MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL23.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL23.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8WWM7-7|ATX2L_HUMAN	Isoform 7 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	31-UNIMOD:21,58-UNIMOD:4,32-UNIMOD:21	0.12	44.0	4	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	44.0	1	1	1
PRT	sp|Q6WCQ1|MPRIP_HUMAN	Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	365-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1770-UNIMOD:21,633-UNIMOD:21,652-UNIMOD:4	0.02	42.0	2	2	1
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	605-UNIMOD:21,602-UNIMOD:188,609-UNIMOD:188,611-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	16-UNIMOD:21,20-UNIMOD:21	0.05	41.0	2	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|O00429-7|DNM1L_HUMAN	Isoform 7 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	413-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	185-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	155-UNIMOD:267,157-UNIMOD:21,158-UNIMOD:267,176-UNIMOD:267,156-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	311-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	202-UNIMOD:21,211-UNIMOD:267,232-UNIMOD:267	0.12	38.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	42-UNIMOD:21,49-UNIMOD:4	0.06	37.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	260-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	501-UNIMOD:21	0.05	37.0	2	1	0
PRT	sp|O14647|CHD2_HUMAN	Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1795-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	2013-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|Q9BQQ3|GORS1_HUMAN	Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	216-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|Q9UPN7|PP6R1_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP6R1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	530-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q53F19-2|NCBP3_HUMAN	Isoform 2 of Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	220-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	363-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	220-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	399-UNIMOD:21,405-UNIMOD:21,417-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	79-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|Q68D20|PMS2L_HUMAN	Protein PMS2CL OS=Homo sapiens OX=9606 GN=PMS2CL PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	53-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	91-UNIMOD:21,85-UNIMOD:21	0.05	35.0	2	1	0
PRT	sp|O43353-2|RIPK2_HUMAN	Isoform 2 of Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	251-UNIMOD:4,256-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q5SW79-2|CE170_HUMAN	Isoform 2 of Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	379-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	351-UNIMOD:21,353-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21	0.02	35.0	2	2	2
PRT	sp|Q92786|PROX1_HUMAN	Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	447-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q9P2K8-2|E2AK4_HUMAN	Isoform 2 of eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	667-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1275-UNIMOD:21,1295-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|O75569|PRKRA_HUMAN	Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	18-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q86VI3|IQGA3_HUMAN	Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1424-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	104-UNIMOD:4,125-UNIMOD:21	0.13	34.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1160-UNIMOD:21	0.01	34.0	3	1	0
PRT	sp|Q5VT06|CE350_HUMAN	Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	1648-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.00	34.0	2	1	0
PRT	sp|Q6PJT7-8|ZC3HE_HUMAN	Isoform 8 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	211-UNIMOD:21,228-UNIMOD:4	0.09	34.0	1	1	1
