MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\111229_pHL28.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\111229_pHL28.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1,19-UNIMOD:21,31-UNIMOD:188,32-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188,141-UNIMOD:188,142-UNIMOD:267	0.14	41.0	3	3	3
PRT	sp|Q9H2G4|TSYL2_HUMAN	Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	16-UNIMOD:21,18-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	157-UNIMOD:188,189-UNIMOD:188,193-UNIMOD:188,194-UNIMOD:188,103-UNIMOD:188,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.29	40.0	3	3	3
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,18-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188,2-UNIMOD:21	0.09	40.0	3	2	1
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	351-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	102-UNIMOD:21	0.12	38.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	266-UNIMOD:21,269-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	102-UNIMOD:188,103-UNIMOD:188	0.14	36.0	4	2	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	177-UNIMOD:21,185-UNIMOD:188,187-UNIMOD:188	0.05	36.0	3	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	351-UNIMOD:21,353-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,349-UNIMOD:267,356-UNIMOD:267,373-UNIMOD:267,294-UNIMOD:267,302-UNIMOD:267,1013-UNIMOD:188,1020-UNIMOD:188	0.03	36.0	8	5	3
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.12	36.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	79-UNIMOD:188	0.05	35.0	2	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	35.0	2	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	213-UNIMOD:21,215-UNIMOD:188,217-UNIMOD:21,222-UNIMOD:188	0.02	35.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	270-UNIMOD:188,271-UNIMOD:21,289-UNIMOD:4,295-UNIMOD:4,300-UNIMOD:188	0.04	35.0	1	1	1
PRT	sp|A6NMX2|I4E1B_HUMAN	Eukaryotic translation initiation factor 4E type 1B OS=Homo sapiens OX=9606 GN=EIF4E1B PE=3 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	29-UNIMOD:21,34-UNIMOD:188,38-UNIMOD:21,44-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	2474-UNIMOD:188,2475-UNIMOD:21,2484-UNIMOD:21,2488-UNIMOD:21,2490-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	139-UNIMOD:21,146-UNIMOD:267,149-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	238-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.15	34.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	328-UNIMOD:21,342-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	478-UNIMOD:21,481-UNIMOD:21,482-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	449-UNIMOD:21,454-UNIMOD:188,462-UNIMOD:188	0.02	33.0	1	1	1
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	382-UNIMOD:21,384-UNIMOD:21,387-UNIMOD:267,400-UNIMOD:267	0.02	33.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	56-UNIMOD:188,57-UNIMOD:21,63-UNIMOD:21,73-UNIMOD:188	0.10	33.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	484-UNIMOD:21,487-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P49450-2|CENPA_HUMAN	Isoform 2 of Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	17-UNIMOD:21,21-UNIMOD:21	0.13	32.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	4386-UNIMOD:21,4401-UNIMOD:267	0.00	32.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	47-UNIMOD:21,51-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	244-UNIMOD:21,246-UNIMOD:4,243-UNIMOD:21,253-UNIMOD:188	0.02	32.0	2	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	53-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	718-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	1381-UNIMOD:21,1383-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	355-UNIMOD:188,362-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	328-UNIMOD:21,330-UNIMOD:21	0.02	31.0	2	2	2
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	313-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	501-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	69-UNIMOD:21,71-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	106-UNIMOD:21	0.18	31.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	32-UNIMOD:21,58-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9BT49|THAP7_HUMAN	THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	127-UNIMOD:4,128-UNIMOD:21,138-UNIMOD:21,147-UNIMOD:4,154-UNIMOD:21,158-UNIMOD:21,162-UNIMOD:21	0.13	31.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	3539-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q9BXB5|OSB10_HUMAN	Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	214-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	691-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:21,25-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	309-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	352-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	310-UNIMOD:188,311-UNIMOD:21,315-UNIMOD:21,319-UNIMOD:188	0.02	30.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	713-UNIMOD:21,718-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	385-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	267-UNIMOD:267,269-UNIMOD:21,272-UNIMOD:21,281-UNIMOD:188	0.04	30.0	1	1	1
