMAN	Isoform 2 of Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	447-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	149-UNIMOD:21,152-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q8IWS0-2|PHF6_HUMAN	Isoform 2 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	156-UNIMOD:21,158-UNIMOD:188,160-UNIMOD:188	0.09	38.0	3	1	0
PRT	sp|Q0JRZ9|FCHO2_HUMAN	F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	496-UNIMOD:21	0.04	38.0	1	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	85-UNIMOD:28,96-UNIMOD:188,105-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	161-UNIMOD:21,168-UNIMOD:21,160-UNIMOD:267,162-UNIMOD:21,165-UNIMOD:21,167-UNIMOD:267,190-UNIMOD:267	0.05	38.0	2	1	0
PRT	sp|Q7Z5P9|MUC19_HUMAN	Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	2576-UNIMOD:21,2578-UNIMOD:21,2588-UNIMOD:21,2597-UNIMOD:21,2607-UNIMOD:21	0.00	38.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1221-UNIMOD:21,1224-UNIMOD:267,1234-UNIMOD:267	0.01	37.0	1	1	1
PRT	sp|P51397|DAP1_HUMAN	Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	51-UNIMOD:21	0.25	37.0	1	1	1
PRT	sp|Q14689-3|DIP2A_HUMAN	Isoform 3 of Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	94-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	404-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9GZR1-2|SENP6_HUMAN	Isoform 2 of Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	204-UNIMOD:4,214-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8WUX9|CHMP7_HUMAN	Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	417-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	362-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|O60292|SI1L3_HUMAN	Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	175-UNIMOD:21,179-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q8N4S9-2|MALD2_HUMAN	Isoform 2 of MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	161-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	872-UNIMOD:21,874-UNIMOD:21,769-UNIMOD:21	0.05	37.0	2	2	2
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	517-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	129-UNIMOD:21	0.17	37.0	1	1	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1225-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	214-UNIMOD:21,8-UNIMOD:188,14-UNIMOD:188,33-UNIMOD:188	0.04	37.0	2	2	2
PRT	sp|Q9NYB9-3|ABI2_HUMAN	Isoform 3 of Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	191-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	190-UNIMOD:21,156-UNIMOD:21	0.04	37.0	3	2	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	420-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	231-UNIMOD:21,233-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9UKE5-8|TNIK_HUMAN	Isoform 8 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	682-UNIMOD:21,685-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	465-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	498-UNIMOD:21,500-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	113-UNIMOD:21	0.03	37.0	1	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	98-UNIMOD:28,112-UNIMOD:188,113-UNIMOD:21,119-UNIMOD:188,116-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q08495|DEMA_HUMAN	Dematin OS=Homo sapiens OX=9606 GN=DMTN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	226-UNIMOD:21	0.06	37.0	1	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1848-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	23-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	227-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	154-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1318-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|O95251-2|KAT7_HUMAN	Isoform 2 of Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	125-UNIMOD:21,129-UNIMOD:4,140-UNIMOD:4,141-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q96CV9-3|OPTN_HUMAN	Isoform 3 of Optineurin OS=Homo sapiens OX=9606 GN=OPTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	467-UNIMOD:267,468-UNIMOD:21,480-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|Q9Y2R2-6|PTN22_HUMAN	Isoform 6 of Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	287-UNIMOD:21,298-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9NVT9-2|ARMC1_HUMAN	Isoform 2 of Armadillo repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=ARMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	87-UNIMOD:21	0.11	36.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	155-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	199-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|P32121-5|ARRB2_HUMAN	Isoform 5 of Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	394-UNIMOD:4	0.04	36.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1259-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	456-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	89-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q2KJY2-2|KI26B_HUMAN	Isoform 2 of Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	623-UNIMOD:21,640-UNIMOD:267	0.01	36.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	374-UNIMOD:21,375-UNIMOD:267,385-UNIMOD:267,389-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|O75151|PHF2_HUMAN	Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	541-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q14181|DPOA2_HUMAN	DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	141-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1099-UNIMOD:21,1105-UNIMOD:4,1111-UNIMOD:267	0.01	36.0	1	1	1
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	196-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	279-UNIMOD:21,288-UNIMOD:188	0.02	36.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	144-UNIMOD:188,149-UNIMOD:21,152-UNIMOD:21,166-UNIMOD:267	0.01	36.0	1	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	1010-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	930-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	49-UNIMOD:21,53-UNIMOD:21,58-UNIMOD:21,59-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	315-UNIMOD:21,313-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	809-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	136-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	134-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1383-UNIMOD:21,1391-UNIMOD:267,1397-UNIMOD:267,836-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	459-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	747-UNIMOD:21,762-UNIMOD:267	0.02	35.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1861-UNIMOD:4,1863-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	85-UNIMOD:21	0.17	35.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	778-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1247-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	198-UNIMOD:21,204-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	527-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q8NHQ9-2|DDX55_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	151-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|O60930|RNH1_HUMAN	Ribonuclease H1 OS=Homo sapiens OX=9606 GN=RNASEH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	76-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	339-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q8TDN4-2|CABL1_HUMAN	Isoform 2 of CDK5 and ABL1 enzyme substrate 1 OS=Homo sapiens OX=9606 GN=CABLES1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	25-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q8WUQ7|CATIN_HUMAN	Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	489-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	518-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2205-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	122-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q5TAQ9-2|DCAF8_HUMAN	Isoform 2 of DDB1- and CUL4-associated factor 8 OS=Homo sapiens OX=9606 GN=DCAF8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	98-UNIMOD:267,99-UNIMOD:21,115-UNIMOD:267	0.08	35.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	780-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	487-UNIMOD:21,490-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	478-UNIMOD:188,482-UNIMOD:21,489-UNIMOD:188,523-UNIMOD:188	0.06	35.0	1	1	1
