MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH04.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH04.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null	68-UNIMOD:267	0.05	53.0	4	1	0
PRT	sp|Q9NWV8-3|BABA1_HUMAN	Isoform 3 of BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.14	53.0	1	1	1
PRT	sp|Q15361|TTF1_HUMAN	Transcription termination factor 1 OS=Homo sapiens OX=9606 GN=TTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null		0.02	53.0	1	1	1
PRT	sp|Q9H0U9|TSYL1_HUMAN	Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	null	140-UNIMOD:21	0.05	52.0	1	1	1
PRT	sp|Q12929-2|EPS8_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.04	50.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	741-UNIMOD:4	0.01	50.0	1	1	1
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	1800-UNIMOD:21,1823-UNIMOD:188	0.01	50.0	7	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	679-UNIMOD:21,683-UNIMOD:21,692-UNIMOD:188,678-UNIMOD:21	0.03	49.0	8	1	0
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	189-UNIMOD:188	0.06	49.0	3	1	0
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	909-UNIMOD:21,912-UNIMOD:188,927-UNIMOD:188	0.02	49.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	121-UNIMOD:267	0.05	49.0	12	1	0
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	49.0	null	197-UNIMOD:188,179-UNIMOD:28	0.05	49.0	10	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.03	48.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	128-UNIMOD:188	0.06	48.0	2	1	0
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	263-UNIMOD:21,279-UNIMOD:4,283-UNIMOD:267	0.01	48.0	9	1	0
PRT	sp|Q5TC82-2|RC3H1_HUMAN	Isoform 2 of Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	531-UNIMOD:21,535-UNIMOD:21,530-UNIMOD:21,545-UNIMOD:188	0.02	48.0	4	1	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	1517-UNIMOD:21,1519-UNIMOD:21,1510-UNIMOD:188,1527-UNIMOD:188,1395-UNIMOD:21	0.03	48.0	12	2	1
PRT	sp|Q96B97-3|SH3K1_HUMAN	Isoform 3 of SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	237-UNIMOD:188	0.04	48.0	2	1	0
PRT	sp|Q7KZ85-2|SPT6H_HUMAN	Isoform 2 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	349-UNIMOD:21,354-UNIMOD:21,350-UNIMOD:267,369-UNIMOD:267,351-UNIMOD:21	0.04	48.0	3	1	0
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	86-UNIMOD:188	0.06	48.0	2	1	0
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	82-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188,94-UNIMOD:21	0.02	47.0	4	1	0
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	75-UNIMOD:188	0.03	47.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	37-UNIMOD:267	0.13	47.0	4	1	0
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	217-UNIMOD:21,224-UNIMOD:21,939-UNIMOD:21	0.05	47.0	2	2	2
PRT	sp|Q02880|TOP2B_HUMAN	DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	1515-UNIMOD:188,1522-UNIMOD:21,1524-UNIMOD:21,1532-UNIMOD:188	0.01	47.0	7	1	0
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	215-UNIMOD:267	0.09	46.0	4	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4,531-UNIMOD:267,501-UNIMOD:267	0.11	46.0	11	2	0
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1558-UNIMOD:4,1561-UNIMOD:21,1568-UNIMOD:21	0.01	46.0	2	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	407-UNIMOD:188	0.04	46.0	2	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	73-UNIMOD:21	0.14	46.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	52-UNIMOD:4,71-UNIMOD:188,125-UNIMOD:188	0.14	46.0	5	3	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	100-UNIMOD:21,114-UNIMOD:21,97-UNIMOD:267,107-UNIMOD:21,116-UNIMOD:267	0.03	46.0	3	1	0
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	90-UNIMOD:188	0.04	46.0	5	2	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	165-UNIMOD:21,161-UNIMOD:21,174-UNIMOD:188,187-UNIMOD:188	0.04	46.0	2	1	0
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	120-UNIMOD:21,146-UNIMOD:267,118-UNIMOD:21	0.09	46.0	2	1	0
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	42-UNIMOD:21,44-UNIMOD:188,65-UNIMOD:188,50-UNIMOD:21,45-UNIMOD:21	0.11	46.0	6	1	0
PRT	sp|Q96CC6|RHDF1_HUMAN	Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	180-UNIMOD:21,183-UNIMOD:21,190-UNIMOD:4	0.04	46.0	1	1	1
PRT	sp|Q9Y333|LSM2_HUMAN	U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	87-UNIMOD:267	0.21	46.0	2	1	0
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	266-UNIMOD:188	0.07	45.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	1943-UNIMOD:21,1950-UNIMOD:188,1957-UNIMOD:188	0.01	45.0	31	1	0
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	243-UNIMOD:21,231-UNIMOD:188,171-UNIMOD:21,240-UNIMOD:21	0.16	45.0	7	2	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	35-UNIMOD:188	0.05	45.0	5	2	1
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	387-UNIMOD:4,392-UNIMOD:21,394-UNIMOD:21,402-UNIMOD:267,403-UNIMOD:267	0.04	45.0	15	1	0
PRT	sp|Q12948|FOXC1_HUMAN	Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	233-UNIMOD:4,235-UNIMOD:21,241-UNIMOD:21,227-UNIMOD:188,256-UNIMOD:188	0.06	45.0	6	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	257-UNIMOD:267,682-UNIMOD:21,691-UNIMOD:4	0.04	45.0	5	2	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	18-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188,2-UNIMOD:1	0.09	45.0	18	2	1
PRT	sp|P16989-3|YBOX3_HUMAN	Isoform 3 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	150-UNIMOD:188,34-UNIMOD:21,38-UNIMOD:21	0.28	45.0	5	3	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	347-UNIMOD:188	0.04	45.0	2	1	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	482-UNIMOD:21,489-UNIMOD:188,519-UNIMOD:188,486-UNIMOD:21	0.07	45.0	2	2	2
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1003-UNIMOD:21,1013-UNIMOD:188,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:188,377-UNIMOD:21,398-UNIMOD:21,401-UNIMOD:267,1218-UNIMOD:21,854-UNIMOD:21,856-UNIMOD:21,866-UNIMOD:21,848-UNIMOD:21	0.04	44.0	7	4	1
PRT	sp|P46199|IF2M_HUMAN	Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	439-UNIMOD:267	0.02	44.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	253-UNIMOD:188	0.05	44.0	3	1	0
PRT	sp|Q3MIN7|RGL3_HUMAN	Ral guanine nucleotide dissociation stimulator-like 3 OS=Homo sapiens OX=9606 GN=RGL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	555-UNIMOD:21,558-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1167-UNIMOD:188	0.01	44.0	1	1	1
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	138-UNIMOD:188	0.07	44.0	3	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	240-UNIMOD:21,244-UNIMOD:21,234-UNIMOD:188,246-UNIMOD:267	0.04	44.0	8	1	0
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.02	44.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	185-UNIMOD:21,189-UNIMOD:21	0.09	44.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	320-UNIMOD:188	0.02	44.0	2	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	300-UNIMOD:267	0.07	44.0	4	2	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	93-UNIMOD:267	0.04	44.0	2	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.05	44.0	3	1	0
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.02	44.0	5	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	2138-UNIMOD:21,2161-UNIMOD:21,2165-UNIMOD:21,2169-UNIMOD:21,2123-UNIMOD:188,2140-UNIMOD:267	0.02	44.0	5	2	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21	0.05	44.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1372-UNIMOD:267,164-UNIMOD:21	0.02	43.0	3	2	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.09	43.0	1	1	1
PRT	sp|Q9C0B1|FTO_HUMAN	Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	338-UNIMOD:4,346-UNIMOD:4,357-UNIMOD:188	0.04	43.0	3	1	0
PRT	sp|Q5SXM2|SNPC4_HUMAN	snRNA-activating protein complex subunit 4 OS=Homo sapiens OX=9606 GN=SNAPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1436-UNIMOD:4,1441-UNIMOD:4,1455-UNIMOD:267	0.01	43.0	2	1	0
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	42-UNIMOD:21,41-UNIMOD:21,57-UNIMOD:188	0.08	43.0	8	1	0
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	102-UNIMOD:21,108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188	0.05	43.0	4	1	0
PRT	sp|Q5MIZ7-3|P4R3B_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP4R3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1674-UNIMOD:21,1679-UNIMOD:21,1695-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2691-UNIMOD:21,2697-UNIMOD:188,2689-UNIMOD:21	0.01	43.0	3	1	0
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	204-UNIMOD:21,209-UNIMOD:188,214-UNIMOD:21,219-UNIMOD:188,284-UNIMOD:21,291-UNIMOD:188,297-UNIMOD:21	0.05	43.0	2	2	2
PRT	sp|Q9BYV8-5|CEP41_HUMAN	Isoform 5 of Centrosomal protein of 41 kDa OS=Homo sapiens OX=9606 GN=CEP41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	92-UNIMOD:267	0.07	43.0	2	1	0
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	214-UNIMOD:267	0.04	43.0	1	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	253-UNIMOD:267,236-UNIMOD:28	0.07	43.0	3	1	0
PRT	sp|Q8IWY9|CDAN1_HUMAN	Codanin-1 OS=Homo sapiens OX=9606 GN=CDAN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	265-UNIMOD:21,270-UNIMOD:4,277-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|P42858|HD_HUMAN	Huntingtin OS=Homo sapiens OX=9606 GN=HTT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	415-UNIMOD:21,430-UNIMOD:21,431-UNIMOD:4	0.01	43.0	1	1	1
