MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH03.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q86UE8-3|TLK2_HUMAN	Isoform 3 of Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	693-UNIMOD:188,715-UNIMOD:21	0.04	54.0	3	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	22-UNIMOD:188	0.04	51.0	2	1	0
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	494-UNIMOD:21,517-UNIMOD:188,498-UNIMOD:21	0.03	51.0	2	1	0
PRT	sp|A7E2V4-5|ZSWM8_HUMAN	Isoform 5 of Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	48-UNIMOD:21,53-UNIMOD:21	0.01	51.0	2	1	0
PRT	sp|Q5C9Z4|NOM1_HUMAN	Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	280-UNIMOD:21,287-UNIMOD:21	0.03	50.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	86-UNIMOD:188	0.06	50.0	1	1	1
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	77-UNIMOD:21,81-UNIMOD:21,95-UNIMOD:267	0.05	49.0	2	1	0
PRT	sp|P52926|HMGA2_HUMAN	High mobility group protein HMGI-C OS=Homo sapiens OX=9606 GN=HMGA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	91-UNIMOD:188,105-UNIMOD:21	0.18	49.0	2	1	0
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	301-UNIMOD:21,304-UNIMOD:21	0.03	49.0	1	1	1
PRT	sp|Q86UE8|TLK2_HUMAN	Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	747-UNIMOD:188,769-UNIMOD:21	0.03	49.0	1	1	0
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.02	48.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	511-UNIMOD:21,525-UNIMOD:21	0.05	48.0	1	1	1
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	304-UNIMOD:21,294-UNIMOD:267	0.06	48.0	15	1	0
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	263-UNIMOD:21,279-UNIMOD:4,283-UNIMOD:267	0.01	47.0	3	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	1152-UNIMOD:28,1171-UNIMOD:21,1175-UNIMOD:21	0.02	47.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	113-UNIMOD:21,128-UNIMOD:4,139-UNIMOD:188	0.03	46.0	3	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	377-UNIMOD:21,398-UNIMOD:21,401-UNIMOD:267,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,383-UNIMOD:21,846-UNIMOD:21,848-UNIMOD:21,866-UNIMOD:21	0.03	46.0	6	3	2
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	505-UNIMOD:188,516-UNIMOD:21,523-UNIMOD:21,515-UNIMOD:21	0.04	46.0	5	1	0
PRT	sp|Q9Y2F5|ICE1_HUMAN	Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1690-UNIMOD:267,1692-UNIMOD:21,1699-UNIMOD:21,1708-UNIMOD:267	0.01	46.0	1	1	1
PRT	sp|Q9Y2T7|YBOX2_HUMAN	Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	76-UNIMOD:21,82-UNIMOD:267	0.05	46.0	2	1	0
PRT	sp|O00459|P85B_HUMAN	Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	262-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1365-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|Q76L83|ASXL2_HUMAN	Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	139-UNIMOD:21,144-UNIMOD:4,146-UNIMOD:21,134-UNIMOD:188,153-UNIMOD:188,138-UNIMOD:21	0.01	45.0	3	1	0
PRT	sp|P10321|HLAC_HUMAN	HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	341-UNIMOD:188,345-UNIMOD:4,350-UNIMOD:4,353-UNIMOD:21,360-UNIMOD:21,364-UNIMOD:4,365-UNIMOD:188,357-UNIMOD:21	0.08	45.0	2	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	85-UNIMOD:267	0.27	45.0	12	1	0
PRT	sp|O43824|GTPB6_HUMAN	Putative GTP-binding protein 6 OS=Homo sapiens OX=9606 GN=GTPBP6 PE=2 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	499-UNIMOD:267	0.04	45.0	2	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	189-UNIMOD:188	0.06	44.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4,531-UNIMOD:267	0.06	44.0	2	1	0
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	240-UNIMOD:21,171-UNIMOD:21,181-UNIMOD:267,231-UNIMOD:188,243-UNIMOD:21	0.16	44.0	7	2	0
PRT	sp|Q6R327|RICTR_HUMAN	Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	1174-UNIMOD:21,1177-UNIMOD:21,1184-UNIMOD:188,1571-UNIMOD:21,1576-UNIMOD:4,1577-UNIMOD:21,1581-UNIMOD:21,1587-UNIMOD:21	0.02	44.0	2	2	2
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	204-UNIMOD:21,214-UNIMOD:21,209-UNIMOD:188,219-UNIMOD:188	0.03	44.0	4	1	0
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	663-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	294-UNIMOD:188	0.02	44.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	333-UNIMOD:21,334-UNIMOD:21	0.08	43.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	101-UNIMOD:21,108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188,102-UNIMOD:21	0.05	43.0	2	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	66-UNIMOD:21,67-UNIMOD:21,71-UNIMOD:267,74-UNIMOD:21,86-UNIMOD:267	0.11	43.0	11	1	0
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	118-UNIMOD:267,120-UNIMOD:21,129-UNIMOD:21,137-UNIMOD:267,135-UNIMOD:21	0.04	43.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	829-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	101-UNIMOD:4,118-UNIMOD:188	0.09	43.0	1	1	1
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	131-UNIMOD:21,134-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1214-UNIMOD:21,1222-UNIMOD:21,1216-UNIMOD:21,1221-UNIMOD:267,1225-UNIMOD:267	0.01	43.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1202-UNIMOD:267	0.01	43.0	5	1	0
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	2	1	0
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	93-UNIMOD:267	0.04	43.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	210-UNIMOD:21,216-UNIMOD:21,5749-UNIMOD:21,5752-UNIMOD:21,5763-UNIMOD:21	0.01	43.0	4	2	1
PRT	sp|P46100|ATRX_HUMAN	Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.01	43.0	1	1	0
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	262-UNIMOD:188	0.07	42.0	2	1	0
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	274-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	85-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|Q99594|TEAD3_HUMAN	Transcriptional enhancer factor TEF-5 OS=Homo sapiens OX=9606 GN=TEAD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	148-UNIMOD:21,160-UNIMOD:267	0.04	42.0	3	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	41-UNIMOD:21,57-UNIMOD:188,38-UNIMOD:21	0.08	42.0	5	1	0
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	234-UNIMOD:21,237-UNIMOD:21,236-UNIMOD:21,252-UNIMOD:267	0.07	42.0	3	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	657-UNIMOD:21,659-UNIMOD:21,655-UNIMOD:267,670-UNIMOD:267,662-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	182-UNIMOD:21,186-UNIMOD:21,179-UNIMOD:267,197-UNIMOD:267,190-UNIMOD:21	0.02	42.0	4	1	0
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	557-UNIMOD:21,563-UNIMOD:21,559-UNIMOD:21,566-UNIMOD:267,584-UNIMOD:267	0.05	42.0	2	1	0
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	16-UNIMOD:4,25-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	1256-UNIMOD:21,1262-UNIMOD:21,1255-UNIMOD:188,1260-UNIMOD:21,1265-UNIMOD:21,1269-UNIMOD:188	0.01	42.0	2	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	428-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|O00165|HAX1_HUMAN	HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	46-UNIMOD:267	0.06	42.0	1	1	1
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	512-UNIMOD:21,514-UNIMOD:21,522-UNIMOD:21	0.04	42.0	1	1	0
PRT	sp|Q8N5A5-3|ZGPAT_HUMAN	Isoform 3 of Zinc finger CCCH-type with G patch domain-containing protein OS=Homo sapiens OX=9606 GN=ZGPAT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.06	41.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	610-UNIMOD:21,615-UNIMOD:188	0.01	41.0	6	1	0
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	312-UNIMOD:188	0.06	41.0	2	1	0
PRT	sp|Q9Y6I3-3|EPN1_HUMAN	Isoform 3 of Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	434-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	416-UNIMOD:4,421-UNIMOD:21,423-UNIMOD:21	0.04	41.0	4	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	240-UNIMOD:21,244-UNIMOD:21,234-UNIMOD:188,246-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|Q9H0D6-2|XRN2_HUMAN	Isoform 2 of 5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	423-UNIMOD:21,425-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q8TF74-2|WIPF2_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	117-UNIMOD:21	0.08	41.0	1	1	1