PRT	sp|Q99466|NOTC4_HUMAN	Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1895-UNIMOD:21,1897-UNIMOD:4,1898-UNIMOD:267,1901-UNIMOD:21,1910-UNIMOD:21,1912-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|Q96RL1|UIMC1_HUMAN	BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	139-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q6WKZ4|RFIP1_HUMAN	Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	190-UNIMOD:21,196-UNIMOD:21,199-UNIMOD:21,202-UNIMOD:21,206-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	852-UNIMOD:21,862-UNIMOD:188,879-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|A2RU67|F234B_HUMAN	Protein FAM234B OS=Homo sapiens OX=9606 GN=FAM234B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	79-UNIMOD:21	0.07	35.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RQVSASELHTSGILGPETLR	1	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	4-UNIMOD:21	ms_run[2]:scan=17701	83.838	2	2230.1107	2230.1107	R	D	2715	2735
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=29583	151.76880500000001	3	3448.4203	3448.4228	K	L	104	135
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	3	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	9-UNIMOD:267,20-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=23622	116.8	3	3082.5756	3082.5756	K	A	444	473
PSM	RQVSASELHTSGILGPETLR	4	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:267,6-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=17709	83.883	2	2250.1272	2250.1272	R	D	2715	2735
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	5	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	3-UNIMOD:21	ms_run[2]:scan=21990	108.06	3	3613.8254	3613.8254	R	Q	125	162
PSM	FHDTSSPLLISGTSAAELPWAVKPEDK	6	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21,23-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=25510	127.13	3	2987.472	2987.4720	R	A	103	130
PSM	TLSTHSVPNISGATCSAFASPFGCPYSHR	7	sp|P28290|ITPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21,15-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=22845	112.73	3	3188.3845	3188.3845	R	H	864	893
PSM	LLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKPK	8	sp|Q9BW85|YJU2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	5-UNIMOD:21,7-UNIMOD:21,21-UNIMOD:267,33-UNIMOD:188,35-UNIMOD:188	ms_run[1]:scan=25560	127.417955	4	3906.870934	3905.865505	R	R	207	242
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	9	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21	ms_run[2]:scan=15927	73.962	3	2574.2228	2574.2228	K	K	408	434
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	10	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21	ms_run[2]:scan=10478	46.893	3	2671.2239	2671.2239	K	Q	710	737
PSM	SRKGSSGNASEVSVACLTER	11	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=12030	54.461	2	2173.9787	2173.9787	R	I	380	400
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	12	sp|Q9UK58|CCNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	26-UNIMOD:21	ms_run[1]:scan=19348	92.64210666666666	3	2789.363201	2789.374924	K	E	317	345
PSM	NFTKPQDGDVIAPLITPQKK	13	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21	ms_run[2]:scan=16495	76.668	2	2289.177	2289.1770	R	E	507	527
PSM	RSSPSARPPDVPGQQPQAAK	14	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=6361	28.251	2	2153.0379	2153.0379	R	S	81	101
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	15	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22746	112.23504166666667	3	3448.4182	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	16	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=20579	99.79952833333333	3	3448.4194	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	17	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21634	105.944125	3	3448.4191	3448.4228	K	L	104	135
PSM	VRSPDEALPGGLSGCSSGSGHSPYALER	18	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	2-UNIMOD:267,3-UNIMOD:21,15-UNIMOD:4,28-UNIMOD:267	ms_run[1]:scan=16486	76.59332833333333	3	2943.315874	2942.313289	R	A	774	802
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	19	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=15752	72.955	3	2574.2228	2574.2228	K	K	408	434
PSM	GRASSHSSQTQGGGSVTK	20	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=736	5.2373	2	1810.7959	1810.7959	R	K	400	418
PSM	KEELGASSPSYGPPNLGFVDSPSSGTHLGGLELK	21	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=24951	124	3	3506.6607	3506.6607	K	T	2289	2323
PSM	RASNEKESAAPASPAPSPAPSPTPAPPQK	22	sp|Q3KQU3-3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=7968	35.775	3	2917.3971	2917.3971	R	E	78	107
PSM	RSNSAPLIHGLSDTSPVFQAEAPSAR	23	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,4-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=20852	101.33	3	2807.3507	2807.3507	R	R	34	60
PSM	SLGNILQAKPTSSPAKGPPQK	24	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=12638	57.429	2	2198.146	2198.1460	K	A	494	515
PSM	KFTVHSPDASSGTNSNGITNPCIR	25	sp|Q6PGQ7|BORA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=12900	58.80759833333333	3	2640.160436	2639.179930	R	S	294	318
PSM	GLRDSHSSEEDEASSQTDLSQTISKK	26	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=11479	51.766	3	2994.2493	2994.2493	R	T	150	176
PSM	KFSKEEPVSSGPEEAVGK	27	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=8528	38.285	2	1983.9191	1983.9191	R	S	561	579
PSM	KKLGAGEGGEASVSPEK	28	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=3044	13.357	2	1722.8189	1722.8189	K	T	1288	1305
PSM	KLSVPTSDEEDEVPAPKPR	29	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=12512	56.877	2	2173.0304	2173.0304	K	G	103	122
PSM	KLSVPTSDEEDEVPAPKPR	30	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21	ms_run[2]:scan=12727	57.897	2	2173.0304	2173.0304	K	G	103	122
PSM	SKDEEEDEESDDADDTPILKPVSLLR	31	sp|Q92794|KAT6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=22894	112.99	3	3024.3336	3024.3336	K	K	1104	1130
PSM	SVKHDSIPAADTFEDLSDVEGGGSEPTQR	32	sp|O95671-3|ASML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=18642	89.055	3	3123.367	3123.3670	R	D	165	194
PSM	TLSTHSVPNISGATCSAFASPFGCPYSHR	33	sp|P28290|ITPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,15-UNIMOD:4,24-UNIMOD:4,29-UNIMOD:267	ms_run[2]:scan=22921	113.14	3	3198.3928	3198.3928	R	H	864	893