PRT	sp|P10321|HLAC_HUMAN	HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	345-UNIMOD:4,350-UNIMOD:4,357-UNIMOD:21,360-UNIMOD:21,364-UNIMOD:4	0.08	43.0	2	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	346-UNIMOD:267	0.03	43.0	5	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	450-UNIMOD:188,642-UNIMOD:21	0.05	43.0	4	2	0
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	89-UNIMOD:21,99-UNIMOD:21	0.19	43.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	2468-UNIMOD:4,2471-UNIMOD:188	0.01	43.0	3	1	0
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	168-UNIMOD:188	0.06	43.0	3	1	0
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.03	43.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	122-UNIMOD:188	0.05	43.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	212-UNIMOD:21,216-UNIMOD:21,5749-UNIMOD:21,5752-UNIMOD:21,5763-UNIMOD:21,2806-UNIMOD:4,210-UNIMOD:21	0.01	43.0	7	5	4
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	176-UNIMOD:188	0.08	43.0	4	1	0
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	464-UNIMOD:4,465-UNIMOD:188	0.04	43.0	4	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	692-UNIMOD:21,696-UNIMOD:21	0.03	43.0	1	1	0
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	653-UNIMOD:188,49-UNIMOD:267	0.05	42.0	4	2	0
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	183-UNIMOD:21,187-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	364-UNIMOD:21,368-UNIMOD:21,374-UNIMOD:21,381-UNIMOD:21	0.06	42.0	2	2	2
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	138-UNIMOD:267	0.08	42.0	2	1	0
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	498-UNIMOD:21,517-UNIMOD:188	0.03	42.0	2	1	0
PRT	sp|O94887-3|FARP2_HUMAN	Isoform 3 of FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	439-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q96C57|CSTOS_HUMAN	Protein CUSTOS OS=Homo sapiens OX=9606 GN=CUSTOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	179-UNIMOD:21,185-UNIMOD:188	0.09	42.0	2	1	0
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	274-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|Q96NB3|ZN830_HUMAN	Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	259-UNIMOD:267	0.06	42.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	564-UNIMOD:188,569-UNIMOD:21,570-UNIMOD:21,578-UNIMOD:188,519-UNIMOD:21,520-UNIMOD:21,514-UNIMOD:188,533-UNIMOD:188	0.07	42.0	13	2	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	66-UNIMOD:21,67-UNIMOD:21	0.11	42.0	4	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	668-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	148-UNIMOD:267	0.06	42.0	3	1	0
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	144-UNIMOD:188	0.09	42.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|P15408-3|FOSL2_HUMAN	Isoform 3 of Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	172-UNIMOD:21,281-UNIMOD:21	0.18	42.0	2	2	2
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	73-UNIMOD:188	0.10	42.0	2	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	385-UNIMOD:21,386-UNIMOD:21,472-UNIMOD:188	0.06	42.0	3	2	1
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	771-UNIMOD:188	0.00	42.0	2	1	0
PRT	sp|P46100-2|ATRX_HUMAN	Isoform 1 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1066-UNIMOD:267	0.01	42.0	5	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	362-UNIMOD:21,360-UNIMOD:21,365-UNIMOD:21	0.00	42.0	4	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	85-UNIMOD:267	0.27	42.0	2	1	0
PRT	sp|P38398-8|BRCA1_HUMAN	Isoform 8 of Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1566-UNIMOD:21,1587-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q504T8|MIDN_HUMAN	Midnolin OS=Homo sapiens OX=9606 GN=MIDN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	209-UNIMOD:21,222-UNIMOD:267,207-UNIMOD:21	0.05	42.0	2	1	0
PRT	sp|O60271-3|JIP4_HUMAN	Isoform 3 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	249-UNIMOD:21,256-UNIMOD:188,273-UNIMOD:188	0.03	42.0	4	1	0
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	122-UNIMOD:267	0.05	42.0	1	1	1
PRT	sp|Q9Y262|EIF3L_HUMAN	Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	262-UNIMOD:267	0.04	42.0	1	1	0
PRT	sp|P28331|NDUS1_HUMAN	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	673-UNIMOD:188	0.03	42.0	2	1	0
PRT	sp|Q9H6U6|BCAS3_HUMAN	Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	475-UNIMOD:28,479-UNIMOD:4,480-UNIMOD:21,488-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	107-UNIMOD:28,109-UNIMOD:21,124-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	149-UNIMOD:188	0.09	41.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	196-UNIMOD:267	0.05	41.0	5	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	110-UNIMOD:188	0.08	41.0	4	1	0
PRT	sp|Q5C9Z4|NOM1_HUMAN	Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	280-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	301-UNIMOD:188	0.01	41.0	2	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1324-UNIMOD:4,1335-UNIMOD:267	0.01	41.0	2	1	0
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	267-UNIMOD:21,272-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1279-UNIMOD:21,1287-UNIMOD:4,1288-UNIMOD:267	0.02	41.0	2	1	0
PRT	sp|Q9UHW9-6|S12A6_HUMAN	Isoform 6 of Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	663-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	169-UNIMOD:21,181-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.04	41.0	3	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	68-UNIMOD:188	0.04	41.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	391-UNIMOD:267,394-UNIMOD:21,397-UNIMOD:21,406-UNIMOD:267	0.03	41.0	1	1	1
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	148-UNIMOD:267,164-UNIMOD:21,167-UNIMOD:4	0.13	41.0	2	1	0
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	69-UNIMOD:21,71-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	227-UNIMOD:188	0.07	41.0	1	1	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	113-UNIMOD:4,117-UNIMOD:188	0.13	41.0	2	1	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	657-UNIMOD:267	0.02	41.0	2	1	0
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	530-UNIMOD:267	0.02	41.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	950-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|Q92835-3|SHIP1_HUMAN	Isoform 3 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	566-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	56-UNIMOD:21,74-UNIMOD:188	0.04	41.0	3	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	537-UNIMOD:267	0.01	41.0	2	1	0
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|Q96QR8|PURB_HUMAN	Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	294-UNIMOD:267,304-UNIMOD:21	0.06	41.0	2	1	0
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q765P7|MTSS2_HUMAN	Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	615-UNIMOD:4,632-UNIMOD:188,634-UNIMOD:21,636-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q86US8|EST1A_HUMAN	Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1011-UNIMOD:188	0.01	40.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	853-UNIMOD:188	0.04	40.0	4	2	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	30-UNIMOD:188	0.05	40.0	2	1	0
PRT	sp|Q9BSA4-2|TTYH2_HUMAN	Isoform 2 of Protein tweety homolog 2 OS=Homo sapiens OX=9606 GN=TTYH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	118-UNIMOD:267	0.08	40.0	2	1	0
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	31-UNIMOD:188	0.03	40.0	1	1	1
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.01	40.0	1	1	1
PRT	sp|O75398-5|DEAF1_HUMAN	Isoform 4 of Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	343-UNIMOD:21,346-UNIMOD:188,176-UNIMOD:21,187-UNIMOD:188	0.09	40.0	7	2	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	516-UNIMOD:21,505-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	391-UNIMOD:4,394-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|Q9UI12-2|VATH_HUMAN	Isoform 2 of V-type proton ATPase subunit H OS=Homo sapiens OX=9606 GN=ATP6V1H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	108-UNIMOD:21,109-UNIMOD:21	0.02	40.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	306-UNIMOD:188	0.02	40.0	10	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	829-UNIMOD:188,431-UNIMOD:28	0.04	40.0	12	2	1
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	138-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	238-UNIMOD:267	0.05	40.0	1	1	1
PRT	sp|P54136-2|SYRC_HUMAN	Isoform Monomeric of Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	321-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|Q8TF05-2|PP4R1_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	549-UNIMOD:4,550-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	170-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P85037-2|FOXK1_HUMAN	Isoform 2 of Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	273-UNIMOD:21,276-UNIMOD:4,278-UNIMOD:21,282-UNIMOD:21	0.05	40.0	4	1	0
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	86-UNIMOD:21,89-UNIMOD:188,108-UNIMOD:188	0.04	40.0	4	1	0