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	346-UNIMOD:4,350-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1457-UNIMOD:21,1462-UNIMOD:21,1473-UNIMOD:267	0.02	41.0	2	1	0
PRT	sp|P43268-2|ETV4_HUMAN	Isoform 2 of ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	110-UNIMOD:21,117-UNIMOD:267	0.04	41.0	3	1	0
PRT	sp|Q96N67-4|DOCK7_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	898-UNIMOD:21,909-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	882-UNIMOD:21,886-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	364-UNIMOD:21,360-UNIMOD:21	0.00	41.0	4	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2161-UNIMOD:21,2165-UNIMOD:21,2169-UNIMOD:21	0.01	41.0	4	1	0
PRT	sp|O95551|TYDP2_HUMAN	Tyrosyl-DNA phosphodiesterase 2 OS=Homo sapiens OX=9606 GN=TDP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	99-UNIMOD:188	0.05	41.0	2	1	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	247-UNIMOD:21	0.09	41.0	2	1	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	464-UNIMOD:4	0.04	41.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	66-UNIMOD:21,67-UNIMOD:21,71-UNIMOD:267,86-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	399-UNIMOD:21,411-UNIMOD:21,418-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	121-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	196-UNIMOD:267	0.05	40.0	1	1	1
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	1	1	1
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	152-UNIMOD:188	0.07	40.0	2	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	806-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	807-UNIMOD:21,811-UNIMOD:21,810-UNIMOD:188,814-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	354-UNIMOD:21,363-UNIMOD:188,367-UNIMOD:21,376-UNIMOD:188,368-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|Q9NSI6-2|BRWD1_HUMAN	Isoform B of Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1786-UNIMOD:21,1793-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	56-UNIMOD:21,59-UNIMOD:21,76-UNIMOD:188	0.09	40.0	2	1	0
PRT	sp|Q13286-5|CLN3_HUMAN	Isoform 5 of Battenin OS=Homo sapiens OX=9606 GN=CLN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	12-UNIMOD:21,14-UNIMOD:21	0.06	40.0	2	1	0
PRT	sp|Q9HCS5|E41LA_HUMAN	Band 4.1-like protein 4A OS=Homo sapiens OX=9606 GN=EPB41L4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	445-UNIMOD:21,446-UNIMOD:4,448-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	334-UNIMOD:4,343-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	289-UNIMOD:21,296-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q8NFA0|UBP32_HUMAN	Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1372-UNIMOD:21,1376-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	4217-UNIMOD:21,4227-UNIMOD:21	0.00	40.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	42-UNIMOD:21	0.11	40.0	1	1	1
PRT	sp|Q8WVB6|CTF18_HUMAN	Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	63-UNIMOD:21,73-UNIMOD:21,58-UNIMOD:267,64-UNIMOD:21,79-UNIMOD:267	0.03	40.0	2	1	0
PRT	sp|Q5T481|RBM20_HUMAN	RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1071-UNIMOD:21,1077-UNIMOD:4,1080-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q7Z460-4|CLAP1_HUMAN	Isoform 4 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	687-UNIMOD:21,694-UNIMOD:21,695-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	220-UNIMOD:267	0.03	40.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	107-UNIMOD:28,109-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	337-UNIMOD:21,345-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	427-UNIMOD:4,429-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	477-UNIMOD:267	0.04	39.0	2	1	0
PRT	sp|P35443|TSP4_HUMAN	Thrombospondin-4 OS=Homo sapiens OX=9606 GN=THBS4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	477-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	246-UNIMOD:188	0.06	39.0	2	1	0
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	194-UNIMOD:267,197-UNIMOD:21,203-UNIMOD:21,209-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q9UIC8-3|LCMT1_HUMAN	Isoform 3 of Leucine carboxyl methyltransferase 1 OS=Homo sapiens OX=9606 GN=LCMT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	13-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:4	0.08	39.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	250-UNIMOD:21,255-UNIMOD:267,257-UNIMOD:21,267-UNIMOD:267	0.03	39.0	1	1	1
PRT	sp|Q8WUZ0|BCL7C_HUMAN	B-cell CLL/lymphoma 7 protein family member C OS=Homo sapiens OX=9606 GN=BCL7C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	114-UNIMOD:21,123-UNIMOD:267,126-UNIMOD:21,142-UNIMOD:267	0.16	39.0	1	1	1
PRT	sp|Q9ULJ3-2|ZBT21_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	431-UNIMOD:21,435-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8IZM8|ZN654_HUMAN	Zinc finger protein 654 OS=Homo sapiens OX=9606 GN=ZNF654 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	568-UNIMOD:4,580-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q96HB5-2|CC120_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 120 OS=Homo sapiens OX=9606 GN=CCDC120	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	290-UNIMOD:21,294-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P27987-2|IP3KB_HUMAN	Isoform 2 of Inositol-trisphosphate 3-kinase B OS=Homo sapiens OX=9606 GN=ITPKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	33-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	478-UNIMOD:21,482-UNIMOD:21,486-UNIMOD:21	0.04	39.0	1	1	0
PRT	sp|Q4KMQ1|TPRN_HUMAN	Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	264-UNIMOD:21,274-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	101-UNIMOD:4,117-UNIMOD:267	0.05	39.0	2	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,67-UNIMOD:267,69-UNIMOD:21,86-UNIMOD:267	0.05	39.0	3	1	0
PRT	sp|O43768|ENSA_HUMAN	Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.15	39.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	890-UNIMOD:28,905-UNIMOD:267,906-UNIMOD:21,908-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	192-UNIMOD:21,195-UNIMOD:21	0.15	39.0	1	1	1
PRT	sp|Q92552|RT27_HUMAN	28S ribosomal protein S27, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	312-UNIMOD:188	0.06	38.0	1	1	1
PRT	sp|Q15642-2|CIP4_HUMAN	Isoform 2 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	296-UNIMOD:21,299-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	214-UNIMOD:21,218-UNIMOD:21,227-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9UK61-2|TASOR_HUMAN	Isoform 2 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	666-UNIMOD:21,670-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9BXK1|KLF16_HUMAN	Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	99-UNIMOD:21,111-UNIMOD:21,114-UNIMOD:267,125-UNIMOD:188	0.15	38.0	1	1	1
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	955-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	51-UNIMOD:21,53-UNIMOD:21,61-UNIMOD:188	0.05	38.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	274-UNIMOD:21,279-UNIMOD:4,280-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|Q9Y2D9|ZN652_HUMAN	Zinc finger protein 652 OS=Homo sapiens OX=9606 GN=ZNF652 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	194-UNIMOD:267,197-UNIMOD:21,204-UNIMOD:21,208-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	391-UNIMOD:267,394-UNIMOD:21,397-UNIMOD:21,406-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q01167-2|FOXK2_HUMAN	Isoform 2 of Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	369-UNIMOD:21,373-UNIMOD:21,389-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	672-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	263-UNIMOD:21,270-UNIMOD:21,274-UNIMOD:267,276-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	252-UNIMOD:21,254-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	676-UNIMOD:21,680-UNIMOD:267,681-UNIMOD:21,693-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|P98175-2|RBM10_HUMAN	Isoform 2 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	126-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	125-UNIMOD:21,133-UNIMOD:267	0.10	38.0	1	1	1