PSM	VLSPLRSPPLIGSESAYESFLSADDKASGR	34	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21	ms_run[2]:scan=27455	138.41	3	3228.5704	3228.5704	K	G	1394	1424
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	35	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21828	107.043175	3	3448.4187	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	36	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23803	117.75872833333334	3	3448.4191	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	37	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21198	103.43453833333334	3	3448.4186	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	38	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=20931	101.762795	3	3448.4201	3448.4228	K	L	104	135
PSM	AVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGR	39	sp|P29590-4|PML_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	3-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=22945	113.26058	4	4099.838786	4098.839141	K	E	516	555
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	40	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,37-UNIMOD:267	ms_run[2]:scan=21818	107	3	3623.8336	3623.8336	R	Q	125	162
PSM	GAQPGRHSVTGYGDCAVGAR	41	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:267,8-UNIMOD:21,15-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=7349	32.908	2	2114.922	2114.9220	R	Y	256	276
PSM	HLFSSTENLAAGSWKEPAEGGGLSSDR	42	sp|Q6WKZ4-2|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=20159	97.248	2	2882.2872	2882.2872	K	Q	205	232
PSM	KKPGDASSLPDAGLSPGSQVDSK	43	sp|Q13459-2|MYO9B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=11526	51.972	2	2320.0948	2320.0948	K	S	1391	1414
PSM	KPKVEEESTGDPFGFDSDDESLPVSSK	44	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=19344	92.617	3	3005.3067	3005.3067	K	N	61	88
PSM	KSPSGPVKSPPLSPVGTTPVK	45	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,2-UNIMOD:21,8-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=11876	53.604	2	2157.1945	2157.1945	R	L	177	198
PSM	RKVTGTEGSSSTLVDYTSTSSTGGSPVR	46	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	25-UNIMOD:21	ms_run[2]:scan=11485	51.787	3	2896.3451	2896.3451	R	K	1219	1247
PSM	SDSVLPASHGHLPQAGSLER	47	sp|Q8N4C8-5|MINK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=14224	65.336	2	2136.9953	2136.9953	R	N	690	710
PSM	SGPKPFSAPKPQTSPSPK	48	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=8190	36.779	2	1996.9061	1996.9061	R	R	294	312
PSM	SLLSHEFQDETDTEEETLYSSKH	49	sp|O75976-2|CBPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=18874	90.313	3	2810.1903	2810.1903	K	-	1111	1134
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	50	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=11896	53.698	3	3112.5078	3112.5078	R	S	818	847
PSM	TAHNSEADLEESFNEHELEPSSPKSK	51	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:21	ms_run[2]:scan=15447	71.335	2	2991.2771	2991.2771	K	K	100	126
PSM	TRKSPSSDSWTCADTSTER	52	sp|Q8N6T3-4|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=6993	31.304	2	2250.9213	2250.9213	K	R	227	246
PSM	VKAQTPPGPSLSGSKSPCPQEK	53	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7732	34.663	3	2439.0906	2439.0906	K	S	999	1021
PSM	VNHEPEPAGGATPGATLPKSPSQLR	54	sp|O00499-6|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:21	ms_run[2]:scan=12888	58.752	3	2590.2541	2590.2541	R	K	281	306
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	55	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=29828	153.08135333333334	3	3448.4203	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	56	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=20397	98.78623333333334	3	3448.4192	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	57	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=24347	120.68316000000002	3	3450.4242	3448.4232	K	L	104	135
PSM	HVEVSQAPLPPAPAYLSSPLALPSQR	58	sp|Q9Y6K9|NEMO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	18-UNIMOD:21	ms_run[1]:scan=23746	117.47744499999999	3	2805.429204	2804.426232	R	R	360	386
PSM	KGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGR	59	sp|Q8N9B5|JMY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=22447	110.71175666666666	4	3672.700481	3672.697851	R	V	709	742
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	60	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=15868	73.66	2	2574.2228	2574.2228	K	K	408	434
PSM	HIKEEPLSEEEPCTSTAIASPEK	61	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=13160	60.054	3	2673.2284	2673.2284	K	K	495	518
PSM	HSGGFLSSPADFSQENKAPFEAVK	62	sp|Q7LBC6-2|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,17-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=21230	103.64	3	2641.2253	2641.2253	R	R	428	452
PSM	KAPLNIPGTPVLEDFPQNDDEKER	63	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=21409	104.69	3	2801.3273	2801.3273	R	L	41	65
PSM	KEEEEEEEEYDEGSNLKK	64	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6371	28.289	3	2212.9495	2212.9495	K	Q	230	248
PSM	KLQELSSKADEASELACPTPK	65	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=13207	60.31	3	2381.1186	2381.1186	R	E	2186	2207
PSM	KNQKPSQVNGAPGSPTEPAGQK	66	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=2858	12.574	2	2299.0958	2299.0958	K	Q	1254	1276
PSM	LLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKPK	67	sp|Q9BW85|YJU2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=25172	125.23	4	3883.817	3883.8170	R	R	207	242
PSM	RGAEEEEEEEDDDSGEEMKALR	68	sp|Q08495-3|DEMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=9798	43.921	3	2632.012	2632.0120	R	E	188	210
PSM	RIDFTPVSPAPSPTRGFGK	69	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=17772	84.227	2	2189.0072	2189.0072	K	M	55	74
PSM	RSNSAPLIHGLSDTSPVFQAEAPSAR	70	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=20763	100.8	3	2787.3341	2787.3341	R	R	34	60
PSM	RTGGPAYGPSSDVSTASETESEKR	71	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=7263	32.546	3	2548.1079	2548.1079	R	E	437	461
PSM	RVPLSPLSLLAGPADAR	72	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=27196	136.88	2	1811.9659	1811.9659	R	R	429	446
PSM	SHVSSEPYEPISPPQVPVVHEK	73	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=17618	83.317	2	2521.189	2521.1890	R	Q	2037	2059
PSM	TLSTHSVPNISGATCSAFASPFGCPYSHR	74	sp|P28290|ITPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,15-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=23077	113.94	3	3188.3845	3188.3845	R	H	864	893
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	75	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21437	104.83044666666667	3	3450.4242	3448.4232	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	76	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23156	114.364995	3	3448.4187	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	77	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22189	109.23393666666666	3	3448.4177	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	78	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=25156	125.13125	3	3448.4187	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	79	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=24053	119.09111833333334	3	3448.4197	3448.4228	K	L	104	135