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	805-UNIMOD:21,809-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	293-UNIMOD:21	0.02	40.0	1	1	0
PRT	sp|Q13451-2|FKBP5_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	15-UNIMOD:21	0.10	40.0	1	1	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	83-UNIMOD:21,89-UNIMOD:188,96-UNIMOD:188	0.01	40.0	2	1	0
PRT	sp|O76094-2|SRP72_HUMAN	Isoform 2 of Signal recognition particle subunit SRP72 OS=Homo sapiens OX=9606 GN=SRP72	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	559-UNIMOD:21,560-UNIMOD:21,566-UNIMOD:267,584-UNIMOD:267,557-UNIMOD:21,564-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	587-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	97-UNIMOD:267	0.03	40.0	3	1	0
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:267	0.03	40.0	1	1	1
PRT	sp|A4D1S0-2|KLRG2_HUMAN	Isoform 2 of Killer cell lectin-like receptor subfamily G member 2 OS=Homo sapiens OX=9606 GN=KLRG2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	90-UNIMOD:4,95-UNIMOD:21	0.08	40.0	3	1	0
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	64-UNIMOD:267	0.05	40.0	2	1	0
PRT	sp|O94925-3|GLSK_HUMAN	Isoform 3 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	232-UNIMOD:4,236-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|O15321-2|TM9S1_HUMAN	Isoform 2 of Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	291-UNIMOD:188	0.05	40.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	206-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	284-UNIMOD:267	0.03	40.0	2	1	0
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,4-UNIMOD:188,21-UNIMOD:267	0.06	40.0	3	1	0
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	73-UNIMOD:21,80-UNIMOD:188,84-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	55-UNIMOD:21	0.06	39.0	2	2	2
PRT	sp|Q6ZUJ8|BCAP_HUMAN	Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	147-UNIMOD:4,151-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1311-UNIMOD:21	0.01	39.0	2	2	2
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	507-UNIMOD:21,511-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	79-UNIMOD:188	0.05	39.0	65	1	0
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	195-UNIMOD:21	0.09	39.0	2	1	0
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	726-UNIMOD:4,738-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.00	39.0	1	1	1
PRT	sp|Q7Z406-4|MYH14_HUMAN	Isoform 4 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	521-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	262-UNIMOD:188	0.05	39.0	3	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	782-UNIMOD:21,787-UNIMOD:188,796-UNIMOD:188,467-UNIMOD:188	0.03	39.0	2	2	2
PRT	sp|P52701-4|MSH6_HUMAN	Isoform 4 of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	235-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1901-UNIMOD:267,1903-UNIMOD:21,1905-UNIMOD:21,1915-UNIMOD:267,1907-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	807-UNIMOD:21,811-UNIMOD:21,61-UNIMOD:4	0.04	39.0	2	2	2
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	767-UNIMOD:21,773-UNIMOD:21,779-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q76L83|ASXL2_HUMAN	Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	139-UNIMOD:21,144-UNIMOD:4,146-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	241-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|Q8NEJ9-2|NGDN_HUMAN	Isoform 2 of Neuroguidin OS=Homo sapiens OX=9606 GN=NGDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	142-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	588-UNIMOD:188,609-UNIMOD:21,613-UNIMOD:21,618-UNIMOD:188	0.03	39.0	2	2	2
PRT	sp|Q86UX6|ST32C_HUMAN	Serine/threonine-protein kinase 32C OS=Homo sapiens OX=9606 GN=STK32C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	10-UNIMOD:21,18-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	339-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	822-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	148-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q96HH9-5|GRM2B_HUMAN	Isoform 5 of GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	110-UNIMOD:4,116-UNIMOD:21,121-UNIMOD:21,132-UNIMOD:267,108-UNIMOD:21	0.08	39.0	2	1	0
PRT	sp|Q53LP3|SWAHC_HUMAN	Ankyrin repeat domain-containing protein SOWAHC OS=Homo sapiens OX=9606 GN=SOWAHC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	221-UNIMOD:4,226-UNIMOD:21,229-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	140-UNIMOD:21,151-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	161-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1931-UNIMOD:188,1932-UNIMOD:21,1945-UNIMOD:188,1894-UNIMOD:188,1788-UNIMOD:21,1793-UNIMOD:21,1797-UNIMOD:21,2041-UNIMOD:4,1779-UNIMOD:21,1782-UNIMOD:21	0.04	39.0	9	6	3
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	221-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	31-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q9BQI3-2|E2AK1_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	493-UNIMOD:4	0.03	39.0	2	1	0
PRT	sp|P23497-7|SP100_HUMAN	Isoform 7 of Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	374-UNIMOD:21,375-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	145-UNIMOD:188	0.03	39.0	3	1	0
PRT	sp|O43768|ENSA_HUMAN	Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,4-UNIMOD:188,18-UNIMOD:188	0.15	39.0	2	1	0
PRT	sp|Q8N4L1|T151A_HUMAN	Transmembrane protein 151A OS=Homo sapiens OX=9606 GN=TMEM151A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	323-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q02446|SP4_HUMAN	Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	138-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	315-UNIMOD:267	0.02	38.0	3	1	0
PRT	sp|P09496-5|CLCA_HUMAN	Isoform 5 of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:267	0.13	38.0	3	1	0
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	483-UNIMOD:21,487-UNIMOD:188,494-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|P49768-7|PSN1_HUMAN	Isoform 7 of Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	372-UNIMOD:267	0.04	38.0	2	1	0
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	108-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P15056|BRAF_HUMAN	Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	394-UNIMOD:21,401-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	226-UNIMOD:21,229-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:267	0.03	38.0	2	1	0
PRT	sp|Q16637-4|SMN_HUMAN	Isoform SMN-delta57 of Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	102-UNIMOD:188	0.06	38.0	2	1	0
PRT	sp|Q8N573-5|OXR1_HUMAN	Isoform 5 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	2	1	0
PRT	sp|Q9NX74|DUS2L_HUMAN	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens OX=9606 GN=DUS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	477-UNIMOD:188,488-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	171-UNIMOD:21,173-UNIMOD:21,159-UNIMOD:188,187-UNIMOD:188	0.02	38.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	51-UNIMOD:21,53-UNIMOD:21,61-UNIMOD:188,2-UNIMOD:1,12-UNIMOD:21,19-UNIMOD:188	0.12	38.0	3	3	3
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	405-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|Q9NWS8-2|RMND1_HUMAN	Isoform 2 of Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens OX=9606 GN=RMND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	91-UNIMOD:188	0.06	38.0	2	1	0
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	215-UNIMOD:188	0.06	38.0	2	1	0
PRT	sp|Q8N1P7|CRBG2_HUMAN	Beta/gamma crystallin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CRYBG2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	224-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O95140|MFN2_HUMAN	Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	79-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	101-UNIMOD:188	0.09	38.0	2	1	0
PRT	sp|P41440-2|S19A1_HUMAN	Isoform 2 of Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	434-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	551-UNIMOD:21,552-UNIMOD:4,556-UNIMOD:188,567-UNIMOD:188	0.03	38.0	3	1	0
PRT	sp|O75044|SRGP2_HUMAN	SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	796-UNIMOD:21,798-UNIMOD:188,811-UNIMOD:188,795-UNIMOD:21	0.02	38.0	3	1	0
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1210-UNIMOD:21,1218-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	116-UNIMOD:21,987-UNIMOD:21,991-UNIMOD:21	0.03	38.0	2	2	2
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	79-UNIMOD:21,83-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	497-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9Y5T5-4|UBP16_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	105-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	47-UNIMOD:21,51-UNIMOD:21,56-UNIMOD:267	0.04	38.0	5	1	0
PRT	sp|O14929-2|HAT1_HUMAN	Isoform B of Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	16-UNIMOD:4,25-UNIMOD:188	0.05	38.0	2	1	0
PRT	sp|P50993|AT1A2_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens OX=9606 GN=ATP1A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	225-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|Q9UMS4|PRP19_HUMAN	Pre-mRNA-processing factor 19 OS=Homo sapiens OX=9606 GN=PRPF19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	38-UNIMOD:21	0.14	38.0	1	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,8-UNIMOD:188,18-UNIMOD:188	0.05	38.0	2	2	2
