MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL21.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL21.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9GZV5|WWTR1_HUMAN	WW domain-containing transcription regulator protein 1 OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	89-UNIMOD:21,114-UNIMOD:267	0.07	49.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	307-UNIMOD:21,309-UNIMOD:21	0.04	45.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	437-UNIMOD:21,294-UNIMOD:267,295-UNIMOD:21,297-UNIMOD:21,302-UNIMOD:267	0.01	44.0	3	2	1
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	51-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	32-UNIMOD:21,58-UNIMOD:4	0.04	44.0	2	1	0
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	183-UNIMOD:21	0.02	44.0	1	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	183-UNIMOD:21,186-UNIMOD:267	0.03	43.0	5	1	0
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	68-UNIMOD:21	0.31	42.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	16-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	92-UNIMOD:21,97-UNIMOD:267,91-UNIMOD:21	0.08	41.0	2	1	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	18-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	568-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q8N5S9|KKCC1_HUMAN	Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	82-UNIMOD:21,74-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	104-UNIMOD:4,125-UNIMOD:21	0.13	40.0	2	1	0
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	151-UNIMOD:21,154-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	17-UNIMOD:21	0.20	40.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	362-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q8IZ73|RUSD2_HUMAN	RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	64-UNIMOD:188,68-UNIMOD:21,73-UNIMOD:188,77-UNIMOD:267	0.05	40.0	1	1	0
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	568-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	123-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9P244|LRFN1_HUMAN	Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	730-UNIMOD:267,731-UNIMOD:21,755-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|Q9P2Y5-2|UVRAG_HUMAN	Isoform 2 of UV radiation resistance-associated gene protein OS=Homo sapiens OX=9606 GN=UVRAG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	199-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	406-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	188-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9Y2G1-2|MYRF_HUMAN	Isoform 2 of Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	705-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	237-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	975-UNIMOD:21,976-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	495-UNIMOD:21,498-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q8IZ73-2|RUSD2_HUMAN	Isoform 2 of RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	68-UNIMOD:21	0.06	37.0	1	1	0
PRT	sp|P51397|DAP1_HUMAN	Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.25	37.0	1	1	1
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	161-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|O15409-4|FOXP2_HUMAN	Isoform 4 of Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	355-UNIMOD:21,373-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	863-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	177-UNIMOD:188,188-UNIMOD:21,198-UNIMOD:21,203-UNIMOD:188,194-UNIMOD:21	0.04	37.0	3	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	495-UNIMOD:267,497-UNIMOD:267,498-UNIMOD:21,500-UNIMOD:21,516-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	141-UNIMOD:188,143-UNIMOD:267	0.05	37.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	482-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q9C086|IN80B_HUMAN	INO80 complex subunit B OS=Homo sapiens OX=9606 GN=INO80B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	63-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1859-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q5T6F0|DCA12_HUMAN	DDB1- and CUL4-associated factor 12 OS=Homo sapiens OX=9606 GN=DCAF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	15-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	238-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|Q8TDD1|DDX54_HUMAN	ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:4,75-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1688-UNIMOD:21,1692-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	459-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	430-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	36.0	1	1	1
PRT	sp|Q7Z460|CLAP1_HUMAN	CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	582-UNIMOD:21,585-UNIMOD:21,586-UNIMOD:21,587-UNIMOD:188,598-UNIMOD:21	0.01	36.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SHSSPASLQLGTGAGAAGSPAQQHAHLR	1	sp|Q9GZV5|WWTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=10502	51.573	3	2783.3128	2783.3128	R	Q	87	115
