MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL20.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	484-UNIMOD:21	0.05	49.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	10-UNIMOD:267,15-UNIMOD:267,21-UNIMOD:21,27-UNIMOD:267,23-UNIMOD:21,18-UNIMOD:21	0.05	44.0	3	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	366-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1604-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1050-UNIMOD:267,1053-UNIMOD:21,1059-UNIMOD:4,1071-UNIMOD:267	0.02	43.0	2	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1470-UNIMOD:21,1482-UNIMOD:4	0.01	43.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	327-UNIMOD:4,328-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	103-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	668-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	294-UNIMOD:267,295-UNIMOD:21,300-UNIMOD:21,302-UNIMOD:267,297-UNIMOD:21	0.01	42.0	3	2	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	112-UNIMOD:4	0.03	42.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	42.0	3	1	0
PRT	sp|Q14004|CDK13_HUMAN	Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	644-UNIMOD:4,662-UNIMOD:21	0.02	42.0	1	1	0
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	21-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|Q8NEV8-2|EXPH5_HUMAN	Isoform 2 of Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1841-UNIMOD:267,1843-UNIMOD:267,1844-UNIMOD:21,1851-UNIMOD:4,1860-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	68-UNIMOD:21,66-UNIMOD:21	0.12	41.0	2	1	0
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	23-UNIMOD:21	0.09	41.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	276-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	8-UNIMOD:21	0.16	41.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1396-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	249-UNIMOD:4,251-UNIMOD:21,259-UNIMOD:21,281-UNIMOD:4	0.06	41.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P21580|TNAP3_HUMAN	Tumor necrosis factor alpha-induced protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	645-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	260-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	214-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1157-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	386-UNIMOD:267,391-UNIMOD:21,407-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	306-UNIMOD:21,297-UNIMOD:188,303-UNIMOD:188,307-UNIMOD:21,311-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	19-UNIMOD:21,17-UNIMOD:21	0.20	40.0	2	1	0
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	644-UNIMOD:4,664-UNIMOD:21	0.02	39.0	1	1	0
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1141-UNIMOD:21,1145-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P48029|SC6A8_HUMAN	Sodium- and chloride-dependent creatine transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	42-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	3110-UNIMOD:267,3111-UNIMOD:21,3117-UNIMOD:267,3903-UNIMOD:21	0.01	39.0	2	2	2
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	68-UNIMOD:21	0.31	39.0	1	1	1
PRT	sp|Q92974|ARHG2_HUMAN	Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	884-UNIMOD:267,885-UNIMOD:267,886-UNIMOD:21,904-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	39-UNIMOD:21	0.10	38.0	1	1	1
PRT	sp|Q12959-5|DLG1_HUMAN	Isoform 5 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	524-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.12	38.0	1	1	1
PRT	sp|Q99959|PKP2_HUMAN	Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	329-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q86U86-6|PB1_HUMAN	Isoform 6 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	9-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	48-UNIMOD:21,51-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	22-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	245-UNIMOD:21,248-UNIMOD:188,259-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1120-UNIMOD:21,1125-UNIMOD:4	0.01	38.0	1	1	1