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|P61024|CKS1_HUMAN	Cyclin-dependent kinases regulatory subunit 1 OS=Homo sapiens OX=9606 GN=CKS1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	5-UNIMOD:28,11-UNIMOD:188,20-UNIMOD:267	0.22	38.0	1	1	1
PRT	sp|P30519|HMOX2_HUMAN	Heme oxygenase 2 OS=Homo sapiens OX=9606 GN=HMOX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1	0.05	38.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	516-UNIMOD:21,519-UNIMOD:267,540-UNIMOD:267,520-UNIMOD:21,517-UNIMOD:21	0.02	38.0	3	1	0
PRT	sp|Q5TC82|RC3H1_HUMAN	Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	529-UNIMOD:21,535-UNIMOD:21,545-UNIMOD:188	0.02	38.0	1	1	0
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	200-UNIMOD:21,209-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9H019-3|MFR1L_HUMAN	Isoform 3 of Mitochondrial fission regulator 1-like OS=Homo sapiens OX=9606 GN=MTFR1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	210-UNIMOD:4,218-UNIMOD:4,223-UNIMOD:188	0.06	37.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1104-UNIMOD:21,1114-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	18-UNIMOD:4,22-UNIMOD:267	0.12	37.0	2	1	0
PRT	sp|O00459|P85B_HUMAN	Phosphatidylinositol 3-kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PIK3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	262-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q96EZ8-3|MCRS1_HUMAN	Isoform 3 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	95-UNIMOD:21,104-UNIMOD:188	0.04	37.0	4	1	0
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|Q96T17-5|MA7D2_HUMAN	Isoform 5 of MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	179-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	41-UNIMOD:267	0.06	37.0	2	1	0
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4,73-UNIMOD:267	0.09	37.0	2	1	0
PRT	sp|B2RTY4-3|MYO9A_HUMAN	Isoform 3 of Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	152-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	57-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	97-UNIMOD:267	0.10	37.0	2	1	0
PRT	sp|Q8IV56|PRR15_HUMAN	Proline-rich protein 15 OS=Homo sapiens OX=9606 GN=PRR15 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	49-UNIMOD:21,57-UNIMOD:267	0.26	37.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	610-UNIMOD:21,615-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	526-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	190-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	996-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P67870|CSK2B_HUMAN	Casein kinase II subunit beta OS=Homo sapiens OX=9606 GN=CSNK2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	23-UNIMOD:4,33-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|O75581|LRP6_HUMAN	Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1490-UNIMOD:21,1495-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	25-UNIMOD:4,40-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|Q9BY32-2|ITPA_HUMAN	Isoform 2 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	39-UNIMOD:188	0.10	37.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	142-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	293-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|Q96FC7-3|PHIPL_HUMAN	Isoform 3 of Phytanoyl-CoA hydroxylase-interacting protein-like OS=Homo sapiens OX=9606 GN=PHYHIPL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	12-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:188	0.37	37.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	404-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	829-UNIMOD:188	0.01	37.0	2	1	0
PRT	sp|Q86WC4|OSTM1_HUMAN	Osteopetrosis-associated transmembrane protein 1 OS=Homo sapiens OX=9606 GN=OSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	333-UNIMOD:21,321-UNIMOD:188	0.05	37.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	314-UNIMOD:188	0.02	37.0	8	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	16-UNIMOD:21,25-UNIMOD:21,14-UNIMOD:267,27-UNIMOD:267	0.10	37.0	3	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	655-UNIMOD:267,657-UNIMOD:21,659-UNIMOD:21,670-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	358-UNIMOD:4,367-UNIMOD:21,370-UNIMOD:188,379-UNIMOD:188	0.03	37.0	3	1	0
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	81-UNIMOD:188	0.11	37.0	2	1	0
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	712-UNIMOD:21,719-UNIMOD:188	0.01	37.0	3	1	0
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	324-UNIMOD:188	0.02	37.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	649-UNIMOD:267	0.02	37.0	2	1	0
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	80-UNIMOD:21,82-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.05	37.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	92-UNIMOD:188	0.02	37.0	1	1	1
PRT	sp|O15126|SCAM1_HUMAN	Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	334-UNIMOD:188	0.07	37.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1132-UNIMOD:21,1146-UNIMOD:188	0.01	37.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2323-UNIMOD:21,2328-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.12	37.0	1	1	1
PRT	sp|P11171-4|41_HUMAN	Isoform 4 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	15-UNIMOD:4,19-UNIMOD:188	0.03	37.0	1	1	1
PRT	sp|Q13443|ADAM9_HUMAN	Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	807-UNIMOD:267,816-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	215-UNIMOD:188	0.02	37.0	2	1	0
PRT	sp|O15269|SPTC1_HUMAN	Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	459-UNIMOD:267	0.03	37.0	1	1	1
PRT	sp|Q5JTH9|RRP12_HUMAN	RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null		0.02	37.0	1	1	0
PRT	sp|Q9GZR7|DDX24_HUMAN	ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	82-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	608-UNIMOD:21,331-UNIMOD:21,346-UNIMOD:4	0.04	37.0	2	2	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	671-UNIMOD:385,671-UNIMOD:4,672-UNIMOD:21,685-UNIMOD:188,689-UNIMOD:267	0.01	37.0	2	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,4-UNIMOD:188,15-UNIMOD:267	0.04	37.0	2	1	0
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.04	37.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	83-UNIMOD:21,85-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q8N2F6-2|ARM10_HUMAN	Isoform 2 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	45-UNIMOD:21,42-UNIMOD:21	0.08	37.0	2	1	0
PRT	sp|Q15651|HMGN3_HUMAN	High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	90-UNIMOD:188	0.16	36.0	1	1	1
PRT	sp|Q9NUQ8-2|ABCF3_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	288-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q96BZ8|LENG1_HUMAN	Leukocyte receptor cluster member 1 OS=Homo sapiens OX=9606 GN=LENG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1012-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	80-UNIMOD:21	0.20	36.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q96A54|PAQR1_HUMAN	Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	37-UNIMOD:188	0.05	36.0	1	1	1
PRT	sp|Q9C0B7|TNG6_HUMAN	Transport and Golgi organization protein 6 homolog OS=Homo sapiens OX=9606 GN=TANGO6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	567-UNIMOD:188	0.01	36.0	1	1	1
PRT	sp|Q8IZH2-2|XRN1_HUMAN	Isoform 2 of 5'-3' exoribonuclease 1 OS=Homo sapiens OX=9606 GN=XRN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1633-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	392-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	125-UNIMOD:21	0.10	36.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	306-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	769-UNIMOD:188	0.02	36.0	2	1	0
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	153-UNIMOD:21,151-UNIMOD:188,166-UNIMOD:188	0.07	36.0	3	1	0
PRT	sp|P55210-4|CASP7_HUMAN	Isoform 4 of Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:267	0.09	36.0	1	1	1
PRT	sp|Q15287|RNPS1_HUMAN	RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	103-UNIMOD:267	0.06	36.0	2	1	0
PRT	sp|Q9NZ52-3|GGA3_HUMAN	Isoform 3 of ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|P49441|INPP_HUMAN	Inositol polyphosphate 1-phosphatase OS=Homo sapiens OX=9606 GN=INPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	97-UNIMOD:4,109-UNIMOD:188	0.04	36.0	2	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	284-UNIMOD:188	0.00	36.0	2	1	0
PRT	sp|P53814-5|SMTN_HUMAN	Isoform B2 of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	267-UNIMOD:21,272-UNIMOD:21,283-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.17	36.0	2	2	2
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	455-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	200-UNIMOD:4,201-UNIMOD:188	0.02	36.0	10	1	0
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	61-UNIMOD:188	0.05	36.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	402-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	4512-UNIMOD:21	0.00	36.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	575-UNIMOD:188	0.02	36.0	1	1	1