PRT	sp|P15923|TFE2_HUMAN	Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	543-UNIMOD:188	0.03	38.0	1	1	1
PRT	sp|P37275-3|ZEB1_HUMAN	Isoform 3 of Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	244-UNIMOD:4,246-UNIMOD:21,255-UNIMOD:21,258-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	1595-UNIMOD:28,1596-UNIMOD:267,1599-UNIMOD:21,1612-UNIMOD:4,1617-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q9H6U6|BCAS3_HUMAN	Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	475-UNIMOD:28,479-UNIMOD:4,480-UNIMOD:21,488-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	247-UNIMOD:267,249-UNIMOD:4,251-UNIMOD:21,259-UNIMOD:21,272-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|Q8N4L1|T151A_HUMAN	Transmembrane protein 151A OS=Homo sapiens OX=9606 GN=TMEM151A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	323-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	87-UNIMOD:21,89-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	221-UNIMOD:21	0.05	38.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	1	sp|Q86UE8-3|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	1-UNIMOD:188,23-UNIMOD:21	ms_run[2]:scan=8917	44.28	2	2425.0701	2425.0701	R	-	693	719
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	2	sp|Q86UE8-3|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:188,23-UNIMOD:21	ms_run[2]:scan=8681	43.159	2	2425.0701	2425.0701	R	-	693	719
PSM	AADSDDGAVSAPAASDGGVSK	3	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	21-UNIMOD:188	ms_run[2]:scan=5615	28.763	2	1852.8382	1852.8382	M	S	2	23
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	4	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	6-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=17583	86.785	2	2967.1987	2967.1987	R	V	489	518
PSM	KQSAGPNSPTGGGGGGGSGGTR	5	sp|A7E2V4-5|ZSWM8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=608	5.0353	2	2002.7895	2002.7895	R	M	46	68
PSM	KAQEAEAQSEDDDEDTEEEQGEEK	6	sp|Q5C9Z4|NOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	9-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=1899	10.96	3	2898.0125	2898.0125	K	E	272	296
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	7	sp|Q86UE8-3|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	23-UNIMOD:21	ms_run[2]:scan=8730	43.38	2	2419.05	2419.0500	R	-	693	719
PSM	VNEASGDGDGEDAVVILEK	8	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	19-UNIMOD:188	ms_run[2]:scan=15823	77.852	2	1921.9212	1921.9212	K	T	68	87
PSM	AAAAGLGHPASPGGSEDGPPGSEEEDAAR	9	sp|Q99856|ARI3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9972	49.133	3	2819.1073	2819.1073	R	E	67	96
PSM	KPAQEETEETSSQESAEED	10	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:188,15-UNIMOD:21	ms_run[2]:scan=1655	9.794	2	2208.8527	2208.8527	K	-	91	110
PSM	KSSELDASDSSSSSNLSLAK	11	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=9853	48.557	2	2171.8872	2171.8872	R	V	288	308
PSM	KSVSTSSPAGAAIASTSGASNNSSSN	12	sp|Q86UE8|TLK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	1-UNIMOD:188,23-UNIMOD:21	ms_run[1]:scan=9238	45.753405	2	2426.065383	2425.070150	R	-	747	773
PSM	AIEDEGGNPDEIEITSEGNK	13	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=13111	64.329	2	2115.9444	2115.9444	K	K	64	84
PSM	GGAPDPSPGATATPGAPAQPSSPDARR	14	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	7-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=7669	38.434	3	2645.1272	2645.1272	R	N	505	532
PSM	RGGGSGGGEESEGEEVDED	15	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	11-UNIMOD:21	ms_run[2]:scan=2492	13.809	2	1930.6702	1930.6702	R	-	294	313
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	16	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=22621	114.21	2	2441.1802	2441.1802	R	S	258	284
PSM	QLEEEQKLKPGGVGAPSSSSPSPSPSAR	17	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:28,20-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=14045	68.98678666666667	3	2949.3312	2949.3152	R	P	1152	1180
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	18	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14708	72.28	3	2789.2772	2789.2772	R	T	112	140
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	19	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=16219	79.902	3	3021.351	3021.3510	R	D	374	402
PSM	KPAQEETEETSSQESAEED	20	sp|P52926|HMGA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:21	ms_run[2]:scan=1635	9.7056	2	2202.8325	2202.8325	K	-	91	110
PSM	KPVTVSPTTPTSPTEGEAS	21	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,12-UNIMOD:21	ms_run[2]:scan=8170	40.725	2	1970.9181	1970.9181	R	-	505	524
PSM	KQSAGPNSPTGGGGGGGSGGTR	22	sp|A7E2V4-5|ZSWM8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=606	5.0245	3	2002.7895	2002.7895	R	M	46	68
PSM	RASPPDPSPSPSAASASER	23	sp|Q9Y2F5|ICE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:267,3-UNIMOD:21,10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=5937	30.219	2	2045.836	2045.8360	R	V	1690	1709
PSM	TPGNPATAVSGTPAPPAR	24	sp|Q9Y2T7|YBOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:21	ms_run[2]:scan=8239	41.046	2	1740.8196	1740.8196	R	S	65	83
PSM	APPPPSSPPPGGAPDGSEPSPDFPALLVEK	25	sp|O00459|P85B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=24138	124.16	3	2986.4001	2986.4001	R	L	257	287
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	26	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21,17-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=14512	71.3	3	2795.2973	2795.2973	R	T	112	140
PSM	GAGDGSDEEVDGKADGAEAKPAE	27	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=4620	24.016	2	2253.8911	2253.8911	K	-	1360	1383
PSM	KVSSSSPQSGCPSPTIPAGK	28	sp|Q76L83|ASXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=6604	33.358	2	2130.9058	2130.9058	R	V	134	154
PSM	RGGGSGGGEESEGEEVDED	29	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:21	ms_run[2]:scan=2281	12.8	2	1930.6702	1930.6702	R	-	294	313
PSM	SSGGKGGSCSQAACSNSAQGSDESLITCKA	30	sp|P10321|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:188,9-UNIMOD:4,14-UNIMOD:4,17-UNIMOD:21,24-UNIMOD:21,28-UNIMOD:4,29-UNIMOD:188	ms_run[2]:scan=9481	46.88	3	3133.2228	3133.2228	K	-	337	367
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	31	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11677	57.43	3	2831.1125	2831.1125	R	T	60	86
PSM	RGGGSGGGEESEGEEVDED	32	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=3885	20.594823333333334	2	1941.691248	1940.678438	R	-	294	313
PSM	EATVQEVDVIPEDGAADVR	33	sp|O43824|GTPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	19-UNIMOD:267	ms_run[1]:scan=17296	85.37147	2	2022.988062	2021.978098	K	V	481	500
PSM	AAAAGLGHPASPGGSEDGPPGSEEEDAAR	34	sp|Q99856|ARI3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21,15-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=9986	49.209	3	2829.1156	2829.1156	R	E	67	96
PSM	AASADSTTEGTPADGFTVLSTK	35	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	22-UNIMOD:188	ms_run[2]:scan=16819	82.886	2	2132.0217	2132.0217	K	S	168	190
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	36	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12129	59.586	3	3173.2435	3173.2435	R	-	502	532
PSM	FVEEEDDDEEEEEENLDDQDEQGNLK	37	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14239	69.928	3	3140.2225	3140.2225	K	G	30	56