PRT	sp|O94874|UFL1_HUMAN	E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	458-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|Q6N043-6|Z280D_HUMAN	Isoform 6 of Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	104-UNIMOD:21	0.22	37.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	502-UNIMOD:21,507-UNIMOD:4,350-UNIMOD:21,353-UNIMOD:188,355-UNIMOD:188	0.08	37.0	3	3	3
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1859-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|A2A3K4|PTPC1_HUMAN	Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	433-UNIMOD:4,438-UNIMOD:21	0.03	37.0	2	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	15-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	209-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	702-UNIMOD:267,705-UNIMOD:21,712-UNIMOD:4,717-UNIMOD:4,722-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	635-UNIMOD:21,652-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	391-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1305-UNIMOD:21,1311-UNIMOD:4	0.02	37.0	1	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	853-UNIMOD:21	0.01	37.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RKVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	26-UNIMOD:21	ms_run[2]:scan=12312	59.636	3	3209.5466	3209.5466	R	A	459	493
PSM	RLGGLRPESPESLTSVSR	2	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,6-UNIMOD:267,12-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=13874	67.757	2	2050.0351	2050.0351	R	T	10	28
PSM	FASDDEHDEHDENGATGPVKR	3	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=4537	21.356	2	2404.9557	2404.9557	K	A	364	385
PSM	KEKPELSEPSHLNGPSSDPEAAFLSR	4	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=16258	80.202	3	2901.3546	2901.3546	K	D	1589	1615
PSM	LHRIETDEEESCDNAHGDANQPAR	5	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:267,6-UNIMOD:21,12-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=5346	24.849	3	2863.1732	2863.1732	R	D	1048	1072
PSM	VKRSPDEALPGGLSGCSSGSGHSPYALER	6	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=14063	68.725	3	3050.3917	3050.3917	K	A	1467	1496
PSM	KHSEEAEFTPPLKCSPK	7	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9271	43.816	2	2063.9387	2063.9387	R	R	314	331
PSM	SHSRQASTDAGTAGALTPQHVR	8	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=6172	29.078	3	2327.0768	2327.0768	K	A	103	125
PSM	SKVGSTENIKHQPGGGR	9	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=1484	7.2325	2	1830.8738	1830.8738	R	V	664	681
PSM	THTTALAGRSPSPASGR	10	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:267,10-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=2860	13.23	2	1845.8039	1845.8039	K	R	286	303
PSM	WCDKSDEDDWSKPLPPSER	11	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4	ms_run[2]:scan=12474	60.498	2	2346.0223	2346.0223	R	L	111	130
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	12	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=18877	95.04636833333333	3	3448.4203	3448.4228	K	L	104	135
PSM	CLLADLPLPPELPGGDDLSKSPEEKK	13	sp|Q14004|CDK13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=26231	137.68125333333333	3	2898.415422	2897.413344	R	T	644	670
PSM	KHPGGGESDASPEAGSGGGGVALKK	14	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=4076	19.072	3	2329.07	2329.0700	K	E	14	39
PSM	KMQAHIQDLEEQLDEEEGAR	15	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16905	83.851	3	2368.0965	2368.0965	K	Q	947	967
PSM	RFRSFSELPSCDGNESWAYR	16	sp|Q8NEV8-2|EXPH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,3-UNIMOD:267,4-UNIMOD:21,11-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=18360	92.072	3	2573.0937	2573.0937	R	S	1841	1861
PSM	RIDFTPVSPAPSPTRGFGK	17	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=16260	80.206	2	2109.0408	2109.0408	K	M	55	74
PSM	RKPVLPALTINPTIAEGPSPTSEGASEANLVDLQK	18	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21	ms_run[2]:scan=23771	123.05	3	3692.9026	3692.9026	R	K	5	40
PSM	RNHYLDLAGIENYTSQFGPGSPSVAQK	19	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=23171	119.72	3	3028.408	3028.4080	R	S	256	283