PRT	sp|Q5T5U3-3|RHG21_HUMAN	Isoform 3 of Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	847-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	17-UNIMOD:21	0.20	34.0	1	1	1
PRT	sp|Q9BUL5-3|PHF23_HUMAN	Isoform 3 of PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	80-UNIMOD:21	0.11	34.0	1	1	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	802-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P0C860|MS3L2_HUMAN	Putative male-specific lethal-3 protein-like 2 OS=Homo sapiens OX=9606 GN=MSL3P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	243-UNIMOD:21,247-UNIMOD:21,252-UNIMOD:21,259-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1739-UNIMOD:21,1744-UNIMOD:21,1745-UNIMOD:21,1747-UNIMOD:21,1748-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|Q9H5L6|THAP9_HUMAN	DNA transposase THAP9 OS=Homo sapiens OX=9606 GN=THAP9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	727-UNIMOD:21,731-UNIMOD:21,732-UNIMOD:4,735-UNIMOD:4,745-UNIMOD:188,747-UNIMOD:21,756-UNIMOD:188	0.04	34.0	1	1	1
PRT	sp|Q12857-2|NFIA_HUMAN	Isoform 2 of Nuclear factor 1 A-type OS=Homo sapiens OX=9606 GN=NFIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	372-UNIMOD:21,389-UNIMOD:267	0.06	33.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	79-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	800-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	152-UNIMOD:21,153-UNIMOD:4	0.03	33.0	1	1	1
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	691-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P49450-2|CENPA_HUMAN	Isoform 2 of Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	15-UNIMOD:267,16-UNIMOD:267,17-UNIMOD:21,19-UNIMOD:21,28-UNIMOD:267	0.13	33.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	26-UNIMOD:267,32-UNIMOD:21,58-UNIMOD:4,70-UNIMOD:267	0.04	33.0	1	1	0
PRT	sp|Q86XJ1|GA2L3_HUMAN	GAS2-like protein 3 OS=Homo sapiens OX=9606 GN=GAS2L3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	600-UNIMOD:21,603-UNIMOD:21,604-UNIMOD:21,610-UNIMOD:267,623-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q13574-2|DGKZ_HUMAN	Isoform 2 of Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	7-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:21,22-UNIMOD:21,23-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9C009|FOXQ1_HUMAN	Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	248-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	78-UNIMOD:21	0.09	32.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	438-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	154-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	366-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q92558|WASF1_HUMAN	Wiskott-Aldrich syndrome protein family member 1 OS=Homo sapiens OX=9606 GN=WASF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	339-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	239-UNIMOD:21,256-UNIMOD:4,260-UNIMOD:21,262-UNIMOD:21	0.12	32.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	1	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=21572	115.49	4	4103.0412	4103.0412	R	R	26	71
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=18044	96.03875333333333	3	3448.4204	3448.4228	K	L	104	135
PSM	KRDFTNEAPPAPLPDASASPLSPHR	3	sp|Q6WCQ1|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	22-UNIMOD:21	ms_run[2]:scan=13731	70.527	3	2750.3177	2750.3177	R	R	344	369
PSM	KLGPISPPQPPSVSAWNKPLTSFGSAPSSEGAK	4	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=22837	123.13	3	3398.6912	3398.6912	K	N	1765	1798
PSM	HLEAADKGHSPAQKPK	5	sp|Q14966-2|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=890	5.3548	2	1792.8621	1792.8621	K	T	596	612
PSM	RPAERSSPGQTPEEGAQALAEFAALHGPALR	6	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=23596	128.2	3	3293.5943	3293.5943	R	A	10	41
PSM	LNFSHGTHEYHAETIK	7	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=7694	37.979	2	1882.8962	1882.8962	R	N	74	90
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	8	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=21639	115.9	3	4103.0412	4103.0412	R	R	26	71