PSM	QTELFAHFIQPSAQKSPTSPLNMK	80	sp|P28370|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=28093	142.38372333333334	3	2762.3129	2762.3134	K	L	101	125
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	81	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=22167	109.1	3	3613.8254	3613.8254	R	Q	125	162
PSM	AKTDHGAEIVYKSPVVSGDTSPR	82	sp|P10636-3|TAU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=9802	43.938	3	2573.1564	2573.1564	K	H	259	282
PSM	ARGGSPAPLPAKVDEATSGLIR	83	sp|Q9NZM4-2|BICRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=18605	88.865	3	2242.1471	2242.1471	R	E	1167	1189
PSM	HAAERPGGTPTPVIAYSK	84	sp|Q9P1Z0|ZBTB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=9158	41.05	2	1930.9302	1930.9302	R	G	787	805
PSM	HCSLQAVPEEIYRYSR	85	sp|Q14160-3|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,13-UNIMOD:267,15-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=16319	75.874	2	2106.9461	2106.9461	R	S	21	37
PSM	HIKEEPLSEEEPCTSTAIASPEK	86	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=12258	55.63	2	2661.1881	2661.1881	K	K	495	518
PSM	HIKEEPLSEEEPCTSTAIASPEK	87	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12940	58.989	2	2661.1881	2661.1881	K	K	495	518
PSM	HIKEEPLSEEEPCTSTAIASPEK	88	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=12941	58.991	2	2673.2284	2673.2284	K	K	495	518
PSM	HTGPNSPDTANDGFVR	89	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=7345	32.885	2	1693.7684	1693.7684	K	L	99	115
PSM	IKEKGSFSDTGLGDGK	90	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,4-UNIMOD:188,8-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=8138	36.554	2	1735.8528	1735.8528	K	M	372	388
PSM	KAEQGSEEEGEGEEEEEEGGESKADDPYAHLSK	91	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=10589	47.367	4	3658.4592	3658.4592	K	K	223	256
PSM	KGGEFDEFVNDDTDDDLPISKK	92	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=19391	92.892	3	2563.1003	2563.1003	K	K	913	935
PSM	KICTLPSPPSPLASLAPVADSSTR	93	sp|Q9UER7-3|DAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=23727	117.38	3	2544.2659	2544.2659	K	V	587	611
PSM	KKIPDPDSDDVSEVDAR	94	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=9086	40.766	2	1964.8728	1964.8728	K	H	688	705
PSM	LEISPDSSPERAHYTHSDYQYSQR	95	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=12634	57.413	3	3025.2281	3025.2281	R	S	148	172
PSM	NRVGVSSKPDSSPVLSPGNK	96	sp|Q8N4C8-5|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=7582	33.976	2	2104.0314	2104.0314	R	A	710	730
PSM	NVAEALGHSPKDPGGGGGPVR	97	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=9340	41.858	2	2050.9586	2050.9586	K	A	428	449
PSM	RSSPSARPPDVPGQQPQAAK	98	sp|Q96JP5-2|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=6156	27.247	2	2153.0379	2153.0379	R	S	81	101
PSM	SHVSSEPYEPISPPQVPVVHEK	99	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=17682	83.729	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLGNILQAKPTSSPAKGPPQK	100	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=12821	58.44	2	2198.146	2198.1460	K	A	494	515
PSM	SPQGQLDTSESKPDSFFLEPLMPAVLKPAK	101	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,12-UNIMOD:188,27-UNIMOD:188,30-UNIMOD:188	ms_run[2]:scan=29690	152.38	3	3354.6957	3354.6957	R	E	297	327
PSM	SRPFTVAASFQSTSVKSPK	102	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=14349	65.99	2	2104.0354	2104.0354	R	T	286	305
PSM	VFIDQNLSPGKGVVSLVAVHPSTVNPLGK	103	sp|Q14186|TFDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,11-UNIMOD:188,29-UNIMOD:188	ms_run[2]:scan=26504	132.85	3	3063.6561	3063.6561	K	Q	16	45
PSM	VLSPLRSPPLIGSESAYESFLSADDKASGR	104	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=27264	137.29	3	3228.5704	3228.5704	K	G	1394	1424
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	105	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=25624	127.782075	3	3449.4222	3448.4232	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	106	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=29412	150.75437166666666	3	3448.4203	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	107	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22960	113.33879833333334	3	3449.4232	3448.4232	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	108	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23589	116.64103333333333	3	3448.4192	3448.4228	K	L	104	135
PSM	KQFKDLFDLNSSEEDDTEGFSER	109	sp|Q9Y3T9|NOC2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=24813	123.26857333333334	3	2896.154503	2895.152511	R	G	662	685
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	110	sp|Q5HYK7|SH319_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=22271	109.71515166666666	3	3065.4157	3065.4200	K	L	268	296
PSM	LPSVEEAEVPKPLPPASKDEDEDIQSILR	111	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=23881	118.17241666666668	4	3280.610446	3280.611586	R	T	62	91
PSM	DKRPLSGPDVGTPQPAGLASGAK	112	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=13356	61.028	2	2298.1369	2298.1369	R	L	176	199
PSM	HIKEEPLSEEEPCTSTAIASPEK	113	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=12192	55.314	3	2661.1881	2661.1881	K	K	495	518
PSM	IADPEHDHTGFLTEYVATR	114	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=16306	75.819	2	2250.9947	2250.9947	R	W	190	209
PSM	IDASKNEEDEGHSNSSPR	115	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=1203	6.5517	2	2050.8229	2050.8229	K	H	68	86
PSM	ILKPGSTALKTPTAVVAPVEK	116	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,10-UNIMOD:188,11-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=15130	69.782	3	2217.2884	2217.2884	K	T	15	36
PSM	KFSKEEPVSSGPEEAVGK	117	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,4-UNIMOD:188,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=8337	37.361	2	2001.9794	2001.9794	R	S	561	579
PSM	KHSEEAEFTPPLKCSPK	118	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=11324	51.052	2	2143.9051	2143.9051	R	R	314	331
PSM	KRSDSSGGYNLSDIIQSPSSTGLLK	119	sp|Q9P2D0-2|IBTK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=23767	117.59	3	2689.296	2689.2960	R	S	988	1013
PSM	LIEGVHPGSLVEKLPDSPALAK	120	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=19811	95.15	2	2349.2345	2349.2345	R	K	559	581
PSM	LKTEKEPDATPPSPR	121	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=4228	18.506	2	1744.8397	1744.8397	K	T	329	344
PSM	LKTEKEPDATPPSPR	122	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=4681	20.539	2	1744.8397	1744.8397	K	T	329	344
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	123	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=23588	116.64	3	3062.559	3062.5590	K	A	444	473
PSM	RHSTEGEEGDVSDVGSR	124	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,3-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=3544	15.541	2	1915.7812	1915.7812	R	T	476	493
PSM	RIDFTPVSPAPSPTRGFGK	125	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=17952	85.242	2	2189.0072	2189.0072	K	M	55	74
PSM	RQVSASELHTSGILGPETLR	126	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=17656	83.56	3	2230.1107	2230.1107	R	D	2715	2735
PSM	SALEDKERDEDDEDGDGDGDGATGK	127	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3467	15.187	3	2595.0328	2595.0328	R	K	74	99
PSM	SALEDKERDEDDEDGDGDGDGATGK	128	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3714	16.206	3	2595.0328	2595.0328	R	K	74	99