PRT	sp|Q8TD57|DYH3_HUMAN	Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1867-UNIMOD:21,1870-UNIMOD:21,1873-UNIMOD:21,1876-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q96F63|CCD97_HUMAN	Coiled-coil domain-containing protein 97 OS=Homo sapiens OX=9606 GN=CCDC97 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	212-UNIMOD:21,218-UNIMOD:4	0.09	30.0	1	1	1
PRT	sp|P10635-2|CP2D6_HUMAN	Isoform 2 of Cytochrome P450 2D6 OS=Homo sapiens OX=9606 GN=CYP2D6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	93-UNIMOD:21,98-UNIMOD:21,101-UNIMOD:267,116-UNIMOD:21,119-UNIMOD:267	0.07	30.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEKR	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,18-UNIMOD:21,30-UNIMOD:188,31-UNIMOD:267	ms_run[1]:scan=12032	70.22619666666667	3	2680.2039	2680.2056	M	S	2	33
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=15949	95.60848166666666	3	3448.4196	3448.4228	K	L	104	135
PSM	RLSSSESPQRDPPPPPPPPPLLR	3	sp|Q9H2G4|TSYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=13197	77.716	3	2676.2826	2676.2826	R	L	14	37
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	4	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,34-UNIMOD:188,38-UNIMOD:188	ms_run[2]:scan=11513	66.978	4	4362.6721	4362.6721	K	K	156	194
PSM	SETAPAETATPAPVEKSPAK	5	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7269	41.18768333333333	2	2102.9767	2102.9768	M	K	2	22
PSM	NKPRPPPLSPLGGPVPSALPNGPPSPR	6	sp|Q15642|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	25-UNIMOD:21	ms_run[2]:scan=15503	92.747	3	2775.4585	2775.4585	K	S	327	354
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	7	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=15803	94.665	3	3393.3457	3393.3457	K	F	86	114
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEKR	8	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=12043	70.29289333333334	3	2664.1754	2664.1772	M	S	2	33
PSM	NTPSQHSHSIQHSPER	9	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=879	5.6324	2	1930.8311	1930.8311	K	S	254	270
PSM	AAEDDEDDDVDTKK	10	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=1103	6.6032	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAEDDEDDDVDTKK	11	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=1104	6.6068	2	1576.6779	1576.6779	R	Q	90	104
PSM	IEDVGSDEEDDSGKDKK	12	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=2008	11.182	2	1944.7837	1944.7837	K	K	172	189
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	13	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	32-UNIMOD:188,36-UNIMOD:188,37-UNIMOD:188	ms_run[2]:scan=9860	56.915	3	4263.6037	4263.6037	K	S	158	195
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	14	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=12879	75.64471666666667	3	3044.400990	3044.400561	K	H	346	374
PSM	SETAPAETATPAPVEKSPAK	15	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=7276	41.23244666666667	2	2115.0163	2115.0170	M	K	2	22
PSM	KKVEEEDEEEEEEEEEEEEEEDE	16	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=7291	41.31801	3	2926.089832	2926.089467	R	-	178	201
PSM	DASDDLDDLNFFNQK	17	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=20142	124.89	2	1761.7789	1761.7789	K	K	65	80
PSM	HTGPNSPDTANDGFVR	18	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6520	36.975	2	1773.7347	1773.7347	K	L	99	115
PSM	TLNAETPKSSPLPAK	19	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,8-UNIMOD:188,10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=6407	36.325	2	1724.819	1724.8190	R	G	208	223
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	20	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:188,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:188	ms_run[1]:scan=19739	121.82400166666666	4	3925.687731	3925.689111	R	I	269	301
PSM	TPTGEKSPNSPRTLLSLR	21	sp|A6NMX2|I4E1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21,6-UNIMOD:188,10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=13572	80.17790833333333	2	2198.962196	2198.983461	R	G	29	47
PSM	EDKSPETGTAGGSSTASYSAGR	22	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:188,4-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=3123	17.488885	3	2443.835104	2440.820688	K	G	2472	2494