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	9	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=21809	116.9	3	4103.0412	4103.0412	R	R	26	71
PSM	SKPIPIMPASPQKGHAVNLLDVPVPVAR	10	sp|O00429-7|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=21471	114.92	3	3010.6191	3010.6191	K	K	404	432
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	11	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	28-UNIMOD:21	ms_run[2]:scan=24020	131.06	3	3131.439	3131.4390	K	E	158	187
PSM	HFRSSRGQEEISGALPVASPASSR	12	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:267,5-UNIMOD:21,6-UNIMOD:267,24-UNIMOD:267	ms_run[2]:scan=11540	58.507	3	2635.2646	2635.2646	K	T	153	177
PSM	RAQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	13	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	30-UNIMOD:21	ms_run[2]:scan=12806	65.377	3	3248.5113	3248.5113	R	V	282	316
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGR	14	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,12-UNIMOD:267,33-UNIMOD:267	ms_run[2]:scan=7039	34.52	4	2890.2582	2890.2582	R	R	200	233
PSM	HFLLEEDKPEEPTAHAFVSTLTR	15	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19013	101.32	4	2666.334	2666.3340	R	G	1516	1539
PSM	HFRSSRGQEEISGALPVASPASSR	16	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=11588	58.765	3	2605.2398	2605.2398	K	T	153	177
PSM	IHLGSSPKKGGNCDLSHQER	17	sp|Q9H410-4|DSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3955	19.308	2	2299.0529	2299.0529	R	L	37	57
PSM	KHSPQHTTTLSLSTLATPKR	18	sp|P52799|EFNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10879	54.927	3	2283.1736	2283.1736	R	S	258	278
PSM	KHSPQHTTTLSLSTLATPKR	19	sp|P52799|EFNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10931	55.177	2	2283.1736	2283.1736	R	S	258	278
PSM	LLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPR	20	sp|Q9C0B5-2|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=13544	69.418	4	3471.6896	3471.6896	K	T	497	530
PSM	RPAERSSPGQTPEEGAQALAEFAALHGPALR	21	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=23440	127.16	3	3293.5943	3293.5943	R	A	10	41
PSM	SPPSQKSPHDSKSPLDHR	22	sp|O14647|CHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=1510	7.4087	2	2078.9535	2078.9535	R	S	1789	1807
PSM	KLGPISPPQPPSVSAWNKPLTSFGSAPSSEGAK	23	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21	ms_run[1]:scan=22673	122.10741166666666	3	3398.688442	3398.691173	K	N	2008	2041
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	24	sp|Q9BQQ3|GORS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:21	ms_run[1]:scan=20392	108.8271	4	3773.852691	3773.855338	K	Q	212	250
PSM	NMVDLVNTHHLHSSSDDEDDRLK	25	sp|Q9UPN7|PP6R1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=12676	64.689	3	2756.1861	2756.1861	K	E	517	540
PSM	RPHSPEKAFSSNPVVR	26	sp|Q53F19-2|NCBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=7047	34.553	2	1886.9152	1886.9152	K	R	217	233
PSM	SHHAPMSPGSSGGGGQPLAR	27	sp|O14497-2|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=1449	7.1751	3	1966.8469	1966.8469	R	T	357	377
PSM	SASPSTQQEKHPTHHER	28	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=608	4.600533333333334	2	2036.887425	2035.886131	R	G	220	237
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	29	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=17847	94.96652166666667	4	3664.615957	3664.614058	R	A	397	429
PSM	DASDDLDDLNFFNQK	30	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=23076	124.65	2	1761.7789	1761.7789	K	K	65	80
PSM	FLSRSVEDVRPHHTDANNQSACFEAPDQK	31	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=11163	56.387	4	3434.5099	3434.5099	K	T	631	660
PSM	HLEAADKGHSPAQKPK	32	sp|Q14966-2|ZN638_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:188,10-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=904	5.3921	2	1810.9225	1810.9225	K	T	596	612
PSM	HTTENKPHSPKTPEPR	33	sp|Q68D20|PMS2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=1041	5.7958	2	1934.9	1934.9000	R	R	42	58
PSM	KTPEGRASPAPGSGHPEGPGAHLDMNSLDR	34	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=10519	53.069	3	3117.4088	3117.4088	R	A	84	114