PSM	SEVQQPVHPKPLSPDSR	129	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=7943	35.65	2	1979.9466	1979.9466	K	A	48	65
PSM	SFSKEELMSSDLEETAGSTSIPKR	130	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=18307	87.22	3	2708.2252	2708.2252	K	K	511	535
PSM	SRGWGQQDGPGPPSPGQSPSPCR	131	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=11111	50.026	2	2471.0438	2471.0438	R	T	1266	1289
PSM	SVGKVEPSSQSPGRSPR	132	sp|Q8IUD2-5|RB6I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=2294	10.315	2	1833.8734	1833.8734	R	L	7	24
PSM	THTTALAGRSPSPASGR	133	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3116	13.689	2	1825.7873	1825.7873	K	R	286	303
PSM	TNANAEKTDEEEKEDR	134	sp|Q9UMR2-2|DD19B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=968	5.8775	2	1877.8239	1877.8239	K	A	41	57
PSM	VAHEPVAPPEDKESESEAKVDGETASDSESR	135	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=8999	40.43	4	3361.4471	3361.4471	R	A	8	39
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	136	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23371	115.49862666666667	3	3448.4156	3448.4228	K	L	104	135
PSM	QTELFAHFIQPSAQKSPTSPLNMK	137	sp|P28370|SMCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,15-UNIMOD:188,16-UNIMOD:21,24-UNIMOD:188	ms_run[1]:scan=28084	142.335265	3	2774.3525	2774.3536	K	L	101	125
PSM	RVPLSPLSLLAGPADAR	138	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:267,5-UNIMOD:21,17-UNIMOD:267	ms_run[1]:scan=27028	135.86283	2	1831.982874	1831.982423	R	R	429	446
PSM	RVPLSPLSLLAGPADAR	139	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:267,5-UNIMOD:21,17-UNIMOD:267	ms_run[1]:scan=27210	136.96189833333335	2	1831.982874	1831.982423	R	R	429	446
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	140	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=21824	107.03	3	3613.8254	3613.8254	R	Q	125	162
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	141	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	26-UNIMOD:21	ms_run[2]:scan=7494	33.545	3	2864.2839	2864.2839	R	G	88	119
PSM	GIPHSASPVSPDGVQIPLKEYGR	142	sp|Q6PJF5-2|RHDF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=18447	88.034	3	2483.221	2483.2210	R	A	290	313
PSM	GQEHKYLLGDAPVSPSSQK	143	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=11736	52.922	2	2132.0342	2132.0342	R	L	190	209
PSM	GRAEGEWEDQEALDYFSDKESGK	144	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=19077	91.269	3	2725.1181	2725.1181	K	Q	367	390
PSM	HGSFHEDEDPIGSPR	145	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=9115	40.883	2	1768.7082	1768.7082	R	L	1266	1281
PSM	HIKEEPLSEEEPCTSTAIASPEK	146	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12919	58.903	3	2661.1881	2661.1881	K	K	495	518
PSM	HIKEEPLSEEEPCTSTAIASPEK	147	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:188,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=12243	55.559	2	2673.2284	2673.2284	K	K	495	518
PSM	KEELGASSPSYGPPNLGFVDSPSSGTHLGGLELK	148	sp|O14686|KMT2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,8-UNIMOD:21,34-UNIMOD:188	ms_run[2]:scan=24966	124.09	3	3518.7009	3518.7009	K	T	2289	2323
PSM	KFSKEEPVSSGPEEAVGK	149	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=8315	37.276	2	1983.9191	1983.9191	R	S	561	579
PSM	KKVEEEDEEEEEEEEEEEEEEDE	150	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9101	40.829	3	2926.0895	2926.0895	R	-	178	201
PSM	KKVEEEDEEEEEEEEEEEEEEDE	151	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14800	68.172	3	2926.0895	2926.0895	R	-	178	201
PSM	KPEEEEEEELEETAQEKK	152	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10960	49.254	3	2221.062	2221.0620	R	L	62	80
PSM	KPYRIESDEEEDFENVGK	153	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=14943	68.775	2	2262.9682	2262.9682	K	V	1087	1105
PSM	LPGLNKNQSQSQDALVLEDVEKK	154	sp|Q92887|MRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=18926	90.572	3	2632.3109	2632.3109	R	K	273	296
PSM	NLEELEEKSTTPPPAEPVSLPQEPPKPR	155	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=17924	85.118	3	3188.5642	3188.5642	K	V	217	245
PSM	NRTPSDVKELVLDNSR	156	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=15474	71.458	2	1921.9259	1921.9259	R	S	13	29
PSM	RKGSQITQQSTNQSR	157	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=1149	6.4063	2	1797.8483	1797.8483	R	N	344	359
PSM	RKSPLQDPFPEEDYSSTEGSGGR	158	sp|P48551|INAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=14610	67.295	3	2618.1286	2618.1286	R	I	398	421
PSM	RPDPDSDEDEDYERER	159	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,6-UNIMOD:21,14-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=5191	22.726	2	2131.811	2131.8110	R	R	150	166
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	160	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=15932	73.995	3	3044.4006	3044.4006	K	H	346	374
PSM	SDSVLPASHGHLPQAGSLER	161	sp|Q8N4C8-5|MINK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=14218	65.308	2	2147.0036	2147.0036	R	N	690	710
PSM	SKLQIGPPSPGEAQGPLLPSPAR	162	sp|Q9HCH0-2|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:21	ms_run[2]:scan=19463	93.263	3	2376.2203	2376.2203	K	G	428	451
PSM	SLGNILQAKPTSSPAKGPPQK	163	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:188,13-UNIMOD:21,16-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=12966	59.104	2	2216.2064	2216.2064	K	A	494	515
PSM	SLTGKLEPVSPPSPPHTDPELELVPPR	164	sp|Q9Y618-5|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=23463	115.96	3	3048.461	3048.4610	R	L	140	167
PSM	SLVHEVGKPPQDVTDDSPPSK	165	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:188,17-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=10766	48.118	3	2323.1136	2323.1136	R	K	1206	1227
PSM	TAHNSEAADLEESFNEHELEPSSPKSK	166	sp|Q8IWS0-2|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:21,25-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=16908	79.342	3	3074.3545	3074.3545	K	K	134	161
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	167	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=26454	132.58223833333332	3	3448.4196	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	168	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=27777	140.42667833333334	3	3449.4222	3448.4232	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	169	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=25416	126.60497	3	3449.4222	3448.4232	K	L	104	135
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	170	sp|Q0JRZ9|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	20-UNIMOD:21	ms_run[1]:scan=23395	115.62632166666666	3	3062.567593	3062.559037	K	A	477	506
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	171	sp|Q9UK58|CCNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	26-UNIMOD:21	ms_run[1]:scan=19282	92.28954333333334	3	2789.363201	2789.374924	K	E	317	345
PSM	QLFHPEQLITGKEDAANNYAR	172	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=21969	107.95270833333332	3	2397.1705	2397.1708	R	G	85	106
PSM	SPLRTSLASLRSEQSNGSVLHDAAAAADSPAGTR	173	sp|Q9HDC5|JPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=20668	100.28985833333334	4	3553.621011	3552.635934	R	G	157	191
PSM	SETTGLSGLTGTSGQLAGVTGTSSKSAGVTVTSEK	174	sp|Q7Z5P9|MUC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21,3-UNIMOD:21,13-UNIMOD:21,22-UNIMOD:21,32-UNIMOD:21	ms_run[1]:scan=10254	45.926111666666664	3	3658.456091	3655.463444	R	S	2576	2611