PSM	SGPKPFSAPKPQTSPSPK	2	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21	ms_run[2]:scan=6933	33.347	2	1916.9397	1916.9397	R	R	294	312
PSM	SHSSPASLQLGTGAGAAGSPAQQHAHLR	3	sp|Q9GZV5|WWTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=10563	51.892	3	2773.3046	2773.3046	R	Q	87	115
PSM	HASSSPESPKPAPAPGSHR	4	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=1242	6.4387	2	1975.8902	1975.8902	R	E	433	452
PSM	REEQTDTSDGESVTHHIR	5	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21	ms_run[2]:scan=4474	20.768	2	2175.9182	2175.9182	R	R	44	62
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	6	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22606	118.71869666666666	3	4104.019469	4103.041199	R	R	26	71
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	7	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	26-UNIMOD:21	ms_run[1]:scan=24870	132.03681	3	3134.444236	3131.438981	K	E	158	187
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	8	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24879	132.09	3	3141.4472	3141.4472	K	E	158	187
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	9	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	26-UNIMOD:21	ms_run[2]:scan=25038	133.05	3	3131.439	3131.4390	K	E	158	187
PSM	NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLR	10	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=18703	96.345	4	3904.8666	3904.8666	R	N	64	100
PSM	PAERSSPGQTPEEGAQALAEFAALHGPALR	11	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=25540	136.21	3	3137.4931	3137.4931	R	A	11	41
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	12	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24716	131.08	3	3141.4472	3141.4472	K	E	158	187
PSM	HSPTSEPTPPGDALPPVSSPHTHR	13	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=9100	44.31	3	2590.1841	2590.1841	K	G	74	98
PSM	RLGGLRPESPESLTSVSR	14	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=13416	66.721	2	2020.0103	2020.0103	R	T	10	28
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	15	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=25050	133.12	3	3141.4472	3141.4472	K	E	158	187
PSM	GDTSHSPTPGKVSSPLSPLSPGIKSPTIPR	16	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:21	ms_run[2]:scan=16510	83.671	3	3076.5594	3076.5594	R	A	544	574
PSM	KLSLQERPAGSYLEAQAGPYATGPASHISPR	17	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=17607	90.017	4	3331.6351	3331.6351	R	A	72	103
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK	18	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=15444	77.732	3	3700.6088	3700.6088	R	L	102	135
PSM	RLEISPDSSPERAHYTHSDYQYSQR	19	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=11143	54.916	4	3181.3292	3181.3292	R	S	147	172
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	20	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=19384	100.38	3	2715.4361	2715.4361	K	I	17	42
PSM	TKFASDDEHDEHDENGATGPVKR	21	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=3670	16.996	2	2634.0984	2634.0984	K	A	362	385
PSM	ASHQQNGDAGGDAKVELSPGPPKPAGR	22	sp|Q8IZ73|RUSD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:188,18-UNIMOD:21,23-UNIMOD:188,27-UNIMOD:267	ms_run[1]:scan=7081	34.06799	3	2743.316505	2742.315298	R	E	51	78
PSM	HWDQDDDFEFTGSHLTVR	23	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=17562	89.744	3	2213.9642	2213.9642	K	N	551	569
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK	24	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=16276	82.378	3	3700.6088	3700.6088	R	L	102	135
PSM	RAEVLGHKTPEPAPR	25	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=3546	16.442	2	1736.8723	1736.8723	K	R	115	130
PSM	HRSTPHLDGAGGGAAGEDGDLGLGSAR	26	sp|Q9P244|LRFN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,3-UNIMOD:21,27-UNIMOD:267	ms_run[2]:scan=11204	55.273	3	2630.1738	2630.1738	R	A	729	756
PSM	KGEDLVGSLNGGHANVHPSQEQGEALSGHR	27	sp|Q9P2Y5-2|UVRAG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=11177	55.112	4	3159.4483	3159.4483	K	A	192	222
PSM	LSSESHHGGSPIHWVLPAGMSAK	28	sp|Q96MU7-2|YTDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=17350	88.525	2	2464.1359	2464.1359	R	M	397	420
PSM	RDSFDDRGPSLNPVLDYDHGSR	29	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=16041	81.03	3	2597.1296	2597.1296	R	S	186	208
PSM	RLDSLKSTGSSGAFSHAGSQFSR	30	sp|Q9Y2G1-2|MYRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=12412	61.59	3	2462.134	2462.1340	R	A	702	725
PSM	RSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYK	31	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=22735	119.44	3	3573.693	3573.6930	R	Q	228	263
PSM	SVRPIHSSTSSPTISIHEVGHTGVTK	32	sp|P46019|KPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=11288	55.687	3	2873.3474	2873.3474	R	T	969	995
PSM	AHSEKDQPPFGDSDDSVEADKSSPGIHLER	33	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=13347	66.38341333333334	4	3410.416392	3409.413705	R	S	483	513