PSM	LHHCPGNHSWDSTISGSQR	35	sp|O43353-2|RIPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=7027	34.463	3	2254.9328	2254.9328	K	A	248	267
PSM	LKGNKHDDGTQSDSENAGAHR	36	sp|Q5SW79-2|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=690	4.8102	3	2315.988	2315.9880	R	R	368	389
PSM	LLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPR	37	sp|Q9C0B5-2|ZDHC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=13716	70.434	4	3471.6896	3471.6896	K	T	497	530
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	38	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=14413	74.711	3	3044.4006	3044.4006	K	H	346	374
PSM	THTTALAGRSPSPASGR	39	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2843	13.351	2	1825.7873	1825.7873	K	R	286	303
PSM	KNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTFR	40	sp|Q92786|PROX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=14490	75.144375	4	3844.755198	3844.755458	R	H	445	482
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	41	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=22448	120.71	4	3913.6489	3913.6489	R	I	250	282
PSM	HERPAGPGTPPPDSGPLAKDDR	42	sp|Q9P2K8-2|E2AK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=5996	29.486	3	2346.0754	2346.0754	R	A	659	681
PSM	HLPSPPLTQEVDLHSIAGPPVPPR	43	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=20481	109.29	3	2633.3367	2633.3367	R	Q	1272	1296
PSM	HLPSPPLTQEVDLHSIAGPPVPPR	44	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=20205	107.81	3	2643.345	2643.3450	R	Q	1272	1296
PSM	HRAEAPPLEREDSGTFSLGK	45	sp|O75569|PRKRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=11767	59.737	2	2276.0587	2276.0587	R	M	6	26
PSM	HRSLTAHSLLPLAEK	46	sp|Q86VI3|IQGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=13307	68.078	2	1751.9084	1751.9084	R	Q	1422	1437
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK	47	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14729	76.56	3	3700.6088	3700.6088	R	L	102	135
PSM	NHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVK	48	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=18596	98.929	4	3617.5584	3617.5584	K	T	1153	1186
PSM	RGHHDDSDEEASPEKTTLSTAK	49	sp|Q5VT06|CE350_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=3040	14.265	3	2490.066	2490.0660	R	E	1642	1664
PSM	RHDEDEDDSLKDR	50	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1269	6.5393	2	1628.7027	1628.7027	R	E	1329	1342
PSM	RIPVLSPKPAVAPPAPPSSSQLCR	51	sp|Q6PJT7-8|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=15715	82.439	3	2604.3611	2604.3611	R	Y	206	230
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	52	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=21742	116.5	4	4103.0412	4103.0412	R	R	26	71
PSM	RQLSHDHESVGPPSLDAQPNSKTER	53	sp|Q5T5U3-3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=7443	36.692	4	2864.3203	2864.3203	R	S	844	869
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	54	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:21	ms_run[2]:scan=19033	101.44	3	2715.4361	2715.4361	K	I	17	42
PSM	VASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPR	55	sp|Q9BUL5-3|PHF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=20631	110.1	3	3663.8774	3663.8774	K	K	78	113
PSM	VKAPVHFVEPLSPTGVAGHR	56	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=14361	74.358	3	2177.1147	2177.1147	K	K	791	811
PSM	LLNPSRPQSTESQSTSGEPATPK	57	sp|P0C860|MS3L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21,9-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=19581	104.30866666666667	3	2732.073360	2731.058170	R	R	239	262
PSM	WSAEASGKPSPSDPGSGTATMMNSSSRGSSPTR	58	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	24-UNIMOD:21,29-UNIMOD:21,30-UNIMOD:21,32-UNIMOD:21,33-UNIMOD:267	ms_run[1]:scan=21097	112.72568166666666	3	3597.352058	3597.325661	R	V	1716	1749
PSM	LSALLTCEDCITALYASDLKASKIGSLLFVK	59	sp|Q9H5L6|THAP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:21,6-UNIMOD:21,7-UNIMOD:4,10-UNIMOD:4,20-UNIMOD:188,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=26381	148.26408833333332	4	3654.784207	3651.742603	K	K	726	757