PSM	GPDKLLPYPTLASPASD	38	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=21867	109.77	2	1820.8597	1820.8597	R	-	228	245
PSM	HIEDTGSTPSIGENDLK	39	sp|Q6R327|RICTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21,10-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=12358	60.681	2	1977.8065	1977.8065	K	F	1168	1185
PSM	LAPVPSPEPQKPAPVSPESVK	40	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=13064	64.096	2	2313.1059	2313.1059	K	A	199	220
PSM	LAPVPSPEPQKPAPVSPESVK	41	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,11-UNIMOD:188,16-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=13318	65.407	2	2325.1461	2325.1461	K	A	199	220
PSM	NGVIQHTGAAAEEFNDDTD	42	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:21	ms_run[2]:scan=11721	57.623	2	2082.8168	2082.8168	R	-	646	665
PSM	RGGGSGGGEESEGEEVDED	43	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=3199	17.266	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	44	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=3425	18.367	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	45	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=4687	24.335	2	1930.6702	1930.6702	R	-	294	313
PSM	TEEEEEEEEEEEEDDEEEEGDDEGQK	46	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	26-UNIMOD:188	ms_run[2]:scan=8172	40.732	3	3149.1067	3149.1067	K	S	269	295
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	47	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11327	55.805	3	2831.1125	2831.1125	R	T	60	86
PSM	GGSFGGRSSGSPYGGGYGSGGGSGGYGSR	48	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10418	51.285	3	2688.0028	2688.0028	K	R	326	355
PSM	GPPASSPAPAPKFSPVTPK	49	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=12787	62.764	2	2003.9562	2003.9562	R	F	97	116
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	50	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17554	86.631	3	2729.1371	2729.1371	K	S	61	87
PSM	GRLTPSPDIIVLSDNEASSPR	51	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,4-UNIMOD:21,13-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=19332	95.873	2	2403.0987	2403.0987	R	S	117	138
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	52	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=16416	80.921	3	3021.351	3021.3510	R	D	374	402
PSM	SAEIDSDDTGGSAAQK	53	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:188	ms_run[2]:scan=1801	10.479	2	1556.6898	1556.6898	K	Q	814	830
PSM	SCVEEPEPEPEAAEGDGDK	54	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=7695	38.544	2	2049.8416	2049.8416	K	K	100	119
PSM	SHSQASLAGPGPVDPSNR	55	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=8350	41.57	2	1935.7877	1935.7877	R	S	129	147
PSM	STPLASPSPSPGRSPQR	56	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=6140	31.144	2	1880.8183	1880.8183	R	L	1209	1226
PSM	SVPVTVDDDDDDNDPENR	57	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8319	41.424	2	2015.8192	2015.8192	K	I	1185	1203
PSM	SVPVTVDDDDDDNDPENR	58	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8524	42.429	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TEGDEEAEEEQEENLEASGDYK	59	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12003	58.959	3	2499.9885	2499.9885	K	Y	10	32
PSM	TPAPPEPGSPAPGEGPSGR	60	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7233	36.296	2	1846.8126	1846.8126	R	K	163	182
PSM	TPGNPATAVSGTPAPPAR	61	sp|Q9Y2T7|YBOX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=8159	40.67	2	1750.8279	1750.8279	R	S	65	83
PSM	TTTTNTQVEGDDEAAFLER	62	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=15504	76.247	2	2106.9581	2106.9581	K	L	75	94
PSM	TTTTNTQVEGDDEAAFLER	63	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=15526	76.347	2	2096.9498	2096.9498	K	L	75	94
PSM	TVIRLPSGSGAASPTGSAVDIR	64	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18138	89.667	2	2271.0661	2271.0661	K	A	204	226
PSM	SVPVTVDDDDDDNDPENR	65	sp|P46100|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=8818	43.800684999999994	2	2017.826590	2015.819202	K	I	1253	1271
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	66	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	26-UNIMOD:267	ms_run[1]:scan=11500	56.58137833333333	3	2842.120524	2841.120812	R	T	60	86
PSM	RGGGSGGGEESEGEEVDED	67	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=4191	22.032768333333333	2	1941.690975	1940.678438	R	-	294	313
PSM	AAAASAAEAGIATTGTEDSDDALLK	68	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17052	84.075	3	2319.1078	2319.1078	R	M	238	263
PSM	AADSDDGAVSAPAASDGGVSK	69	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5605	28.724	2	1846.8181	1846.8181	M	S	2	23
PSM	AQTPPGPSLSGSKSPCPQEK	70	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7313	36.689	2	2211.9273	2211.9273	K	S	1001	1021
PSM	EAGVEMGDEDDLSTPNEK	71	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=11484	56.503	2	1940.8253	1940.8253	R	L	257	275
PSM	EQEAEPEEQEEDSSSDPR	72	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=3236	17.427	2	2099.8279	2099.8279	K	L	68	86
PSM	FSPPSPLPQAVFSTSSR	73	sp|Q99594|TEAD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=21999	110.53	2	1893.8901	1893.8901	K	F	144	161
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	74	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=22452	113.21	2	2441.1802	2441.1802	R	S	258	284
PSM	GIPLATGDTSPEPELLPGAPLPPPK	75	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=24481	126.36	2	2549.3126	2549.3126	K	E	33	58
PSM	GIPLATGDTSPEPELLPGAPLPPPK	76	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=24632	127.33	3	2549.3126	2549.3126	K	E	33	58
PSM	LAPVPSPEPQKPAPVSPESVK	77	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,11-UNIMOD:188,16-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=13070	64.12	2	2325.1461	2325.1461	K	A	199	220
PSM	PASPSSPEHLPATPAESPAQR	78	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10254	50.477	2	2285.9719	2285.9719	R	F	232	253
PSM	PASPSSPEHLPATPAESPAQR	79	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=10460	51.505	2	2285.9719	2285.9719	R	F	232	253
PSM	RGGGSGGGEESEGEEVDED	80	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2572	14.195	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	81	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=2702	14.839	2	1930.6702	1930.6702	R	-	294	313
PSM	RNSSSPVSPASVPGQR	82	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=6383	32.295	2	1784.7608	1784.7608	R	R	655	671
PSM	SRINSSGESGDESDEFLQSR	83	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=12962	63.599	2	2358.9003	2358.9003	R	K	178	198
PSM	SSKASLGSLEGEAEAEASSPKGK	84	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=16910	83.345	2	2458.9907	2458.9907	K	F	5745	5768
PSM	SVPVTVDDDDDDNDPENR	85	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=8314	41.405	2	2025.8275	2025.8275	K	I	1185	1203
PSM	TNPEDIYPSNPTDDDVSSGSSSER	86	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12265	60.229	3	2568.0736	2568.0736	R	S	163	187
PSM	TPAPPEPGSPAPGEGPSGR	87	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=7439	37.318	2	1846.8126	1846.8126	R	K	163	182
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	88	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=15643	76.942	3	2894.3576	2894.3576	K	H	557	585
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	89	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	26-UNIMOD:267	ms_run[2]:scan=11337	55.852	3	2841.1208	2841.1208	R	T	60	86
PSM	VDENFDCVEADDVEGK	90	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:4	ms_run[2]:scan=13554	66.554	2	1839.7469	1839.7469	K	I	10	26
PSM	VSPSKSPSLSPSPPSPLEK	91	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12565	61.675	2	2079.9531	2079.9531	K	T	1251	1270
PSM	VVSDADDSDSDAVSDK	92	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:188	ms_run[2]:scan=2729	14.959	2	1629.6949	1629.6949	R	S	413	429