PSM	AAEDDEDDDVDTK	23	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=1533	8.6624	2	1436.5427	1436.5427	R	K	90	103
PSM	GLLYDSDEEDEERPAR	24	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21,13-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=10470	60.586	2	1992.8217	1992.8217	R	K	134	150
PSM	HTGPNSPDTANDGFVR	25	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=6523	36.99	2	1763.7264	1763.7264	K	L	99	115
PSM	IEDVGSDEEDDSGKDK	26	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=3018	16.899	2	1816.6888	1816.6888	K	K	172	188
PSM	KIDTHPSPSHSSTVKDSLIELK	27	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=10423	60.311	3	2498.2418	2498.2418	R	E	232	254
PSM	KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE	28	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6931	39.263	3	4005.3218	4005.3218	K	-	184	216
PSM	SPSPPLPTHIPPEPPRTPPFPAK	29	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=16364	98.243	3	2616.2543	2616.2543	R	T	326	349
PSM	THTTALAGRSPSPASGR	30	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2580	14.329	2	1825.7873	1825.7873	K	R	286	303
PSM	TVTPASSAKTSPAKQQAPPVR	31	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4627	26.015	3	2361.0532	2361.0532	K	N	476	497
PSM	VKAQTPPGPSLSGSKSPCPQEK	32	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=6362	36.056	3	2439.0906	2439.0906	K	S	999	1021
PSM	AVTPVPTKTEEVSNLK	33	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=9022	51.691	2	1803.9422	1803.9422	R	T	447	463
PSM	DASDDLDDLNFFNQK	34	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20157	125	2	1755.7588	1755.7588	K	K	65	80
PSM	HSSISPVRLPLNSSLGAELSR	35	sp|Q9NYV4-3|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=18843	115.23	3	2399.1514	2399.1514	R	K	380	401
PSM	KSLDSDESEDEEDDYQQK	36	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:188,2-UNIMOD:21,8-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6090	34.516	3	2330.8391	2330.8391	K	R	56	74
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGK	37	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188,38-UNIMOD:188	ms_run[1]:scan=20057	124.2445	4	4152.8749	4152.8756	K	R	104	142
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	38	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=13032	76.65264666666667	3	3044.400990	3044.400561	K	H	346	374
PSM	GVVDSDDLPLNVSR	39	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13896	82.257	2	1484.7471	1484.7471	K	E	435	449
PSM	KASSPSPLTIGTPESQR	40	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=9209	52.832	2	1914.8489	1914.8489	R	K	482	499
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK	41	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:188,3-UNIMOD:4,24-UNIMOD:21,33-UNIMOD:188	ms_run[2]:scan=13198	77.719	3	3712.649	3712.6490	R	L	102	135
PSM	RLSSSESPQRDPPPPPPPPPLLR	42	sp|Q9H2G4|TSYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=13042	76.711	3	2676.2826	2676.2826	R	L	14	37
PSM	RRSPSPTPTPGPSR	43	sp|P49450-2|CENPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=1348	7.7844	2	1651.7233	1651.7233	R	R	15	29
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	44	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:267,6-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=13044	76.722	3	3074.4254	3074.4254	K	H	346	374
PSM	SSSVGSSSSYPISPAVSR	45	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=10363	59.963	2	1843.8229	1843.8229	R	T	4384	4402
PSM	VAAAAGSGPSPPGSPGHDRER	46	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3402	19.06	3	2131.8838	2131.8838	R	Q	38	59
PSM	VDSTTCLFPVEEK	47	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=15024	89.56	2	1603.6841	1603.6841	R	A	241	254
PSM	VTKNEEPSEEEIDAPKPK	48	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=5750	32.501	3	2118.9722	2118.9722	K	K	46	64
PSM	GSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPARNPPGASTYNK	49	sp|Q9BUJ2|HNRL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	33-UNIMOD:21	ms_run[1]:scan=10623	61.52707666666667	4	5014.3899	5014.3935	R	N	686	732
PSM	GRPSKTPSPSQPK	50	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=762	5.1743	2	1525.6691	1525.6691	R	K	1376	1389
PSM	HKAAAYDISEDEED	51	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:188,9-UNIMOD:21	ms_run[2]:scan=7026	39.796	2	1677.6503	1677.6503	R	-	354	368
PSM	KHSPSPPPPTPTESR	52	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2034	11.31	3	1773.7488	1773.7488	R	K	326	341
PSM	KVLSPTAAKPSPFEGK	53	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:21	ms_run[2]:scan=8654	49.377	3	1735.891	1735.8910	K	T	310	326
PSM	LLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPR	54	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21	ms_run[2]:scan=12204	71.352	4	3471.6896	3471.6896	K	T	497	530