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	175	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:267,9-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=15795	73.232	3	2594.2393	2594.2393	K	K	408	434
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	176	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	26-UNIMOD:21,31-UNIMOD:267	ms_run[2]:scan=7715	34.574	3	2874.2921	2874.2921	R	G	88	119
PSM	AVHSPIRSQPVTLPEAR	177	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,7-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=11668	52.58	2	1957.0049	1957.0049	K	T	1218	1235
PSM	DKDDQEWESPSPPKPTVFISGVIAR	178	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=25415	126.6	3	2877.3586	2877.3586	K	G	41	66
PSM	FRSDVHTEAVQAALAK	179	sp|Q14689-3|DIP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=12788	58.267	2	1821.8775	1821.8775	R	Y	92	108
PSM	GMKDDKEEEEDGTGSPQLNNR	180	sp|P49407-2|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=4562	19.981	3	2427.985	2427.9850	K	-	390	411
PSM	HCSTYQPTPPLSPASKK	181	sp|Q9GZR1-2|SENP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=7601	34.069	2	1977.902	1977.9020	R	C	203	220
PSM	HFTNSVPNPRISDAELEAELEK	182	sp|Q8WUX9|CHMP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=20619	100.03	3	2575.1956	2575.1956	R	L	406	428
PSM	HKAAAYDISEDEED	183	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=8640	38.767	2	1671.6301	1671.6301	R	-	354	368
PSM	HRSSSEITLSECDAEDAGEPR	184	sp|O60292|SI1L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=11408	51.472	2	2424.9853	2424.9853	R	G	168	189
PSM	KEADAVFPRDPYGSLDR	185	sp|Q8N4S9-2|MALD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=16057	74.646	2	2014.915	2014.9150	R	H	148	165
PSM	KETESEAEDNLDDLEKHLR	186	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=21111	102.9	3	2429.9989	2429.9989	K	E	870	889
PSM	KKPGDASSLPDAGLSPGSQVDSK	187	sp|Q13459-2|MYO9B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=11472	51.742	3	2320.0948	2320.0948	K	S	1391	1414
PSM	KKVEEEDEEEEEEEEEEEEEEDE	188	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8876	39.876	2	2926.0895	2926.0895	R	-	178	201
PSM	KKVEEEDEEEEEEEEEEEEEEDE	189	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9335	41.839	3	2926.0895	2926.0895	R	-	178	201
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	190	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=16757	78.419	3	2662.3156	2662.3156	K	K	763	788
PSM	KPRPSEGDEDCLPASK	191	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4193	18.373	2	1864.8026	1864.8026	K	K	247	263
PSM	LIEGVHPGSLVEKLPDSPALAK	192	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=19762	94.865	3	2349.2345	2349.2345	R	K	559	581
PSM	LKAEPAAPPAAPSTPAPPPAVPK	193	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=12516	56.895	3	2254.1763	2254.1763	R	E	504	527
PSM	LLEDSDSEDEAAPSPLQPALRPNPTAILDEAPKPK	194	sp|Q9BW85|YJU2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=25353	126.24	4	3883.817	3883.8170	R	R	207	242
PSM	LLKEGEEPTVYSDEEEPKDESAR	195	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=11333	51.094	3	2729.1957	2729.1957	K	K	118	141
PSM	NFVFHTLSPVKAEAAK	196	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=17105	80.457	2	1837.9128	1837.9128	R	E	1218	1234
PSM	NKPGPNIESGNEDDDASFKIK	197	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=12811	58.389	2	2354.0427	2354.0427	K	T	206	227
PSM	NRTPSDVKELVLDNSR	198	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=14559	67.046	2	1921.9259	1921.9259	R	S	13	29
PSM	NRTYSSSGSSGGSHPSSR	199	sp|Q9NYB9-3|ABI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=863	5.5992	2	1889.7653	1889.7653	R	S	187	205
PSM	RKELSQNTDESGLNDEAIAK	200	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=9659	43.238	3	2297.0536	2297.0536	K	Q	186	206
PSM	RKPSVPDSASPADDSFVDPGER	201	sp|P16333-2|NCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=13486	61.682	3	2408.0645	2408.0645	K	L	18	40
PSM	RLASTSDIEEKENR	202	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21	ms_run[2]:scan=5969	26.371	2	1726.7887	1726.7887	R	D	417	431
PSM	RSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYK	203	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=25504	127.11	3	3653.6593	3653.6593	R	Q	228	263
PSM	SKKGGEFDEFVNDDTDDDLPISK	204	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=19565	93.775	2	2650.1324	2650.1324	R	K	911	934
PSM	SLVHEVGKPPQDVTDDSPPSK	205	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=10668	47.714	3	2311.0733	2311.0733	R	K	1206	1227
PSM	TRKSPSSDSWTCADTSTER	206	sp|Q8N6T3-4|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=6967	31.186	3	2250.9213	2250.9213	K	R	227	246
PSM	VRANSKSEGSPVLPHEPAK	207	sp|Q9UKE5-8|TNIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6637	29.534	2	2161.9922	2161.9922	R	V	676	695
PSM	WLNSGRGDEASEEGQNGSSPKSK	208	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:21	ms_run[2]:scan=5835	25.793	2	2499.0663	2499.0663	R	T	447	470
PSM	YRQRSPSPAPAPAPAAAAGPPTR	209	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=7303	32.696	3	2446.1308	2446.1308	R	K	494	517
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	210	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=25848	129.03174666666666	3	3450.4212	3448.4232	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	211	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=26047	130.207685	3	3448.4188	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	212	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=26531	133.00702333333334	3	3450.4262	3448.4232	K	L	104	135
PSM	SKKGGEFDEFVNDDTDDDLPISK	213	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:21	ms_run[1]:scan=20169	97.31925	3	2651.116619	2650.132354	R	K	911	934
PSM	SKGPSAAGEQEPDKESGASVDEVAR	214	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=7075	31.687134999999998	3	2501.173238	2500.167754	K	Q	45	70
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	215	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	26-UNIMOD:21	ms_run[1]:scan=7934	35.61141666666667	3	2864.282455	2864.283877	R	G	88	119
PSM	QTELFAHFIQPAAQKTPTSPLK	216	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,15-UNIMOD:188,16-UNIMOD:21,22-UNIMOD:188	ms_run[1]:scan=27112	136.35370166666667	3	2527.2925	2527.2910	K	M	98	120
PSM	RGAEEEEEEEDDDSGEEMKALR	217	sp|Q08495|DEMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=9774	43.805815	3	2632.010147	2632.011980	R	E	213	235
PSM	ASPGHSPHYFAASSPTSPNALPPAR	218	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=13585	62.2	3	2596.186	2596.1860	R	K	1847	1872
PSM	DLHQPSLSPASPHSQGFER	219	sp|Q9BZF1-3|OSBL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=12977	59.15	2	2168.964	2168.9640	K	G	16	35
PSM	ELEKPIQSKPQSPVIQAAAVSPK	220	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:21	ms_run[2]:scan=13167	60.093	3	2524.3302	2524.3302	R	F	207	230
PSM	FSGFSAKPNNSGEAPSSPTPKR	221	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=8991	40.396	3	2342.0692	2342.0692	K	S	139	161
PSM	GQEHKYLLGDAPVSPSSQK	222	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=11733	52.901	2	2119.9939	2119.9939	R	L	190	209
PSM	GYTSDSEVYTDHGRPGK	223	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=8266	37.086	2	1947.8	1947.8000	R	I	1315	1332