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	40-UNIMOD:267	0.03	36.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	152-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	468-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	456-UNIMOD:188	0.03	36.0	1	1	1
PRT	sp|Q9Y4U1|MMAC_HUMAN	Methylmalonic aciduria and homocystinuria type C protein OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	275-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	195-UNIMOD:21,200-UNIMOD:21,204-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	157-UNIMOD:4,163-UNIMOD:267	0.04	36.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	31-UNIMOD:188	0.04	36.0	1	1	1
PRT	sp|P28370-2|SMCA1_HUMAN	Isoform 2 of Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q8WVB6|CTF18_HUMAN	Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	64-UNIMOD:21,73-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|O15014|ZN609_HUMAN	Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	842-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q6ZTU2-4|E400N_HUMAN	Isoform 3 of Putative EP400-like protein OS=Homo sapiens OX=9606 GN=EP400P1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	159-UNIMOD:21,160-UNIMOD:267	0.08	36.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	498-UNIMOD:188,500-UNIMOD:21,513-UNIMOD:4,514-UNIMOD:188	0.01	36.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:188	0.17	36.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1394-UNIMOD:188	0.01	36.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	148-UNIMOD:21,152-UNIMOD:21	0.18	36.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	181-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,4-UNIMOD:188,15-UNIMOD:188	0.15	36.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	369-UNIMOD:4	0.02	36.0	1	1	1
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1	0.04	36.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q8IUR6|CRERF_HUMAN	CREB3 regulatory factor OS=Homo sapiens OX=9606 GN=CREBRF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	510-UNIMOD:21,513-UNIMOD:21,521-UNIMOD:21,526-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	230-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	638-UNIMOD:21,642-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	381-UNIMOD:21,390-UNIMOD:267	0.06	35.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	337-UNIMOD:21,345-UNIMOD:21,354-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|O15550|KDM6A_HUMAN	Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	46-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1076-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	88-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	459-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	910-UNIMOD:21,913-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	171-UNIMOD:267	0.04	35.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	328-UNIMOD:21,331-UNIMOD:188,344-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	284-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	84-UNIMOD:4	0.07	35.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	507-UNIMOD:4,514-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1448-UNIMOD:21,1452-UNIMOD:21,1464-UNIMOD:267	0.01	35.0	1	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	229-UNIMOD:4,231-UNIMOD:188	0.04	35.0	1	1	1
PRT	sp|Q14676-3|MDC1_HUMAN	Isoform 3 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	663-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	138-UNIMOD:267	0.04	35.0	1	1	1
PRT	sp|Q96H12|MSD3_HUMAN	Myb/SANT-like DNA-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MSANTD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	274-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q9BY67-5|CADM1_HUMAN	Isoform 5 of Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	406-UNIMOD:21,409-UNIMOD:188,410-UNIMOD:188	0.07	35.0	1	1	1
PRT	sp|Q99871-3|HAUS7_HUMAN	Isoform 3 of HAUS augmin-like complex subunit 7 OS=Homo sapiens OX=9606 GN=HAUS7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q9NUL3-4|STAU2_HUMAN	Isoform 4 of Double-stranded RNA-binding protein Staufen homolog 2 OS=Homo sapiens OX=9606 GN=STAU2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	268-UNIMOD:21,271-UNIMOD:4,272-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q9UER7-3|DAXX_HUMAN	Isoform 3 of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	589-UNIMOD:4,596-UNIMOD:21,610-UNIMOD:267	0.04	35.0	1	1	1
PRT	sp|Q8TEA7-3|TBCK_HUMAN	Isoform 3 of TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	818-UNIMOD:188,827-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	353-UNIMOD:21,363-UNIMOD:188,367-UNIMOD:21,376-UNIMOD:188	0.05	35.0	1	1	1
PRT	sp|P61006|RAB8A_HUMAN	Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	181-UNIMOD:21,185-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	89-UNIMOD:188,92-UNIMOD:188,99-UNIMOD:21,102-UNIMOD:21,103-UNIMOD:21	0.19	35.0	1	1	1
PRT	sp|Q5TGY3|AHDC1_HUMAN	AT-hook DNA-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	596-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9H4L5-8|OSBL3_HUMAN	Isoform 2d of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	493-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	367-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|Q9HCH0-2|NCK5L_HUMAN	Isoform 2 of Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	447-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9Y248|PSF2_HUMAN	DNA replication complex GINS protein PSF2 OS=Homo sapiens OX=9606 GN=GINS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	182-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	23-UNIMOD:188	0.04	35.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1500-UNIMOD:4,1519-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	216-UNIMOD:21,219-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q9UM00-1|TMCO1_HUMAN	Isoform 3 of Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	188-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.09	35.0	1	1	1
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	117-UNIMOD:21	0.13	35.0	1	1	1
PRT	sp|Q86YD5-2|LRAD3_HUMAN	Isoform 2 of Low-density lipoprotein receptor class A domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LDLRAD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	248-UNIMOD:21,285-UNIMOD:267	0.13	35.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	843-UNIMOD:21,844-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9H5H4|ZN768_HUMAN	Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	97-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O60637-3|TSN3_HUMAN	Isoform 3 of Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	175-UNIMOD:267,184-UNIMOD:21,187-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|Q53EP0-2|FND3B_HUMAN	Isoform 2 of Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	253-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1089-UNIMOD:21,1100-UNIMOD:188,1105-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	34-UNIMOD:21,36-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	47-UNIMOD:4,61-UNIMOD:188	0.09	35.0	1	1	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	340-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	322-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	229-UNIMOD:21,233-UNIMOD:188	0.03	35.0	1	1	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	885-UNIMOD:267	0.01	35.0	1	1	1
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	717-UNIMOD:4,724-UNIMOD:188	0.01	35.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	234-UNIMOD:21,237-UNIMOD:4,240-UNIMOD:21	0.10	35.0	1	1	1
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P36871-3|PGM1_HUMAN	Isoform 3 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	106-UNIMOD:21	0.17	35.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,15-UNIMOD:188,18-UNIMOD:188	0.16	35.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	1174-UNIMOD:28,1180-UNIMOD:21,1182-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	167-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,15-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q96BJ3|AIDA_HUMAN	Axin interactor, dorsalization-associated protein OS=Homo sapiens OX=9606 GN=AIDA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	212-UNIMOD:267	0.06	35.0	1	1	1
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	184-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	2041-UNIMOD:21,2047-UNIMOD:21	0.01	35.0	1	1	0
PRT	sp|O43516|WIPF1_HUMAN	WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	345-UNIMOD:21,353-UNIMOD:267	0.03	35.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	36-UNIMOD:21,38-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	496-UNIMOD:21,497-UNIMOD:21,502-UNIMOD:21,506-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q3L8U1|CHD9_HUMAN	Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	2128-UNIMOD:21,2131-UNIMOD:21,2138-UNIMOD:21,2141-UNIMOD:21,2143-UNIMOD:4	0.01	35.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NAGDLAPAGGAASASTDEAADAESGTR	1	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	27-UNIMOD:267	ms_run[2]:scan=10993	53.516	2	2442.077	2442.0770	R	N	42	69