PSM	VSPSKSPSLSPSPPSPLEK	93	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:188,10-UNIMOD:21,15-UNIMOD:21,19-UNIMOD:188	ms_run[1]:scan=12411	60.90504	2	2093.006267	2091.993328	K	T	1251	1270
PSM	DEDDDEEEEEEGGSWGR	94	sp|O00165|HAX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	17-UNIMOD:267	ms_run[1]:scan=9055	44.88908	2	1992.714361	1991.701602	R	G	30	47
PSM	TVTPASSAKTSPAKQQAPPVR	95	sp|Q16555|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:21,3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=5015	25.918691666666664	2	2362.063170	2361.053209	K	N	512	533
PSM	AEAGPESAAGGQEEEEGEDEEELSGTK	96	sp|Q8N5A5-3|ZGPAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10808	53.217	3	2734.1213	2734.1213	K	V	107	134
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	97	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14507	71.273	3	2789.2772	2789.2772	R	T	112	140
PSM	EGPEPPEEVPPPTTPPVPK	98	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14377	70.623	2	2078.9909	2078.9909	K	V	597	616
PSM	ENAEVDGDDDAEEMEAK	99	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=8041	40.144	2	1871.731	1871.7310	R	A	296	313
PSM	GPDKLLPYPTLASPASD	100	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:188,16-UNIMOD:21	ms_run[2]:scan=22060	110.88	2	1826.8799	1826.8799	R	-	228	245
PSM	GSLAEAVGSPPPAATPTPTPPTR	101	sp|Q9Y6I3-3|EPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=13369	65.644	3	2251.0886	2251.0886	R	K	420	443
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	102	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=16385	80.76	3	3011.3427	3011.3427	R	D	374	402
PSM	IACEEEFSDSEEEGEGGRK	103	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8269	41.188	2	2316.8131	2316.8131	R	N	414	433
PSM	IACEEEFSDSEEEGEGGRK	104	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9273	45.912	2	2316.8131	2316.8131	R	N	414	433
PSM	ILQEKLDQPVSAPPSPR	105	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12609	61.889	2	2033.9588	2033.9588	R	D	230	247
PSM	KAEDSDSEPEPEDNVR	106	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3901	20.669	2	1975.7085	1975.7085	R	L	419	435
PSM	KAEDSDSEPEPEDNVR	107	sp|Q9H0D6-2|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4118	21.672	2	1975.7085	1975.7085	R	L	419	435
PSM	KPVTVSPTTPTSPTEGEAS	108	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=8147	40.615	2	1964.898	1964.8980	R	-	505	524
PSM	KPVTVSPTTPTSPTEGEAS	109	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,19-UNIMOD:21	ms_run[2]:scan=8717	43.317	2	1970.9181	1970.9181	R	-	505	524
PSM	KVSSSSPQSGCPSPTIPAGK	110	sp|Q76L83|ASXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,6-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6611	33.39	2	2142.9461	2142.9461	R	V	134	154
PSM	LAPVPSPEPQKPAPVSPESVK	111	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=13259	65.102	2	2313.1059	2313.1059	K	A	199	220
PSM	QPPGVPNGPSSPTNESAPELPQR	112	sp|Q8TF74-2|WIPF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=13450	66.032	2	2435.1118	2435.1118	R	H	107	130
PSM	RGGGSGGGEESEGEEVDED	113	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2304	12.895	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	114	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2994	16.257	2	1940.6784	1940.6784	R	-	294	313
PSM	SEVNDDQDAILCEASCQK	115	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=13872	68.136	2	2080.8677	2080.8677	R	W	335	353
PSM	SLGGESSGGTTPVGSFHTEAAR	116	sp|O15085|ARHGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=12234	60.077	2	2263.9148	2263.9148	K	W	1452	1474
PSM	SLGGESSGGTTPVGSFHTEAAR	117	sp|O15085|ARHGB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,11-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=12212	59.974	2	2273.9231	2273.9231	K	W	1452	1474
PSM	SPAPGALGQSPLQPFPR	118	sp|P43268-2|ETV4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=18990	94.082	2	1798.8767	1798.8767	K	A	101	118
PSM	SPAPGALGQSPLQPFPR	119	sp|P43268-2|ETV4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=18840	93.306	2	1808.885	1808.8850	K	A	101	118
PSM	SRINSSGESGDESDEFLQSR	120	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,9-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=12944	63.519	2	2378.9168	2378.9168	R	K	178	198
PSM	SRSLSNSNPDISGTPTSPDDEVR	121	sp|Q96N67-4|DOCK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=10663	52.468	3	2590.0585	2590.0586	R	S	894	917
PSM	TGKEYIPGQPPLSQSSDSSPTR	122	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=13034	63.954	2	2491.0669	2491.0669	K	N	868	890
PSM	TGSTSSKEDDYESDAATIVQK	123	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=13745	67.535	2	2310.9741	2310.9741	R	C	360	381
PSM	TSSKESSPIPSPTSDRK	124	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3411	18.296	2	2042.8	2042.8000	R	A	2159	2176
PSM	TYVDLTNEETTDSTTSK	125	sp|O95551|TYDP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10693	52.616	2	1903.8535	1903.8535	K	I	83	100
PSM	VEEEQEADEEDVSEEEAESKEGTNK	126	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=8285	41.264	2	2918.135	2918.1350	K	D	235	260
PSM	VQTDAFVSNELDDPDDLQCK	127	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:4	ms_run[2]:scan=19060	94.451	2	2308.0165	2308.0165	R	R	446	466
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	128	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=12283	60.322076666666675	3	2832.114431	2831.112543	R	T	60	86
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	129	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=20123	100.17163333333333	3	2750.170760	2749.153674	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	130	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=17105	84.36596	3	2729.153129	2729.137136	K	S	61	87
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	131	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21,15-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=19205	95.20660333333333	3	3664.631180	3664.614058	R	A	397	429
PSM	RGGGSGGGEESEGEEVDED	132	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:21	ms_run[1]:scan=3759	19.991568333333333	2	1931.682886	1930.670169	R	-	294	313
PSM	LVQDVANNTNEEAGDGTTTATVLAR	133	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	25-UNIMOD:267	ms_run[1]:scan=13960	68.559895	3	2570.244429	2569.249522	K	S	97	122
PSM	AAAASAAEAGIATTGTEDSDDALLK	134	sp|P55036|PSMD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	25-UNIMOD:188	ms_run[2]:scan=17083	84.246	2	2325.1279	2325.1279	R	M	238	263
PSM	AEDGSVIDYELIDQDAR	135	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=19977	99.379	2	1917.8831	1917.8831	R	D	180	197
PSM	DLDEDELLGNLSETELK	136	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24661	127.53	2	1931.9211	1931.9211	K	Q	14	31
PSM	DNDPNDYVEQDDILIVK	137	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=20942	104.58	2	2009.9525	2009.9525	R	L	136	153
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	138	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=14691	72.189	3	2967.1987	2967.1987	R	V	489	518
PSM	EGPEPPEEVPPPTTPPVPK	139	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14576	71.634	2	2078.9909	2078.9909	K	V	597	616
PSM	ENAEVDGDDDAEEMEAK	140	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8028	40.087	2	1865.7109	1865.7109	R	A	296	313
PSM	ETDYPAGEDLSESGQVDK	141	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10495	51.688	2	1938.8331	1938.8331	R	A	789	807
PSM	ETTDTDTADQVIASFK	142	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=20347	101.36	2	1740.8054	1740.8054	R	V	838	854
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	143	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=22415	113	3	2431.1719	2431.1719	R	S	258	284
PSM	GPPASSPAPAPKFSPVTPK	144	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=12781	62.731	2	1991.9159	1991.9159	R	F	97	116