PSM	ASHQQNGDAGGDAKVELSPGPPKPAGR	34	sp|Q8IZ73-2|RUSD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:21	ms_run[2]:scan=7089	34.103	3	2720.2668	2720.2668	R	E	51	78
PSM	DKDDQEWESPSPPKPTVFISGVIAR	35	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21969	115.23	3	2797.3923	2797.3923	K	G	41	66
PSM	IHEKDPNSATATAPPSPLKR	36	sp|Q92766-6|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=6393	30.782	3	2209.0892	2209.0892	K	R	146	166
PSM	RDSSSHEETGASHTLYGHGVCK	37	sp|O15409-4|FOXP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=4593	21.321	3	2494.0333	2494.0333	R	W	353	375
PSM	RRSQFFEQGSSDSVVPDLPVPTISAPSR	38	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=23180	121.88	3	3138.5135	3138.5135	K	W	861	889
PSM	RRSQFFEQGSSDSVVPDLPVPTISAPSR	39	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=23352	122.88	3	3138.5135	3138.5135	K	W	861	889
PSM	THTTALAGRSPSPASGR	40	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:267,10-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=2761	12.463	2	1845.8039	1845.8039	K	R	286	303
PSM	VKEVHDELEDLPSPPPPLSPPPTTSPHK	41	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,13-UNIMOD:21,23-UNIMOD:21,28-UNIMOD:188	ms_run[2]:scan=17146	87.279	3	3211.5282	3211.5282	K	Q	176	204
PSM	YRQRSPSPAPAPAPAAAAGPPTR	42	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:267,4-UNIMOD:267,5-UNIMOD:21,7-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=6800	32.761	3	2476.1556	2476.1556	R	K	494	517
PSM	HSQFLGYPITLYLEKER	43	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:188,17-UNIMOD:267	ms_run[1]:scan=22498	118.10823	3	2109.123178	2109.122974	K	E	127	144
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	44	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22422	117.68919666666666	3	4104.021147	4103.041199	R	R	26	71
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK	45	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21	ms_run[1]:scan=23367	122.970725	4	4931.341424	4931.348895	R	H	475	524
PSM	HHQEEDAGPTQPSPAKPQLK	46	sp|Q9C086|IN80B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21	ms_run[2]:scan=4203	19.6	3	2274.043	2274.0430	K	L	51	71
PSM	HSPTSEPTPPGDALPPVSSPHTHR	47	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:21	ms_run[2]:scan=9306	45.425	3	2580.1758	2580.1758	K	G	74	98
PSM	HSQFIGYPITLFVEKER	48	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=23563	124.13	3	2063.084	2063.0840	K	D	210	227
PSM	HWDQDDDFEFTGSHLTVR	49	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17555	89.71	3	2203.9559	2203.9559	K	N	551	569
PSM	IHRASDPGLPAEEPKEK	50	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=5437	26.064	2	1952.9357	1952.9357	R	S	1855	1872
PSM	KAPASPGAGSDAQGPQFGWDHSLHK	51	sp|Q5T6F0|DCA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=12663	62.849	3	2625.1762	2625.1762	R	R	11	36
PSM	KIDTHPSPSHSSTVKDSLIELK	52	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=11689	57.861	3	2498.2418	2498.2418	R	E	232	254
PSM	KIDTHPSPSHSSTVKDSLIELK	53	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=11701	57.925	2	2498.2418	2498.2418	R	E	232	254
PSM	KLGPGRPLPTFPTSECTSDVEPDTR	54	sp|Q8TDD1|DDX54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=15858	79.967	3	2836.3103	2836.3103	R	E	58	83
PSM	LHKRDSFDNCSLGESSK	55	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=4693	21.779	2	2058.883	2058.8830	R	I	1683	1700
PSM	RHQDGLPYIDDSPSSSPHLSSK	56	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	12-UNIMOD:21	ms_run[2]:scan=13680	68.129	3	2502.1176	2502.1176	R	G	448	470
PSM	RHSSDINHLVTQGR	57	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=6589	31.708	2	1698.7951	1698.7951	R	E	428	442
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	58	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=7468	36.046	3	2750.1933	2750.1933	R	T	13	39
PSM	SGPKPFSAPKPQTSPSPK	59	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7661	36.976	2	1996.9061	1996.9061	R	R	294	312
PSM	THTTALAGRSPSPASGR	60	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2736	12.296	2	1825.7873	1825.7873	K	R	286	303
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	61	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21	ms_run[2]:scan=25205	134.07	3	3131.439	3131.4390	K	E	158	187
PSM	VKEVHDELEDLPSPPPPLSPPPTTSPHK	62	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=16958	86.239	3	3199.488	3199.4880	K	Q	176	204
PSM	VKEVHDELEDLPSPPPPLSPPPTTSPHK	63	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17149	87.301	3	3199.488	3199.4880	K	Q	176	204
PSM	MREIVHIQAGQCGNQIGAK	64	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=10272	50.35870833333333	3	2125.084816	2125.085560	-	F	1	20
PSM	KLSLQERPAGSYLEAQAGPYATGPASHISPR	65	sp|Q8N5S9|KKCC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=17522	89.54802166666667	3	3333.620833	3331.635055	R	A	72	103
PSM	ASTVSTKSVSTTGSLQRSR	66	sp|Q7Z460|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:21,5-UNIMOD:21,6-UNIMOD:21,7-UNIMOD:188,18-UNIMOD:21	ms_run[1]:scan=15519	78.13549499999999	3	2278.929879	2277.914134	R	S	581	600