PSM	SEGEGEAASADDGSLNTSGAGPK	2	sp|Q9NWV8-3|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=6992	34.321	2	2105.8985	2105.8985	R	S	49	72
PSM	YLSADSGDADDSDADLGSAVK	3	sp|Q15361|TTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0		ms_run[2]:scan=12847	62.503	2	2070.8866	2070.8866	R	Q	476	497
PSM	SASELTAGAEAEAEEVKTGK	4	sp|Q9H0U9|TSYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:21	ms_run[2]:scan=17986	87.336	2	2056.9202	2056.9202	R	C	140	160
PSM	ISAAASDSGVESFDEGSSH	5	sp|Q12929-2|EPS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=11322	55.101	2	1851.7759	1851.7759	K	-	544	563
PSM	LQELESCSGLGSTSDDTDVR	6	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	7-UNIMOD:4	ms_run[2]:scan=13244	64.412	2	2167.9539	2167.9539	R	E	735	755
PSM	NAGDLAPAGGAASASTDEAADAESGTR	7	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=11006	53.595	2	2432.0688	2432.0688	R	N	42	69
PSM	TLSSPSLQTDGIAATPVPPPPPPK	8	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	1-UNIMOD:21	ms_run[2]:scan=19406	94.155	2	2447.2349	2447.2349	R	S	1800	1824
PSM	AAPEASSPPASPLQHLLPGK	9	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=21111	102.92	2	2133.0004	2133.0004	K	A	673	693
PSM	AASADSTTEGTPADGFTVLSTK	10	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=17006	82.472	2	2126.0015	2126.0015	K	S	168	190
PSM	GVSQEKEAQISSAIVSSVQSK	11	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21,6-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=19833	96.294	2	2253.1292	2253.1292	R	I	907	928
PSM	LVQDVANNTNEEAGDGTTTATVLAR	12	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	25-UNIMOD:267	ms_run[2]:scan=14240	68.933	2	2569.2495	2569.2495	K	S	97	122
PSM	QNLYDLDEDDDGIASVPTK	13	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=18848	91.404	2	2106.9593	2106.9593	K	Q	179	198
PSM	TLSSPSLQTDGIAATPVPPPPPPK	14	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=19214	93.229	2	2453.255	2453.2550	R	S	1800	1824
PSM	AVAEEDNGSIGEETDSSPGR	15	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=7062	34.641	2	2018.8665	2018.8665	K	K	652	672
PSM	DATNVGDEGGFAPNILENK	16	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	19-UNIMOD:188	ms_run[2]:scan=19650	95.435	2	1965.9375	1965.9375	K	E	110	129
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	17	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23260	114.06	2	2441.1802	2441.1802	R	S	258	284
PSM	IDHLSSSAPGSPPDLLESVPK	18	sp|Q5TC82-2|RC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22534	110.3	2	2305.028	2305.0280	K	S	525	546
PSM	KVVEAVNSDSDSEFGIPK	19	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16526	80.033	2	2079.8803	2079.8803	K	K	1510	1528
PSM	SNDIDLEGFDSVVSSTEK	20	sp|Q96B97-3|SH3K1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	18-UNIMOD:188	ms_run[2]:scan=23246	113.99	2	1946.9052	1946.9052	R	L	220	238
PSM	TLSSPSLQTDGIAATPVPPPPPPK	21	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21	ms_run[2]:scan=19199	93.145	2	2447.2349	2447.2349	R	S	1800	1824
PSM	TRTPASINATPANINLADLTR	22	sp|Q7KZ85-2|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=22771	111.51	2	2369.1142	2369.1142	R	A	349	370
PSM	VNEASGDGDGEDAVVILEK	23	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=16031	77.555	2	1915.9011	1915.9011	K	T	68	87
PSM	AQAVSEEEEEEEGKSSSPK	24	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21,14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5037	24.908	2	2140.9088	2140.9088	K	K	78	97
PSM	GVSQEKEAQISSAIVSSVQSK	25	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=19829	96.276	2	2241.089	2241.0890	R	I	907	928
PSM	KVVEAVNSDSDSEFGIPK	26	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16124	78.005	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	27	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16323	79.027	2	2079.8803	2079.8803	K	K	1510	1528
PSM	KVVEAVNSDSDSEFGIPK	28	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16736	81.064	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LGIYDADGDGDFDVDDAK	29	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	18-UNIMOD:188	ms_run[2]:scan=19260	93.464	2	1905.8212	1905.8212	K	V	58	76
PSM	LVQDVANNTNEEAGDGTTTATVLAR	30	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14232	68.896	2	2559.2413	2559.2413	K	S	97	122
PSM	SASPDDDLGSSNWEAADLGNEER	31	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=18234	88.49	2	2434.0157	2434.0157	R	K	15	38
PSM	TKDQPDGSSLSPAQSPSQSQPPAASSLR	32	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=10753	52.215	3	2983.2962	2983.2962	R	E	210	238
PSM	VNEASGDGDGEDAVVILEK	33	sp|Q96C86|DCPS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	19-UNIMOD:188	ms_run[2]:scan=16018	77.499	2	1921.9212	1921.9212	K	T	68	87
PSM	KVVEAVNSDSDSEFGIPK	34	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[1]:scan=16973	82.29124333333334	2	2092.926736	2091.920557	K	K	1515	1533
PSM	AEAAASALADADADLEER	35	sp|O43633|CHM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=18926	91.771	2	1787.8174	1787.8174	K	L	198	216
PSM	AEAAASALADADADLEER	36	sp|O43633|CHM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:267	ms_run[2]:scan=18966	91.948	2	1797.8256	1797.8256	K	L	198	216
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	37	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12109	58.8	3	3173.2435	3173.2435	R	-	502	532
PSM	AQAVSEEEEEEEGKSSSPK	38	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:21	ms_run[2]:scan=3561	18.018	2	2128.8685	2128.8685	K	K	78	97
PSM	AQAVSEEEEEEEGKSSSPK	39	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=4889	24.221	2	2128.8685	2128.8685	K	K	78	97
PSM	KQETAAVCGETDEEAGESGGEGIFR	40	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14929	72.127	2	2786.078	2786.0780	K	E	1551	1576
PSM	KVVEAVNSDSDSEFGIPK	41	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16394	79.394	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LAPITSDPTEATAVGAVEASFK	42	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	22-UNIMOD:188	ms_run[2]:scan=25807	128.42	2	2180.1308	2180.1308	R	C	386	408
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	43	sp|O43583|DENR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=9900	48.066	3	2796.2339	2796.2339	K	K	68	94
PSM	MAEGGSGDVDDAGDCSGAR	44	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:4	ms_run[2]:scan=3916	19.683	2	1825.6843	1825.6843	K	Y	38	57
PSM	RPPSPDVIVLSDNEQPSSPR	45	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=16137	78.062	2	2349.0403	2349.0403	R	V	97	117
PSM	SEAPETPMEEEAELVLTEK	46	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:188	ms_run[2]:scan=26800	134.81	2	2137.008	2137.0080	K	S	72	91
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	47	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=7404	36.272	3	2856.1094	2856.1094	R	S	161	188
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	48	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=19310	93.708	3	2962.3796	2962.3796	R	E	118	147
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	49	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21	ms_run[2]:scan=19991	97.089	2	2692.1753	2692.1753	R	L	42	66
PSM	VADDTAEGLSAPHTPVTPGAASLCSFSSSR	50	sp|Q96CC6|RHDF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:21,17-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=19248	93.409	3	3147.3257	3147.3257	R	S	167	197
PSM	YVQLPADEVDTQLLQDAAR	51	sp|Q9Y333|LSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:267	ms_run[2]:scan=24505	120.73	2	2154.0832	2154.0832	R	K	69	88
PSM	KVVEAVNSDSDSEFGIPK	52	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=15881	76.80381666666666	2	2080.886513	2079.880299	K	K	1515	1533
PSM	AQAVSEEEEEEEGKSSSPK	53	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21	ms_run[2]:scan=5125	25.327	2	2128.8685	2128.8685	K	K	78	97
PSM	ELGGLEGDPSPEEDEGIQK	54	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:188	ms_run[2]:scan=13389	65.081	2	2003.9267	2003.9267	K	A	248	267
PSM	GAGDGSDEEVDGKADGAEAKPAE	55	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:21	ms_run[2]:scan=4086	20.434	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GPDKLLPYPTLASPASD	56	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21	ms_run[2]:scan=22499	110.1	2	1820.8597	1820.8597	R	-	228	245
PSM	GPDKLLPYPTLASPASD	57	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:188,16-UNIMOD:21	ms_run[2]:scan=22600	110.63	2	1826.8799	1826.8799	R	-	228	245
PSM	GSSGVGLTAAVTTDQETGER	58	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12215	59.306	2	1934.9181	1934.9181	R	R	372	392
PSM	IACDEEFSDSEDEGEGGRR	59	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=7674	37.554	2	2336.8045	2336.8045	R	N	385	404
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	60	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=19745	95.903	3	3489.6252	3489.6252	R	I	223	257
PSM	KVVEAVNSDSDSEFGIPK	61	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=17378	84.385	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LAPITSDPTEATAVGAVEASFK	62	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=25803	128.4	2	2174.1107	2174.1107	R	C	386	408
PSM	LSEGSQPAEEEEDQETPSR	63	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:267	ms_run[2]:scan=6513	31.996	2	2126.9115	2126.9115	K	N	239	258