PSM	ASPHATPSTLHFPTSPIIQQPGPYFSHPAIR	60	sp|Q12857-2|NFIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	14-UNIMOD:21,31-UNIMOD:267	ms_run[2]:scan=21541	115.31	4	3441.6899	3441.6899	R	Y	359	390
PSM	GAKEEHGGLIRSPR	61	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=2471	11.455	2	1585.7726	1585.7726	R	H	68	82
PSM	KKVEEEDEEEEEEEEEEEEEEDE	62	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=8115	40.092	3	2926.0895	2926.0895	R	-	178	201
PSM	KLFAPVPFPSGSTEDVSPSGPQQPPPLPQKK	63	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=19731	105.16	4	3336.6795	3336.6795	K	I	789	820
PSM	RHDEDEDDSLKDR	64	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=1274	6.5584	3	1628.7027	1628.7027	R	E	1329	1342
PSM	RNSCNVGGGGGGFKHPAFK	65	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=7257	35.711	3	2025.8993	2025.8993	R	R	150	169
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	66	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=12440	63.475	4	2845.2556	2845.2556	K	A	686	710
PSM	RRSPSPTPTPGPSR	67	sp|P49450-2|CENPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:267,2-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=1500	7.3719	3	1681.7481	1681.7481	R	R	15	29
PSM	SKPIPIMPASPQKGHAVNLLDVPVPVAR	68	sp|O00429-7|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21	ms_run[2]:scan=21301	113.92	3	3010.6191	3010.6191	K	K	404	432
PSM	VILHLKEDQTEYLEERR	69	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12847	65.574	3	2170.1382	2170.1382	K	V	181	198
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	70	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:267,7-UNIMOD:21,33-UNIMOD:4,45-UNIMOD:267	ms_run[1]:scan=21650	115.96203	3	4123.049785	4123.057737	R	R	26	71
PSM	TGPSSLKSPGRTPLSIVSLPQSSTK	71	sp|Q86XJ1|GA2L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21,4-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:267,24-UNIMOD:21	ms_run[1]:scan=16796	88.89104833333333	3	2857.280391	2854.259660	K	T	600	625
PSM	DGSPEARSSDSESASASSSGSER	72	sp|Q13574-2|DGKZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,8-UNIMOD:21,13-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=13845	71.25905999999999	3	2641.772454	2641.753424	R	D	5	28
PSM	APVPAPGLRPEEAPGLPAAPPPAPAAPASPR	73	sp|Q9C009|FOXQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	29-UNIMOD:21	ms_run[2]:scan=16769	88.721	3	2998.543	2998.5430	R	M	220	251
PSM	KTPEGRASPAPGSGHPEGPGAHLDMNSLDR	74	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:21	ms_run[2]:scan=10478	52.88	4	3117.4088	3117.4088	R	A	84	114
PSM	NHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVK	75	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=18784	99.939	4	3617.5584	3617.5584	K	T	1153	1186
PSM	NHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVK	76	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=18683	99.415	3	3617.5584	3617.5584	K	T	1153	1186
PSM	NSQKHSPTSEPTPPGDALPPVSSPHTHR	77	sp|Q9H6S3-2|ES8L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	9-UNIMOD:21	ms_run[2]:scan=8422	41.718	3	3037.4043	3037.4043	R	G	70	98
PSM	RHSSDINHLVTQGRESPEGSYTDDANQEVR	78	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=10693	53.993	4	3476.5342	3476.5342	R	G	428	458
PSM	RLEISPDSSPERAHYTHSDYQYSQR	79	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=10266	51.728	4	3101.3629	3101.3629	R	S	147	172
PSM	TKFASDDEHDEHDENGATGPVKR	80	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=3758	18.281	3	2634.0984	2634.0984	K	A	362	385
PSM	TPHVQAVQGPLGSPPKRGPLPTEEQR	81	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=12594	64.251	3	2855.4443	2855.4443	R	V	113	139
PSM	TPVFVSPTPPPPPPPLPSALSTSSLR	82	sp|Q92558|WASF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	24-UNIMOD:21	ms_run[2]:scan=23627	128.4	3	2718.4034	2718.4034	R	A	316	342
PSM	TKFASDDEHDEHDENGATGPVKR	83	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=4261	20.83483166666667	3	2635.082050	2634.098368	K	A	362	385
PSM	LGSTVVDLSVPGKFGIIRPGCALESTTAILQQK	84	sp|Q86U90|YRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=18991	101.19006	4	3697.793358	3694.784770	R	Y	236	269