PSM	NDSVIVADQTPTPTR	55	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=7464	42.3	2	1772.7383	1772.7383	R	F	60	75
PSM	THTTALAGRSPSPASGR	56	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:267,10-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=2661	14.791	2	1845.8039	1845.8039	K	R	286	303
PSM	THTTALAGRSPSPASGRR	57	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=1916	10.663	3	1981.8885	1981.8885	K	G	286	304
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKR	58	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	28-UNIMOD:21	ms_run[2]:scan=16015	96.027	4	4259.6823	4259.6823	K	L	79	118
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKR	59	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188,38-UNIMOD:188,39-UNIMOD:267	ms_run[1]:scan=19155	117.51708333333333	4	4318.9824	4318.9850	K	S	104	143
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	60	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=19008	116.44051833333333	4	4103.039453	4103.041199	R	R	26	71
PSM	SETAPAETATPAPVEK	61	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=7627	43.268053333333334	2	1719.7605	1719.7599	M	S	2	18
PSM	AQTPPGPSLSGSKSPCPQEK	62	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,13-UNIMOD:188,14-UNIMOD:21,16-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=6556	37.157803333333334	3	2223.966532	2223.967524	K	S	1001	1021
PSM	CSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGR	63	sp|Q9BT49|THAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,2-UNIMOD:21,12-UNIMOD:21,21-UNIMOD:4,28-UNIMOD:21,32-UNIMOD:21,36-UNIMOD:21	ms_run[1]:scan=10445	60.440065000000004	5	4477.773166	4477.751722	R	L	127	167
PSM	AAEDDEDDDVDTK	64	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:188	ms_run[2]:scan=1528	8.6403	2	1442.5628	1442.5628	R	K	90	103
PSM	GSKSPAKVSDGGSSSTDFK	65	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=3164	17.704	3	1920.8466	1920.8466	K	M	3536	3555
PSM	HLSVGAPGVVTITHHKSPAAAR	66	sp|Q9BXB5|OSB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:21	ms_run[2]:scan=8364	47.67	4	2285.1794	2285.1794	R	R	207	229
PSM	IEDVGSDEEDDSGKDK	67	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3043	17.051	2	1828.729	1828.7290	K	K	172	188
PSM	NKPGPNIESGNEDDDASFK	68	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=8215	46.803	3	2112.8637	2112.8637	K	I	206	225
PSM	NTPSQHSHSIQHSPER	69	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=878	5.6287	2	1920.8228	1920.8228	K	S	254	270
PSM	RKHSPSPPPPTPTESR	70	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=1461	8.3215	3	1929.8499	1929.8499	K	K	325	341
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	71	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=11110	64.502	4	2845.2556	2845.2556	K	A	686	710
PSM	SGAQASSTPLSPTR	72	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=4293	24.049	2	1448.6536	1448.6536	R	I	12	26
PSM	SGPKPFSAPKPQTSPSPK	73	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:21	ms_run[2]:scan=6071	34.401	2	1916.9397	1916.9397	R	R	294	312
PSM	TFLDKDAQRLSPIPEEVPK	74	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:21	ms_run[2]:scan=14765	87.903	3	2262.1297	2262.1297	K	S	342	361
PSM	TSSAFVGKTPEASPEPK	75	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:188,9-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=7046	39.917	3	1903.8408	1903.8408	K	D	303	320
PSM	VDSTTCLFPVEEK	76	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:188	ms_run[2]:scan=15030	89.594	2	1609.7042	1609.7042	R	A	241	254
PSM	RQSPSPSTRPIR	77	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=2089	11.624318333333333	2	1540.689183	1540.691257	R	R	711	723
PSM	GRAEGEWEDQEALDYFSDKESGK	78	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:21	ms_run[1]:scan=15489	92.65687833333334	3	2726.122271	2725.118100	K	Q	369	392
PSM	SRLTPVSPESSSTEEK	79	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:267,4-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:188	ms_run[1]:scan=5392	30.44045	2	1908.808697	1908.808983	R	S	266	282
PSM	DSYMDTLPSSLTKEHK	80	sp|Q8TD57|DYH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,6-UNIMOD:21,9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=16712	100.51065666666666	2	2172.724848	2170.737353	K	E	1865	1881
PSM	TPTHQPPKPGSPGRPACPLSNLLLQSYEER	81	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=18276	111.09192833333334	4	3406.650003	3406.649325	R	E	202	232
PSM	EALVTHGEDTADRPPVPITQILGFGPRSQGR	82	sp|P10635-2|CP2D6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,10-UNIMOD:21,13-UNIMOD:267,28-UNIMOD:21,31-UNIMOD:267	ms_run[1]:scan=16047	96.22685	4	3573.636290	3573.632268	R	P	89	120