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	145	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16705	82.341	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	146	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17752	87.666	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	147	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=18147	89.708	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	148	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,11-UNIMOD:267,14-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=17068	84.16	2	2749.1537	2749.1537	K	S	61	87
PSM	IPGGNIYISPLKSPYK	149	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=20143	100.28	2	1905.9043	1905.9043	R	I	799	815
PSM	IPGGNIYISPLKSPYK	150	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,12-UNIMOD:188,13-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=19925	99.099	2	1917.9445	1917.9445	R	I	799	815
PSM	ISTPQTNTVPIKPLISTPPVSSQPK	151	sp|Q9BTA9-5|WAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=19625	97.464	3	2801.442	2801.4420	R	V	352	377
PSM	KPVTVSPTTPTSPTEGEAS	152	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=8362	41.628	2	1964.898	1964.8980	R	-	505	524
PSM	LKAESISEEADSEPGR	153	sp|Q9NSI6-2|BRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=8729	43.376	2	1876.7493	1876.7493	K	S	1782	1798
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	154	sp|Q9C0E8-3|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=14536	71.429	3	2539.2472	2539.2472	R	D	52	77
PSM	RFSDSEGEETVPEPR	155	sp|Q13286-5|CLN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=10207	50.251	2	1893.7183	1893.7183	R	L	10	25
PSM	RFSDSEGEETVPEPR	156	sp|Q13286-5|CLN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=9993	49.242	2	1893.7183	1893.7183	R	L	10	25
PSM	RNPSCGSDNDSVQPVR	157	sp|Q9HCS5|E41LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=3436	18.42	2	1946.7343	1946.7343	R	R	442	458
PSM	RNSSSPVSPASVPGQR	158	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6227	31.541	2	1804.7773	1804.7773	R	R	655	671
PSM	SEDEAGCSSVDEESYK	159	sp|Q7L4I2-2|RSRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4	ms_run[2]:scan=5515	28.288	2	1790.6789	1790.6789	K	T	328	344
PSM	SHSESASPSALSSSPNNLSPTGWSQPK	160	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=16707	82.346	3	2899.2063	2899.2063	R	T	283	310
PSM	SPSSLSANIISSPKGSPSSSR	161	sp|Q8NFA0|UBP32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=12786	62.761	2	2204.9716	2204.9716	K	K	1361	1382
PSM	SRSSSVGSSSSYPISPAVSR	162	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=10422	51.304	2	2156.9141	2156.9141	R	T	4213	4233
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	163	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=19932	99.138	3	2692.1753	2692.1753	R	L	42	66
PSM	STPLASPSPSPGRSPQR	164	sp|Q8WYP5|ELYS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,13-UNIMOD:267,14-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=6186	31.37	2	1900.8348	1900.8348	R	L	1209	1226
PSM	SVPVTVDDDDDDNDPENR	165	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=8521	42.415	2	2025.8275	2025.8275	K	I	1185	1203
PSM	SVPVTVDDDDDDNDPENR	166	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:267	ms_run[2]:scan=8739	43.426	2	2025.8275	2025.8275	K	I	1185	1203
PSM	TEGDEEAEEEQEENLEASGDYK	167	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12020	59.041	2	2499.9885	2499.9885	K	Y	10	32
PSM	TFEEALARGDAASSPAPAASVGSSQGGAR	168	sp|Q8WVB6|CTF18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=14368	70.578	3	2877.2332	2877.2332	R	K	51	80
PSM	TGSTSSKEDDYESDAATIVQK	169	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=12371	60.734	2	2310.9741	2310.9741	R	C	360	381
PSM	TGSTSSKEDDYESDAATIVQK	170	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=13546	66.527	2	2310.9741	2310.9741	R	C	360	381
PSM	TRGTPEDGACEGSPLEEK	171	sp|Q5T481|RBM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=5791	29.529	2	2091.7857	2091.7857	K	A	1068	1086
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	172	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11901	58.453	3	2831.1125	2831.1125	R	T	60	86
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	173	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	26-UNIMOD:267	ms_run[2]:scan=11892	58.412	3	2841.1208	2841.1208	R	T	60	86
PSM	VVSQSQPGSRSSSPGKLLGSGYGGLTGGSSR	174	sp|Q7Z460-4|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18090	89.443	3	3189.3894	3189.3894	K	G	683	714
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	175	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=11493	56.548809999999996	3	2832.112739	2831.112543	R	T	60	86
PSM	TSSDDESEEDEDDLLQR	176	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	17-UNIMOD:267	ms_run[1]:scan=11609	57.09933833333333	2	1992.798191	1991.795502	K	T	204	221
PSM	QASTDAGTAGALTPQHVR	177	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=10822	53.27239333333333	2	1842.8345	1842.8256	R	A	107	125
PSM	ILQEKLDQPVSAPPSPR	178	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:188,11-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:267	ms_run[1]:scan=12819	62.933255	2	2051.001233	2049.987222	R	D	230	247
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	179	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12319	60.495	3	3183.2517	3183.2517	R	-	502	532
PSM	ARSVDALDDLTPPSTAESGSR	180	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=15351	75.488	3	2303.9672	2303.9672	R	S	335	356
PSM	DIDDDLEGEVTEECGK	181	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=16666	82.153	2	1828.7616	1828.7616	K	F	414	430
PSM	DSAIPVESDTDDEGAPR	182	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=9639	47.583	2	1772.7701	1772.7701	R	I	461	478
PSM	DVDIDSYPDEELPCSAR	183	sp|P35443|TSP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4	ms_run[2]:scan=17002	83.808	2	1979.8419	1979.8419	K	N	464	481
PSM	EEEEEEEEYDEGSNLK	184	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=8588	42.716	2	1962.7797	1962.7797	K	K	231	247
PSM	EEEEEEEEYDEGSNLK	185	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8591	42.731	2	1956.7596	1956.7596	K	K	231	247
PSM	EGPEPPEEVPPPTTPPVPK	186	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=14514	71.311	2	2072.9708	2072.9708	K	V	597	616
PSM	EGPEPPEEVPPPTTPPVPK	187	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14783	72.648	2	2078.9909	2078.9909	K	V	597	616
PSM	ERESSANNSVSPSESLR	188	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,5-UNIMOD:21,11-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=6107	30.998	2	2027.8101	2027.8101	R	A	193	210
PSM	ESSITSCCSTSSCDADDEGVR	189	sp|Q9UIC8-3|LCMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7145	35.912	2	2321.8682	2321.8682	R	G	7	28
PSM	ETDYPAGEDLSESGQVDK	190	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=10509	51.753	2	1944.8532	1944.8532	R	A	789	807
PSM	FSPPSPLPQAVFSTSSR	191	sp|Q99594|TEAD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=22123	111.25	2	1883.8819	1883.8819	K	F	144	161
PSM	FSPPSPLPQAVFSTSSR	192	sp|Q99594|TEAD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=22175	111.55	2	1893.8901	1893.8901	K	F	144	161
PSM	GGSDGTPRGSPSPASVSSGR	193	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,8-UNIMOD:267,10-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=3630	19.362	2	1994.7999	1994.7999	R	K	248	268
PSM	GPDKLLPYPTLASPASD	194	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=22038	110.77	2	1820.8597	1820.8597	R	-	228	245
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	195	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=15914	78.308	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	196	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16912	83.357	3	2729.1371	2729.1371	K	S	61	87
PSM	GRLTPSPDIIVLSDNEASSPR	197	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=20357	101.41	2	2383.0822	2383.0822	R	S	117	138