PSM	HFSISGCPLYHNLSADECK	224	sp|O95251-2|KAT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,7-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=19483	93.369	3	2319.9749	2319.9749	R	A	123	142
PSM	HFSISGCPLYHNLSADECK	225	sp|O95251-2|KAT7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,7-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=19500	93.455	3	2313.9548	2313.9548	R	A	123	142
PSM	HGARTSDSDQQAYLVQR	226	sp|Q96CV9-3|OPTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:267,5-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=6953	31.101	2	2030.9074	2030.9074	R	G	464	481
PSM	HQSLDLGSLLFEGCSNSKPVNAAGR	227	sp|Q9Y2R2-6|PTN22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=24448	121.25	3	2736.2691	2736.2691	K	Y	285	310
PSM	HTGPNSPDTANDGFVR	228	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=7327	32.805	2	1683.7601	1683.7601	K	L	99	115
PSM	IRSDLKAEALASAIASTK	229	sp|Q9NVT9-2|ARMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=19198	91.841	3	1924.0031	1924.0031	R	V	85	103
PSM	KKVEEEDEEEEEEEEEEEEEEDE	230	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12414	56.374	3	2926.0895	2926.0895	R	-	178	201
PSM	KKVEEEDEEEEEEEEEEEEEEDE	231	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:188,2-UNIMOD:188	ms_run[2]:scan=8905	40	2	2938.1297	2938.1297	R	-	178	201
PSM	KPLTSSSAAPQRPISTQR	232	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=6298	27.943	2	2004.0154	2004.0154	K	T	151	169
PSM	KSFSKEELMSSDLEETAGSTSIPK	233	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:21	ms_run[2]:scan=18435	87.982	3	2680.2191	2680.2191	K	R	510	534
PSM	KTCTTVAFTQVNSEDKGALAK	234	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:4	ms_run[2]:scan=11644	52.476	3	2268.142	2268.1420	R	L	197	218
PSM	LKGMKDDDYDDQLC	235	sp|P32121-5|ARRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=10317	46.168	2	1714.7178	1714.7178	R	-	381	395
PSM	NKPLSPIKLTPTSVLDYFGTGSVQR	236	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=29546	151.56	3	2797.4415	2797.4415	K	S	152	177
PSM	NLEELEEKSTTPPPAEPVSLPQEPPKPR	237	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=17578	83.096	3	3188.5642	3188.5642	K	V	217	245
PSM	RGHTASESDEQQWPEEK	238	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=6355	28.223	2	2092.8487	2092.8487	K	R	1252	1269
PSM	RHTSAEEEEPPPVK	239	sp|Q9BZ95-3|NSD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=2912	12.819	2	1684.7458	1684.7458	R	I	454	468
PSM	RRSTDSSSVSGSLQQETK	240	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=5553	24.373	2	2031.9222	2031.9222	K	Y	87	105
PSM	SEVQQPVHPKPLSPDSR	241	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=7726	34.621	2	1979.9466	1979.9466	K	A	48	65
PSM	SHSPVPAAAPAHSPSPASPR	242	sp|Q2KJY2-2|KI26B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=5922	26.184	2	2009.9348	2009.9348	R	S	621	641
PSM	SKDEEEDEESDDADDTPILKPVSLLR	243	sp|Q92794|KAT6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=22686	111.96	3	3024.3336	3024.3336	K	K	1104	1130
PSM	SKKGGEFDEFVNDDTDDDLPISK	244	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=19520	93.553	3	2650.1324	2650.1324	R	K	911	934
PSM	SLTGKLEPVSPPSPPHTDPELELVPPR	245	sp|Q9Y618-5|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=23265	114.94	3	3048.461	3048.4610	R	L	140	167
PSM	SLVHEVGKPPQDVTDDSPPSK	246	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=10426	46.653	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SRDDLYDQDDSRDFPR	247	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,2-UNIMOD:267,12-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=12779	58.218	2	2108.8579	2108.8579	R	S	374	390
PSM	SRESASPTIPNLDLLEAHTK	248	sp|O75151|PHF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=20892	101.56	3	2258.0944	2258.0944	K	E	534	554
PSM	SRESASPTIPNLDLLEAHTK	249	sp|O75151|PHF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=21054	102.57	3	2258.0944	2258.0944	K	E	534	554
PSM	SRGWGQQDGPGPPSPGQSPSPCR	250	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=11036	49.664	3	2471.0438	2471.0438	R	T	1266	1289
PSM	SRPFTVAASFQSTSVKSPK	251	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:21	ms_run[2]:scan=14284	65.65	3	2104.0354	2104.0354	R	T	286	305
PSM	SVSTRSPHQLLSPSSFSPSATPSQK	252	sp|Q14181|DPOA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=16236	75.512	3	2692.2858	2692.2858	R	Y	136	161
PSM	TAHNSEAADLEESFNEHELEPSSPKSK	253	sp|Q8IWS0-2|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:21	ms_run[2]:scan=16975	79.728	3	3062.3142	3062.3142	K	K	134	161
PSM	THSFENVSCHLPDSR	254	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=11635	52.439	2	1874.7646	1874.7646	R	T	1097	1112
PSM	TKPIVKPQTSPEYGQGINPISR	255	sp|O95793-2|STAU1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=13579	62.171	2	2489.2679	2489.2679	K	L	188	210
PSM	TSSIHQLIAPASYSPIQPHSLIK	256	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=21302	104.06	3	2573.335	2573.3350	R	H	266	289
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	257	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=26221	131.22185333333334	3	3448.4196	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	258	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=19939	95.867215	3	3448.4188	3448.4228	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	259	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21988	108.04863999999999	3	3448.4172	3448.4228	K	L	104	135
PSM	QTELFAHFIQPAAQKTPTSPLK	260	sp|O60264|SMCA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=26902	135.11508666666666	3	2515.2518	2515.2507	K	M	98	120
PSM	SLTGKLEPVSPPSPPHTDPELELVPPR	261	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:188,10-UNIMOD:21,13-UNIMOD:21,27-UNIMOD:267	ms_run[1]:scan=23189	114.539445	3	3064.479792	3064.489434	R	L	140	167
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	262	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	22-UNIMOD:21	ms_run[1]:scan=21815	106.98272	3	2619.359461	2618.362175	R	S	989	1017
PSM	GPGAPASPSASHPQGLDTTPKPH	263	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21	ms_run[1]:scan=7606	34.094895	3	2286.041978	2286.043025	R	-	924	947
PSM	ISSSKGSLGGGFSSGGFSGGSFSR	264	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21,18-UNIMOD:21,23-UNIMOD:21,24-UNIMOD:267	ms_run[1]:scan=23881	118.17241666666668	3	2461.960767	2458.947236	R	G	36	60
PSM	KVLSPTAAKPSPFEGK	265	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21	ms_run[1]:scan=10387	46.48543166666666	2	1736.894046	1735.890988	K	T	310	326
PSM	SLSRTPETLLPFAEAEAFLKK	266	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=29767	152.76676666666668	3	2429.243848	2427.245079	K	A	809	830
PSM	AGKYVDEENSDGETSNHRLQETSSQSYVEEQK	267	sp|Q8N9T8|KRI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=11276	50.86987333333333	4	3724.564068	3723.580967	K	Q	127	159
PSM	DLLAEQQPHHLATAVPLTPR	268	sp|Q7L9B9|EEPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:21	ms_run[2]:scan=17470	82.499	3	2286.1522	2286.1522	R	V	117	137
PSM	FCFTPHTEEGCLSER	269	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=14894	68.563	2	1868.7822	1868.7822	K	A	1117	1132
PSM	GIRPFPSEETTENDDDVYR	270	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14427	66.35	2	2239.0029	2239.0029	K	S	125	144