PSM	SLSTSGESLYHVLGLDKNATSDDIKK	20	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=23017	118.88	3	2857.3746	2857.3746	R	S	8	34
PSM	VLSPLRSPPLIGSESAYESFLSADDKASGR	21	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=26175	137.33	3	3228.5704	3228.5704	K	G	1394	1424
PSM	ACASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSK	22	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	2-UNIMOD:4,4-UNIMOD:21,12-UNIMOD:21,34-UNIMOD:4	ms_run[1]:scan=21403	110.12274666666666	4	4005.778358	4005.779170	R	N	248	285
PSM	ARPFPDGLAEDIDKGEVSAR	23	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17306	86.034	3	2142.0705	2142.0705	K	Q	606	626
PSM	ENKHFAAASGKVSPTASR	24	sp|P21580|TNAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=3449	16.216	2	1936.9156	1936.9156	R	F	633	651
PSM	KHSPQHTTTLSLSTLATPK	25	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=12970	62.966	2	2127.0725	2127.0725	R	R	258	277
PSM	KVAHSDKPGSTSTASFR	26	sp|Q9P0L0|VAPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=2522	11.413	2	1854.8625	1854.8625	R	D	205	222
PSM	LIRPEYAWIVQPVSGAVYDRPGASPK	27	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	24-UNIMOD:21	ms_run[2]:scan=23733	122.83	3	2948.495	2948.4950	R	R	1134	1160
PSM	RQPPVSPLTLSPGPEAHQGFSR	28	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,6-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=15007	73.498	3	2457.2069	2457.2069	R	Q	386	408
PSM	SGPKPFSAPKPQTSPSPK	29	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=6948	32.744	2	1916.9397	1916.9397	R	R	294	312
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	30	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=20046	102.13	3	2715.4361	2715.4361	K	I	17	42
PSM	CLLADLPLPPELPGGDDLSKSPEEKK	31	sp|Q14004-2|CDK13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=26563	139.75	3	2897.4133	2897.4133	R	T	644	670
PSM	HFSTLKDDDLVEFSDLESEDDERPR	32	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=20943	107.5	3	3153.2853	3153.2853	R	S	1128	1153
PSM	KGPLIAPGPDGAPAKGDGPVGLGTPGGR	33	sp|P48029|SC6A8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:21	ms_run[2]:scan=14291	69.879	3	2588.3112	2588.3112	K	L	19	47
PSM	LFGHSSTSALSAILRSPAFTSR	34	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:267,16-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=23469	121.37	3	2405.2007	2405.2007	R	L	3096	3118
PSM	NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLR	35	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=19118	96.484	4	3904.8666	3904.8666	R	N	64	100
PSM	SGPKPFSAPKPQTSPSPK	36	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:188,10-UNIMOD:188,14-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6920	32.632	2	1935.0001	1935.0001	R	R	294	312
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	37	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=19723	100.11	3	2715.4361	2715.4361	K	I	17	42
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	38	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18904	95.20378000000001	3	3442.4008	3442.4027	K	L	104	135
PSM	RRSLPAGDALYLSFNPPQPSR	39	sp|Q92974|ARHG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:267,2-UNIMOD:267,3-UNIMOD:21,21-UNIMOD:267	ms_run[1]:scan=20185	102.94987666666667	3	2451.228346	2451.220251	R	G	884	905
PSM	DDSHSAEDSEDEKEDHKNVR	40	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=921	5.5957	2	2420.9354	2420.9354	K	Q	31	51
PSM	IHDLREQMMNSSISSGSGSLR	41	sp|Q12959-5|DLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=14547	71.186	3	2384.0614	2384.0614	K	T	506	527
PSM	KKVEEEDEEEEEEEEEEEEEEDE	42	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8531	40.227	3	2926.0895	2926.0895	R	-	178	201
PSM	RAHLTVGQAAAGGSGNLLTER	43	sp|Q99959|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=12824	62.235	3	2158.0644	2158.0644	R	S	316	337
PSM	RATSPSSSVSGDFDDGHHSVSTPGPSR	44	sp|Q86U86-6|PB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=9317	44.061	3	2806.1944	2806.1944	R	K	7	34
PSM	REEQTDTSDGESVTHHIR	45	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5330	24.782	2	2255.8845	2255.8845	R	R	44	62