PSM	SEAPETPMEEEAELVLTEK	64	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=26746	134.44	2	2130.9878	2130.9878	K	S	72	91
PSM	SETAPAETATPAPVEKSPAK	65	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21	ms_run[2]:scan=6434	31.647	2	2060.9667	2060.9667	M	K	2	22
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	66	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21	ms_run[2]:scan=19325	93.778	3	2952.3714	2952.3714	R	E	118	147
PSM	SVGDGETVEFDVVEGEK	67	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:188	ms_run[2]:scan=17680	85.855	2	1800.8361	1800.8361	R	G	134	151
PSM	VENQENVSNLVIEDTELK	68	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=21239	103.55	2	2072.0273	2072.0273	R	Q	330	348
PSM	GEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	69	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	4-UNIMOD:21,11-UNIMOD:188,41-UNIMOD:188	ms_run[1]:scan=23859	117.17226333333333	3	4129.993395	4129.965920	K	Q	479	520
PSM	LVQDVANNTNEEAGDGTTTATVLAR	70	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=14164	68.56327166666667	2	2560.227505	2559.241253	K	S	97	122
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	71	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12510	60.845	3	3173.2435	3173.2435	R	-	502	532
PSM	AQTPPGPSLSGSKSPCPQEK	72	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,13-UNIMOD:188,14-UNIMOD:21,16-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=7586	37.129	2	2223.9675	2223.9675	K	S	1001	1021
PSM	DLPSAGEEILEVESEPR	73	sp|P46199|IF2M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:267	ms_run[2]:scan=23534	115.49	2	1878.9086	1878.9086	R	A	423	440
PSM	DPDAQPGGELMLGGTDSK	74	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:188	ms_run[2]:scan=14091	68.234	2	1792.8245	1792.8245	R	Y	236	254
PSM	EKSSSPSGSPGDPSSPTSSVSPGSPPSSPR	75	sp|Q3MIN7|RGL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	24-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=8139	39.732	3	2985.2278	2985.2278	R	S	532	562
PSM	GAGDGSDEEVDGKADGAEAKPAE	76	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21	ms_run[2]:scan=5371	26.469	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GGEEPIEESNILSPVQDGTK	77	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	20-UNIMOD:188	ms_run[2]:scan=18386	89.204	2	2104.0267	2104.0267	K	K	1148	1168
PSM	GTSFDAAATSGGSASSEK	78	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=5709	28.017	2	1629.7118	1629.7118	R	A	121	139
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	79	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=16698	80.887	3	3021.351	3021.3510	R	D	374	402
PSM	IACDEEFSDSEDEGEGGRR	80	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7370	36.111	2	2316.7879	2316.7879	R	N	385	404
PSM	IDHLSSSAPGSPPDLLESVPK	81	sp|Q5TC82-2|RC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=22334	109.29	2	2311.0482	2311.0482	K	S	525	546
PSM	ILQEKLDQPVSAPPSPR	82	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12856	62.56	2	2033.9588	2033.9588	R	D	230	247
PSM	LSEGSQPAEEEEDQETPSR	83	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=6384	31.409	2	2116.9033	2116.9033	K	N	239	258
PSM	QNLYDLDEDDDGIASVPTK	84	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=19141	92.854	2	2112.9795	2112.9795	K	Q	179	198
PSM	SETAPAETATPAPVEKSPAK	85	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6583	32.364	2	2073.007	2073.0070	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	86	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=7078	34.711	2	2073.007	2073.0070	M	K	2	22
PSM	SIDGTADDEDEGVPTDQAIR	87	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=12165	59.05	2	2102.924	2102.9240	K	A	628	648
PSM	SPSGPVKSPPLSPVGTTPVK	88	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12853	62.544	2	2091.0054	2091.0054	K	L	178	198
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	89	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=18740	90.867	3	2704.2155	2704.2155	R	L	42	66
PSM	SSLGQSASETEEDTVSVSK	90	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11234	54.685	2	1939.8858	1939.8858	R	K	302	321
PSM	SSLGQSASETEEDTVSVSK	91	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=11261	54.816	2	1945.906	1945.9060	R	K	302	321
PSM	TPEELDDSDFETEDFDVR	92	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=21085	102.77	2	2157.8862	2157.8862	R	S	264	282
PSM	TSVQTEDDQLIAGQSAR	93	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:267	ms_run[2]:scan=11091	54	2	1827.8838	1827.8838	R	A	284	301
PSM	TTTTNTQVEGDDEAAFLER	94	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:267	ms_run[2]:scan=15734	76.103	2	2106.9581	2106.9581	K	L	75	94
PSM	YYSPCEEHPAETNQNEGAESGTIR	95	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=9812	47.649	3	2828.1261	2828.1261	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	96	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9331	45.422	3	2834.1127	2834.1127	R	Q	182	206
PSM	VSEEAESQQQWDTSKGEQVSQNGLPAEQGSPR	97	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	30-UNIMOD:21	ms_run[1]:scan=13096	63.69071333333333	3	3566.543024	3565.559443	K	M	2109	2141
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	98	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=11344	55.19263	3	3261.3631	3261.3655	R	G	54	87
PSM	KVVEAVNSDSDSEFGIPK	99	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[1]:scan=17172	83.31848166666667	2	2092.924453	2091.920557	K	K	1515	1533
PSM	AAEINGEVDDDDAGGEWR	100	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=13171	64.081	2	1917.7977	1917.7977	R	L	1355	1373
PSM	AAEINGEVDDDDAGGEWR	101	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=13174	64.097	2	1927.8059	1927.8059	R	L	1355	1373
PSM	AAPEASSPPASPLQHLLPGK	102	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=21106	102.88	2	2126.9803	2126.9803	K	A	673	693
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	103	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12459	60.573	3	3183.2517	3183.2517	R	-	502	532
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	104	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12316	59.833	3	3173.2435	3173.2435	R	-	502	532
PSM	ATTPADGEEPAPEAEALAAAR	105	sp|Q96S44|PRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=15754	76.192	2	2036.9651	2036.9651	R	E	6	27
PSM	CQLALQNVCDDVDNDDVSLK	106	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=20684	100.52	2	2320.0311	2320.0311	R	S	338	358
PSM	CSASSCLDTSNDPDDLDVLR	107	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=18282	88.71	2	2238.9369	2238.9369	K	T	1436	1456
PSM	CSASSCLDTSNDPDDLDVLR	108	sp|Q5SXM2|SNPC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:4,6-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=18300	88.795	2	2248.9452	2248.9452	K	T	1436	1456
PSM	GAGDGSDEEVDGKADGAEAKPAE	109	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=4802	23.817	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	110	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=5019	24.828	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GIPLATGDTSPEPELLPGAPLPPPK	111	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=25133	124.38	2	2543.2924	2543.2924	K	E	33	58
PSM	GPPASSPAPAPKFSPVTPK	112	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=12979	63.172	2	2003.9562	2003.9562	R	F	97	116
PSM	GSLVGLVDYPDDEEEDEEEESSPR	113	sp|Q5MIZ7-3|P4R3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=20939	102.01	3	2694.1304	2694.1304	K	K	734	758
PSM	HEATSEEVLSPPSDSGGPDGSFTSSEGSSGK	114	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21,15-UNIMOD:21,31-UNIMOD:188	ms_run[2]:scan=15074	72.842	3	3187.2487	3187.2487	K	S	1665	1696
PSM	IACDEEFSDSEDEGEGGRR	115	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7803	38.138	2	2316.7879	2316.7879	R	N	385	404
PSM	ILQEKLDQPVSAPPSPR	116	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13282	64.585	2	2033.9588	2033.9588	R	D	230	247
PSM	IPSFFPSPEEPPSPSAPSIAK	117	sp|Q12802-4|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=24741	122.09	2	2267.0858	2267.0858	R	S	2677	2698
PSM	KVVEAVNSDSDSEFGIPK	118	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16109	77.932	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LAPVPSPEPQKPAPVSPESVK	119	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,11-UNIMOD:188,16-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=13382	65.049	2	2325.1461	2325.1461	K	A	199	220
PSM	LEDNDSAASDPDAETTAR	120	sp|Q9BYV8-5|CEP41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=5007	24.766	2	1876.7923	1876.7923	R	T	75	93
PSM	NAGDLAPAGGAASASTDEAADAESGTR	121	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	27-UNIMOD:267	ms_run[2]:scan=11002	53.578	3	2442.077	2442.0770	R	N	42	69
PSM	QLEVYTSGGDPESVAGEYGR	122	sp|Q9Y262-2|EIF3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:267	ms_run[2]:scan=16721	80.991	2	2122.9683	2122.9683	R	H	195	215
PSM	QNLYDLDEDDDGIASVPTK	123	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:188	ms_run[2]:scan=18835	91.347	2	2112.9795	2112.9795	K	Q	179	198
PSM	QQLSAEELDAQLDAYNAR	124	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:267	ms_run[2]:scan=20514	99.668	2	2043.9737	2043.9737	K	M	236	254