PSM	HNGSLSPGLEARDPLEAR	271	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,12-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=14869	68.457	2	2017.9486	2017.9486	R	E	1380	1398
PSM	HQDGLPYIDDSPSSSPHLSSK	272	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=16166	75.178	3	2346.0165	2346.0165	R	G	449	470
PSM	HSSNPPLESHVGWVMDSR	273	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=17611	83.266	3	2123.9124	2123.9124	R	E	745	763
PSM	IACRSPQPDPVGTPTIFKPQSK	274	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=15128	69.771	3	2503.2294	2503.2294	K	R	1859	1881
PSM	IADPEHDHTGFLTEYVATR	275	sp|P27361-2|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16302	75.802	2	2261.0029	2261.0029	R	W	190	209
PSM	ILGSASPEEEQEKPILDRPTR	276	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=13608	62.319	2	2444.1948	2444.1948	R	I	82	103
PSM	KIEEAMDGSETPQLFTVLPEKR	277	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=21184	103.34	3	2597.2448	2597.2448	K	T	770	792
PSM	KIKNENTEGSPQEDGVELEGLK	278	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=13064	59.598	3	2493.1636	2493.1636	K	Q	1238	1260
PSM	KKTEFLDLDNSPLSPPSPR	279	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=20858	101.37	3	2300.0491	2300.0491	K	T	188	207
PSM	KKVEEEDEEEEEEEEEEEEEEDE	280	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8852	39.779	3	2926.0895	2926.0895	R	-	178	201
PSM	KKVEEEDEEEEEEEEEEEEEEDE	281	sp|O15347|HMGB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10053	45.03	3	2926.0895	2926.0895	R	-	178	201
PSM	KPGDGEVSPSTEDAPFQHSPLGK	282	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=14879	68.497	2	2459.1006	2459.1006	K	A	520	543
PSM	KREEGSDIEDEDMEELLNDTR	283	sp|Q8NHQ9-2|DDX55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=21993	108.07	3	2602.0742	2602.0742	R	L	146	167
PSM	KSASPEVSEGHENQHGQESEAK	284	sp|O60930|RNH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=1182	6.4991	3	2444.0241	2444.0241	R	A	73	95
PSM	KVLSPTAAKPSPFEGK	285	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=10619	47.494	2	1735.891	1735.8910	K	T	310	326
PSM	LHKTEDGGWEWSDDEFDEESEEGK	286	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=19451	93.205	3	2933.1189	2933.1189	R	A	328	352
PSM	LISQRSSLETLEDIEENAPLRR	287	sp|Q8TDN4-2|CABL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=25660	127.98	3	2648.3171	2648.3171	R	C	20	42
PSM	LKQEQGVESEPLFPILKQEPQSPSR	288	sp|Q8WUQ7|CATIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:21	ms_run[2]:scan=21161	103.19	3	2943.4743	2943.4743	K	S	468	493
PSM	NKPLSPIKLTPTSVLDYFGTGSVQR	289	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=29377	150.55	3	2797.4415	2797.4415	K	S	152	177
PSM	NKSEDSTKDDIDLDALAAEIEGAGAAK	290	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,8-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=26658	133.73	3	2764.3749	2764.3749	K	E	7	34
PSM	NRTPSDVKELVLDNSR	291	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=15670	72.468	2	1921.9259	1921.9259	R	S	13	29
PSM	NVAEALGHSPKDPGGGGGPVR	292	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,11-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=9352	41.91	2	2066.987	2062.9988	K	A	428	449
PSM	RHSTEGEEGDVSDVGSR	293	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=3526	15.485	3	1895.7647	1895.7647	R	T	476	493
PSM	RHSTEGEEGDVSDVGSR	294	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=3535	15.506	2	1895.7647	1895.7647	R	T	476	493
PSM	RQVLEGEEIAYKFTPK	295	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=16409	76.218	3	1986.9816	1986.9816	K	Y	505	521
PSM	RVSFADPIYQAGLADDIDRR	296	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=22263	109.68	3	2357.1165	2357.1165	R	C	2203	2223
PSM	RVTQHESDNENEIQIQNK	297	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=6177	27.327	3	2261.0074	2261.0074	R	L	116	134
PSM	SHVSSEPYEPISPPQVPVVHEK	298	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=17316	81.708	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLLSHEFQDETDTEEETLYSSKH	299	sp|O75976-2|CBPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=18733	89.532	3	2804.1702	2804.1702	K	-	1111	1134
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	300	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=11689	52.69	3	3112.5078	3112.5078	R	S	818	847
PSM	TAHNSEAADLEESFNEHELEPSSPKSK	301	sp|Q8IWS0-2|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	23-UNIMOD:21	ms_run[2]:scan=16795	78.682	3	3062.3142	3062.3142	K	K	134	161
PSM	TAHNSEADLEESFNEHELEPSSPKSK	302	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	25-UNIMOD:21	ms_run[2]:scan=15344	70.798	3	2991.2771	2991.2771	K	K	100	126
PSM	VHDRSEEEEEEEEEEEEEQPR	303	sp|Q5TAQ9-2|DCAF8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:267,5-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=7442	33.323	3	2771.047	2771.0470	R	R	95	116
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	304	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=15228	70.244	3	3174.5598	3174.5598	K	N	773	803
PSM	VNHEPEPAGGATPGATLPKSPSQLR	305	sp|O00499-6|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21	ms_run[2]:scan=13095	59.757	3	2590.2541	2590.2541	R	K	281	306
PSM	VNPHKVSPASSVDSNIPSSQGYKK	306	sp|Q9UHB7|AFF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9408	42.181	3	2685.2201	2685.2201	K	E	481	505
PSM	VVGKPAQLGTQRSQEADVQDWEFR	307	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=17990	85.491	3	2823.3341	2823.3341	R	K	824	848
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK	308	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:188,8-UNIMOD:21,15-UNIMOD:188,49-UNIMOD:188	ms_run[1]:scan=24867	123.54406666666668	4	4949.405100	4949.409282	R	H	475	524
PSM	QLFHPEQLITGKEDAANNYAR	309	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,12-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=21946	107.83662	3	2413.1997	2413.1992	R	G	85	106
PSM	SPLRTSLASLRSEQSNGSVLHDAAAAADSPAGTR	310	sp|Q9HDC5|JPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:267,6-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:267,34-UNIMOD:267	ms_run[1]:scan=20684	100.387455	4	3583.644436	3582.660741	R	G	157	191
PSM	GGGAYSHCRSLSGVGAGGGPTPRGR	311	sp|Q99466|NOTC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:267,12-UNIMOD:21,21-UNIMOD:21,23-UNIMOD:267	ms_run[1]:scan=23166	114.41906333333333	3	2633.045666	2630.051489	R	R	1890	1915
PSM	SRPLATGPSSQSHQEK	312	sp|Q96RL1|UIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1688	7.994333333333333	2	1789.820823	1788.815591	R	T	131	147
PSM	HIKEEPLSEEEPCTSTAIASPEKK	313	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=12055	54.594228333333334	2	2869.245875	2869.249389	K	K	495	519
PSM	DSGSDTASAIIPSTTPSVDSDDESVVK	314	sp|Q6WKZ4|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=27819	140.68182666666667	3	3079.027638	3079.056315	K	D	183	210
PSM	DSPATTHSPTPPSPKGAPTPSAVTPLSPKGVTLPPK	315	sp|E9PAV3|NACAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21,15-UNIMOD:188,32-UNIMOD:21	ms_run[1]:scan=21821	107.01116666666667	3	3680.854954	3680.819940	K	E	848	884
PSM	NGKSPLGEAPEPDSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQK	316	sp|A2RU67|F234B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	31-UNIMOD:21	ms_run[1]:scan=21801	106.90507	4	4710.181294	4710.186187	K	A	49	94