PSM	GTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPR	198	sp|Q8WUZ0|BCL7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,14-UNIMOD:267,17-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=13059	64.076	3	3438.5397	3438.5397	K	L	110	143
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	199	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=14733	72.407	3	3011.3427	3011.3427	R	D	374	402
PSM	IKTEPSSPLSDPSDIIR	200	sp|Q9ULJ3-2|ZBT21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16899	83.29	2	2013.9061	2013.9061	R	V	429	446
PSM	ISTPQTNTVPIKPLISTPPVSSQPK	201	sp|Q9BTA9-5|WAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=19585	97.245	3	2789.4017	2789.4017	R	V	352	377
PSM	KCQTLFGFDSDDESA	202	sp|Q8IZM8|ZN654_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=20877	104.23	2	1798.6757	1798.6757	K	-	567	582
PSM	KVSSSSPQSGCPSPTIPAGK	203	sp|Q76L83|ASXL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=6621	33.433	3	2130.9058	2130.9058	R	V	134	154
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	204	sp|Q9C0E8-3|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=14263	70.04	3	2545.2673	2545.2673	R	D	52	77
PSM	RGGGSGGGEESEGEEVDED	205	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=4456	23.244	2	1930.6702	1930.6702	R	-	294	313
PSM	SAEIDSDDTGGSAAQK	206	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1797	10.461	2	1550.6696	1550.6696	K	Q	814	830
PSM	SASSFEGRSVPATPVLTR	207	sp|Q96HB5-2|CC120_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=14059	69.055	2	2020.902	2020.9020	R	G	282	300
PSM	SEDEAGCSSVDEESYK	208	sp|Q7L4I2-2|RSRC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=5510	28.259	2	1796.699	1796.6990	K	T	328	344
PSM	SGGGPGPSGSETPPPPR	209	sp|P27987-2|IP3KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=3286	17.659	2	1612.6883	1612.6883	K	R	22	39
PSM	SPAPGALGQSPLQPFPR	210	sp|P43268-2|ETV4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=19042	94.36	2	1808.885	1808.8850	K	A	101	118
PSM	SRINSSGESGDESDEFLQSR	211	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=11842	58.169	3	2358.9003	2358.9003	R	K	178	198
PSM	SRINSSGESGDESDEFLQSR	212	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=13032	63.948	3	2358.9003	2358.9003	R	K	178	198
PSM	SSKASLGSLEGEAEAEASSPKGK	213	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=16818	82.884	3	2458.9907	2458.9907	K	F	5745	5768
PSM	TFEEALARGDAASSPAPAASVGSSQGGAR	214	sp|Q8WVB6|CTF18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:267,14-UNIMOD:21,23-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=14478	71.116	3	2897.2497	2897.2497	R	K	51	80
PSM	TGSTSSKEDDYESDAATIVQK	215	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=13538	66.489	3	2310.9741	2310.9741	R	C	360	381
PSM	TPAPPEPGSPAPGEGPSGR	216	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=7224	36.258	2	1836.8044	1836.8044	R	K	163	182
PSM	TSSKESSPIPSPTSDRK	217	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3835	20.355	2	2042.8	2042.8000	R	A	2159	2176
PSM	TVTPASSAKTSPAKQQAPPVR	218	sp|Q16555-2|DPYL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4760	24.663	2	2361.0532	2361.0532	K	N	476	497
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	219	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	26-UNIMOD:267	ms_run[2]:scan=11726	57.649	2	2841.1208	2841.1208	R	T	60	86
PSM	VDENFDCVEADDVEGK	220	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=13556	66.561	2	1845.767	1845.7670	K	I	10	26
PSM	VEEEQEADEEDVSEEEAESKEGTNK	221	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=8273	41.208	3	2918.135	2918.1350	K	D	235	260
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	222	sp|Q4KMQ1|TPRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=11632	57.215	3	3336.4701	3336.4701	K	Q	252	285
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	223	sp|Q4KMQ1|TPRN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=11859	58.25	3	3336.4701	3336.4701	K	Q	252	285
PSM	VSVCAETYNPDEEEEDTDPR	224	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11962	58.75	2	2363.9575	2363.9575	R	V	98	118
PSM	SSGGKGGSCSQAACSNSAQGSDESLITCKA	225	sp|P10321|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:188,9-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:21,24-UNIMOD:21,28-UNIMOD:4,29-UNIMOD:188	ms_run[1]:scan=9041	44.825583333333334	3	3134.224392	3133.222783	K	-	337	367
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	226	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,14-UNIMOD:267,16-UNIMOD:21,33-UNIMOD:267	ms_run[1]:scan=11452	56.36105666666666	3	3281.3962	3281.3822	R	G	54	87
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	227	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=11162	54.98973833333333	3	3261.3812	3261.3652	R	G	54	87
PSM	SQKQEEENPAEETGEEK	228	sp|O43768|ENSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1	ms_run[1]:scan=4006	21.140756666666668	2	2002.8694	2002.8598	M	Q	2	19
PSM	QGLGPASTTSPSPGPRSPK	229	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,16-UNIMOD:267,17-UNIMOD:21,19-UNIMOD:188	ms_run[1]:scan=9031	44.782711666666664	2	1899.9162	1899.9062	R	A	890	909
PSM	LVQDVANNTNEEAGDGTTTATVLAR	230	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0		ms_run[1]:scan=13959	68.55721333333334	3	2560.2332	2559.2412	K	S	97	122
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	231	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=18916	93.7123	3	3045.279438	3044.280171	K	-	178	207
PSM	SGTPPRQGSITSPQANEQSVTPQRR	232	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,3-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=7663	38.406013333333334	3	2921.271122	2918.247446	K	S	846	871
PSM	ALTSADGASEEQSQNDEDNQGSEK	233	sp|Q92552|RT27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	24-UNIMOD:188	ms_run[2]:scan=3796	20.169	3	2515.0526	2515.0526	K	L	289	313
PSM	APSDSSLGTPSDGRPELR	234	sp|Q15642-2|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=9566	47.256	2	2000.8242	2000.8242	R	G	294	312
PSM	DNDPNDYVEQDDILIVK	235	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20947	104.61	2	2003.9324	2003.9324	R	L	136	153
PSM	DSAIPVESDTDDEGAPR	236	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:267	ms_run[2]:scan=9428	46.637	2	1782.7783	1782.7783	R	I	461	478
PSM	DYPDFSPSVDAEAIQK	237	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=18299	90.497	2	1780.8156	1780.8156	R	A	14	30
PSM	EAGVEMGDEDDLSTPNEK	238	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11467	56.426	2	1934.8051	1934.8051	R	L	257	275
PSM	EATVQEVDVIPEDGAADVR	239	sp|O43824|GTPB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17335	85.549	2	2011.9698	2011.9698	K	V	481	500
PSM	EGPEPPEEVPPPTTPPVPK	240	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=14949	73.449	2	2072.9708	2072.9708	K	V	597	616
PSM	ELEKPIQSKPQSPVIQAAAVSPK	241	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=13408	65.835	3	2684.2629	2684.2629	R	F	207	230
PSM	ETTDTDTADQVIASFK	242	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20544	102.41	2	1740.8054	1740.8054	R	V	838	854
PSM	GGNLPPVSPNDSGAKIASNPLER	243	sp|Q9UK61-2|TASOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=16613	81.895	3	2449.104	2449.1040	K	H	659	682
PSM	GGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAK	244	sp|Q9BXK1|KLF16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,23-UNIMOD:21,26-UNIMOD:267,37-UNIMOD:188	ms_run[2]:scan=6734	33.95	3	3182.4002	3178.4120	R	S	89	126
PSM	GIPLATGDTSPEPELLPGAPLPPPK	245	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=24129	124.1	2	2543.2924	2543.2924	K	E	33	58
PSM	GIPLATGDTSPEPELLPGAPLPPPK	246	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=24277	125.12	2	2543.2924	2543.2924	K	E	33	58
PSM	GIPLATGDTSPEPELLPGAPLPPPK	247	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=24275	125.11	2	2549.3126	2549.3126	K	E	33	58