PSM	RIDFTPVSPAPSPTRGFGK	46	sp|Q7Z309-5|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=16230	80.038	3	2109.0408	2109.0408	K	M	55	74
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	47	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=7422	35.027	3	2750.1933	2750.1933	R	T	13	39
PSM	VIPSPFKHADIVTTTTHK	48	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=14738	72.149	2	2083.0906	2083.0906	K	T	242	260
PSM	VPGEQGSDEEHCKEHR	49	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=1110	6.1369	2	1972.7735	1972.7735	K	A	1114	1130
PSM	GRKDDDSDDESQSSHTGK	50	sp|O94874|UFL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=583	4.606403333333334	2	2042.781211	2042.781450	K	K	452	470
PSM	ESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSR	51	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=25882	135.51	3	3621.7756	3621.7756	R	E	3889	3922
PSM	GITAAFKPTSQHYTNPTSNPVPASPINFHPESR	52	sp|Q6N043-6|Z280D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:21	ms_run[2]:scan=18059	90.263	4	3642.7257	3642.7257	R	S	81	114
PSM	HIKEEPLSEEEPCTSTAIASPEK	53	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12344	59.826	3	2661.1881	2661.1881	K	K	495	518
PSM	IHRASDPGLPAEEPKEK	54	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=5325	24.763	2	1952.9357	1952.9357	R	S	1855	1872
PSM	KHIKEEPLSEEEPCTSTAIASPEK	55	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=10624	50.841	3	2789.2831	2789.2831	K	K	494	518
PSM	LHRIETDEEESCDNAHGDANQPAR	56	sp|Q96T23-3|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=5299	24.664	3	2843.1566	2843.1566	R	D	1048	1072
PSM	LISHCYIPQSPEPDLHKEALVR	57	sp|A2A3K4|PTPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=15588	76.522	3	2681.3037	2681.3037	K	S	429	451
PSM	LISHCYIPQSPEPDLHKEALVR	58	sp|A2A3K4|PTPC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=15598	76.569	3	2681.3037	2681.3037	K	S	429	451
PSM	PAERSSPGQTPEEGAQALAEFAALHGPALR	59	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=26008	136.28	3	3137.4931	3137.4931	R	A	11	41
PSM	RLGGLRPESPESLTSVSR	60	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=13729	66.922	2	2020.0103	2020.0103	R	T	10	28
PSM	RLGGLRPESPESLTSVSR	61	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,6-UNIMOD:267,9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=13539	65.931	2	2050.0351	2050.0351	R	T	10	28
PSM	RPGQSFHVNSEVNSVLSPR	62	sp|Q14671-2|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=14839	72.665	3	2189.0379	2189.0379	R	S	193	212
PSM	RSASPHDVDLCLVSPCEFEHR	63	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,4-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=18190	91.103	3	2610.1259	2610.1259	R	K	702	723
PSM	SVEDVRPHHTDANNQSACFEAPDQK	64	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8492	40.063	3	2931.2243	2931.2243	R	T	635	660
PSM	THTTALAGRSPSPASGR	65	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2820	12.986	3	1825.7873	1825.7873	K	R	286	303
PSM	THTTALAGRSPSPASGRR	66	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=2124	9.6086	2	1981.8885	1981.8885	K	G	286	304
PSM	YGLIYHASLVGQTSPKHK	67	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,16-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=13181	64.052	2	2090.0753	2090.0753	K	G	338	356
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	68	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=19145	96.65356833333334	3	3449.4222	3448.4232	K	L	104	135
PSM	KKPAPLPPSSSPGPPSQDSR	69	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=5549	25.837965	3	2110.028528	2109.025584	K	Q	381	401
PSM	LHRIETDEEESCDNAHGDANQPAR	70	sp|Q96T23|RSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=5182	24.207936666666665	3	2844.143397	2843.156628	R	D	1300	1324
PSM	GGGLRLPLLPPESPGPLR	71	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=24745	128.67029666666664	2	1905.024410	1905.023734	R	Q	841	859
PSM	GRKDDDSDDESQSSHTGK	72	sp|O94874|UFL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21	ms_run[1]:scan=573	4.575326666666667	3	2042.781943	2042.781450	K	K	452	470