PSM	GPDKLLPYPTLASPASD	248	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:188,13-UNIMOD:21	ms_run[2]:scan=21880	109.85	2	1826.8799	1826.8799	R	-	228	245
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	249	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17283	85.303	2	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	250	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17349	85.625	3	2729.1371	2729.1371	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	251	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=16156	79.559	3	2749.1537	2749.1537	K	S	61	87
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	252	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=19134	94.854	3	2749.1537	2749.1537	K	S	61	87
PSM	GSPSPAAPGPPAGPLPR	253	sp|Q6F5E8-2|CARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=11900	58.451	2	1604.7712	1604.7712	R	M	954	971
PSM	IACEEEFSDSEEEGEGGRK	254	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8694	43.216	2	2316.8131	2316.8131	R	N	414	433
PSM	IACEEEFSDSEEEGEGGRK	255	sp|Q13547|HDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8908	44.232	2	2316.8131	2316.8131	R	N	414	433
PSM	KPVTVSPTTPTSPTEGEAS	256	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=8709	43.282	2	1964.898	1964.8980	R	-	505	524
PSM	LDNVPHTPSSYIETLPK	257	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21276	106.44	2	2075.9313	2075.9313	R	A	45	62
PSM	LEDGQTADGQTEEAAEPGEQLQTQK	258	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=9841	48.51	3	2672.2049	2672.2049	R	R	77	102
PSM	NAASFPLRSPQPVCSPAGSEGTPK	259	sp|Q6KC79-3|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=14326	70.375	3	2614.1288	2614.1288	R	G	266	290
PSM	NAASFPLRSPQPVCSPAGSEGTPK	260	sp|Q6KC79-3|NIPBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=14285	70.17	2	2614.1288	2614.1288	R	G	266	290
PSM	PASPSSPEHLPATPAESPAQR	261	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,5-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=10320	50.803	2	2295.9802	2295.9802	R	F	232	253
PSM	RAASVAAATTSPTPR	262	sp|Q9Y2D9|ZN652_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,4-UNIMOD:21,11-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=3552	19.006	2	1635.7286	1635.7286	R	T	194	209
PSM	RALSSDSILSPAPDAR	263	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,4-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=13891	68.224	2	1834.813	1834.8130	R	A	391	407
PSM	RGGGSGGGEESEGEEVDED	264	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2787	15.228	2	1940.6784	1940.6784	R	-	294	313
PSM	RGGGSGGGEESEGEEVDED	265	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=2065	11.796	2	1930.6702	1930.6702	R	-	294	313
PSM	RNSSSPVSPASVPGQR	266	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7205	36.178	2	1784.7608	1784.7608	R	R	655	671
PSM	SAPASPNHAGVLSAHSSGAQTPESLSR	267	sp|Q01167-2|FOXK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,5-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=11625	57.177	3	2855.1678	2855.1678	R	E	369	396
PSM	SEDESETEDEEEKSQEDQEQK	268	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=3614	19.292	2	2606.9505	2606.9505	R	R	668	689
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	269	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=7290	36.568	3	2856.1094	2856.1094	R	S	161	188
PSM	SPSFGDPQLSPEARPR	270	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=13125	64.4	2	1919.8083	1919.8083	R	C	261	277
PSM	SRTASGSSVTSLDGTR	271	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5688	29.056	2	1740.7081	1740.7081	R	S	245	261
PSM	SSKASLGSLEGEAEAEASSPKGK	272	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17018	83.891	3	2458.9907	2458.9907	K	F	5745	5768
PSM	SSPPLRTPDVLESSGPAVR	273	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,6-UNIMOD:267,7-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16361	80.627	2	2143.9819	2143.9819	R	S	675	694
PSM	TEQEEDEELLTESSK	274	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11728	57.655	2	1765.7741	1765.7741	R	A	146	161
PSM	TEQGEEEEEEEDEEEEEK	275	sp|P98175-2|RBM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=5065	26.123	2	2230.834	2230.8340	R	A	109	127
PSM	TLEAEFNSPSPPTPEPGEGPR	276	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=16094	79.231	3	2298.0081	2298.0081	K	K	113	134
PSM	TSPDEDEDDLLPPEQK	277	sp|P15923|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=12698	62.332	2	1832.8259	1832.8259	R	A	528	544
PSM	TSQCSSPSLSASPGSPTRPQIR	278	sp|P37275-3|ZEB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=10405	51.221	3	2470.0588	2470.0588	K	Q	241	263
PSM	TSSKESSPIPSPTSDRK	279	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3203	17.285	2	2042.8	2042.8000	R	A	2159	2176
PSM	TSSKESSPIPSPTSDRK	280	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3621	19.325	2	2042.8	2042.8000	R	A	2159	2176
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	281	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,10-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=15516	76.306	3	2914.3742	2914.3742	K	H	557	585
PSM	TYVDLTNEETTDSTTSK	282	sp|O95551|TYDP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=10662	52.464	2	1909.8736	1909.8736	K	I	83	100
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	283	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11945	58.657	2	2831.1125	2831.1125	R	T	60	86
PSM	VEDYDAADDVQLSK	284	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11399	56.127	2	1566.7049	1566.7049	R	T	339	353
PSM	VSVCAETYNPDEEEEDTDPR	285	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=11967	58.776	2	2353.9492	2353.9492	R	V	98	118
PSM	VVSDADDSDSDAVSDK	286	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2712	14.881	2	1623.6748	1623.6748	R	S	413	429
PSM	EGPEPPEEVPPPTTPPVPK	287	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=14108	69.29593	2	2073.984282	2072.970755	K	V	597	616
PSM	QRQTSPTPASPSPPAAPCPFVAR	288	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,2-UNIMOD:267,5-UNIMOD:21,18-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=15688	77.175235	3	2502.1772	2502.1622	K	G	1595	1618
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	289	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=11379	56.039285	3	3261.3812	3261.3652	R	G	54	87
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	290	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	26-UNIMOD:267	ms_run[1]:scan=12286	60.33647	3	2842.122266	2841.120812	R	T	60	86
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	291	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	26-UNIMOD:267	ms_run[1]:scan=11659	57.33840333333333	3	2842.120524	2841.120812	R	T	60	86
PSM	QGGRCSPVPGLSSSPSGSPLHGK	292	sp|Q9H6U6|BCAS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,5-UNIMOD:4,6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=13773	67.66280666666667	3	2391.0202	2391.0072	K	L	475	498
PSM	RACASPSAQVEGSPVAGSDGSQPAVK	293	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:267,3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21,26-UNIMOD:188	ms_run[1]:scan=8036	40.12227333333333	3	2689.170005	2688.158674	K	L	247	273
PSM	LFGASSPPPGAVPSGPPLSR	294	sp|Q8N4L1|T151A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21	ms_run[1]:scan=20100	100.03780666666667	2	1970.977804	1969.966278	K	V	318	338
PSM	LIHGEDSDSEGEEEGR	295	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=3592	19.181163333333334	2	1918.679707	1917.666678	R	G	81	97
PSM	NSESESNKVAAETQSPSLFGSTK	296	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:21	ms_run[1]:scan=14681	72.131805	3	2478.093228	2477.095908	R	L	207	230
PSM	FSGISGCSDGVSQEGSASSTK	297	sp|Q6R327|RICTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:21,7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=8108	40.42777666666667	2	2369.732569	2366.745352	K	S	1570	1591