PSM	SASPDDDLGSSNWEAADLGNEER	125	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18217	88.408	3	2434.0157	2434.0157	R	K	15	38
PSM	SASPDDDLGSSNWEAADLGNEER	126	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	23-UNIMOD:267	ms_run[2]:scan=18236	88.501	3	2444.0239	2444.0239	R	K	15	38
PSM	SKQLQQSPTPTCPTPELGSPLPSR	127	sp|Q8IWY9|CDAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,12-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=14675	70.996	3	2765.2497	2765.2497	R	T	259	283
PSM	SRSGSIVELIAGGGSSCSPVLSR	128	sp|P42858|HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=22577	110.52	3	2435.0917	2435.0917	R	K	415	438
PSM	SSGGKGGSCSQAACSNSAQGSDESLITCKA	129	sp|P10321|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:21,24-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=9189	44.779	3	3121.1825	3121.1825	K	-	337	367
PSM	TDASSASSFLDSDELER	130	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18454	89.54	2	1828.7963	1828.7963	R	T	330	347
PSM	TEDGGEFEEGASENNAK	131	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:188	ms_run[2]:scan=5686	27.906	2	1788.7382	1788.7382	K	E	434	451
PSM	TEESPASDEAGEKEAKSD	132	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21	ms_run[2]:scan=1850	10.097	2	1958.763	1958.7630	K	-	83	101
PSM	TGGAYGEDLGADYNLSQVCDGK	133	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=18361	89.1	2	2295.0057	2295.0057	K	V	2450	2472
PSM	TIQNLYDLDEDDDGIASVPTK	134	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=21811	106.53	2	2321.0911	2321.0911	K	Q	148	169
PSM	TRTPASINATPANINLADLTR	135	sp|Q7KZ85-2|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,2-UNIMOD:267,6-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=22750	111.41	2	2389.1307	2389.1307	R	A	349	370
PSM	TSSAETPTIPLGSAVEAIK	136	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=21819	106.57	2	1870.9888	1870.9888	K	A	550	569
PSM	TTTTNTQVEGDDEAAFLER	137	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=15746	76.157	2	2096.9498	2096.9498	K	L	75	94
PSM	TVDFTQDSNYLLTGGQDK	138	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=21039	102.53	2	2000.9327	2000.9327	K	L	105	123
PSM	TVIRLPSGSGAASPTGSAVDIR	139	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18666	90.53	2	2271.0661	2271.0661	K	A	204	226
PSM	VIAINVDDPDAANYNDINDVK	140	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=19806	96.17	2	2287.0968	2287.0968	K	R	156	177
PSM	VQTDAFVSNELDDPDDLQCK	141	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:4	ms_run[2]:scan=19375	94.009	2	2308.0165	2308.0165	R	R	446	466
PSM	AAPEASSPPASPLQHLLPGK	142	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=22466	109.92506499999999	2	2127.9792	2126.9802	K	A	686	706
PSM	AGEAAELQDAEVESSAK	143	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10795	52.42	2	1703.785	1703.7850	K	S	637	654
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	144	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=11969	58.183	3	3183.2517	3183.2517	R	-	502	532
PSM	AGSPRGSPLAEGPQAFFPER	145	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=22540	110.34	2	2229.9609	2229.9609	R	G	181	201
PSM	AKTQTPPVSPAPQPTEER	146	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5516	27.149	2	2092.9232	2092.9232	R	L	360	378
PSM	ALSQAAVEEEEEEEEEEEPAQGK	147	sp|Q5JTH9-2|RRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13417	65.214	3	2559.0984	2559.0984	R	G	947	970
PSM	AQEAPGQAEPPAAAEVQGAGNENEPR	148	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10668	51.829	3	2587.1899	2587.1899	R	E	113	139
PSM	CQLALQNVCDDVDNDDVSLK	149	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:4,9-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=20656	100.38	2	2326.0513	2326.0513	R	S	338	358
PSM	DPDAQPGGELMLGGTDSK	150	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14088	68.221	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	151	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=17857	86.726	2	2967.1987	2967.1987	R	V	489	518
PSM	DSSSSLTDPQVSYVKSPAAER	152	sp|O94887-3|FARP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=12873	62.644	2	2303.0319	2303.0319	K	R	424	445
PSM	EAAVSASDILQESAIHSPGTVEK	153	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=19318	93.746	2	2418.1316	2418.1316	R	E	163	186
PSM	EAGVEMGDEDDLSTPNEK	154	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11652	56.692	2	1934.8051	1934.8051	R	L	257	275
PSM	EAGVEMGDEDDLSTPNEK	155	sp|P14868-2|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=11657	56.713	2	1940.8253	1940.8253	R	L	257	275
PSM	ENTAEALPEGFFDDPEVDAR	156	sp|Q96NB3|ZN830_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:267	ms_run[2]:scan=24379	120.05	2	2230.9894	2230.9894	R	V	240	260
PSM	FSKEEPVSSGPEEAVGK	157	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:188,8-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=10372	50.345	2	1947.8307	1947.8307	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	158	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=3195	16.322	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	159	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=4079	20.409	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	160	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=4734	23.487	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	161	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=4951	24.497	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GIPLATGDTSPEPELLPGAPLPPPK	162	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=25735	127.98	3	2543.2924	2543.2924	K	E	33	58
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	163	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17702	85.952	3	2729.1371	2729.1371	K	S	61	87
PSM	IACDEEFSDSEDEGEGGRR	164	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6933	34.077	2	2316.7879	2316.7879	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	165	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8851	43.245	2	2316.7879	2316.7879	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	166	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9347	45.495	2	2316.7879	2316.7879	R	N	385	404
PSM	IPSFFPSPEEPPSPSAPSIAK	167	sp|Q12802-4|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=24737	122.07	2	2261.0657	2261.0657	R	S	2677	2698
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	168	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=19577	95.008	3	3489.6252	3489.6252	R	I	223	257
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	169	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:188,11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21,34-UNIMOD:188	ms_run[2]:scan=19465	94.456	3	3501.6655	3501.6655	R	I	223	257
PSM	LEDTENWLYEDGEDQPK	170	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=18331	88.961	2	2085.911	2085.9110	K	Q	652	669
PSM	NGLAEGTEQEEEEEDEQVR	171	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10354	50.251	2	2189.9196	2189.9196	R	L	130	149
PSM	NGLAEGTEQEEEEEDEQVR	172	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=10370	50.334	2	2199.9279	2199.9279	R	L	130	149
PSM	QFYDQALQQAVVDDDANNAK	173	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	20-UNIMOD:188	ms_run[2]:scan=19539	94.827	2	2258.0547	2258.0547	K	A	125	145
PSM	QNLYDLDEDDDGIASVPTK	174	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19332	93.81	2	2106.9593	2106.9593	K	Q	179	198
PSM	QQLSAEELDAQLDAYNAR	175	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20511	99.652	2	2033.9654	2033.9654	K	M	236	254
PSM	SEDFGVNEDLADSDAR	176	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=14631	70.777	2	1738.7282	1738.7282	R	A	189	205
PSM	SETAPAETATPAPVEKSPAK	177	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=30843	162.57	2	2060.9667	2060.9667	M	K	2	22
PSM	SGGGSVGAVVVKQEPLEEDSPSSSSAGLDK	178	sp|P15408-3|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=15973	77.277	3	2952.3601	2952.3601	R	A	172	202
PSM	SLDSDESEDEEDDYQQK	179	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=6852	33.676	2	2030.7712	2030.7712	K	R	57	74
PSM	SLDSDESEDEEDDYQQK	180	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=6864	33.726	2	2036.7914	2036.7914	K	R	57	74
PSM	SRTGSESSQTGTSTTSSR	181	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=592	4.8228	2	1975.7521	1975.7521	R	N	379	397
PSM	SVLDQDDVDTSMEESLK	182	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:188	ms_run[2]:scan=18750	90.91	2	1915.8664	1915.8664	K	H	755	772
PSM	SVPVTVDDDDDDNDPENR	183	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=8653	42.326	2	2025.8275	2025.8275	K	I	1049	1067
PSM	SVPVTVDDDDDDNDPENR	184	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8663	42.371	2	2015.8192	2015.8192	K	I	1049	1067
PSM	TDASSASSFLDSDELER	185	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:267	ms_run[2]:scan=18682	90.596	2	1838.8045	1838.8045	R	T	330	347
PSM	TGGAYGEDLGADYNLSQVCDGK	186	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4	ms_run[2]:scan=18371	89.135	2	2288.9856	2288.9856	K	V	2450	2472
PSM	TGSTSSKEDDYESDAATIVQK	187	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=13679	66.381	3	2310.9741	2310.9741	R	C	360	381
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	188	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=11952	58.115	3	2831.1125	2831.1125	R	T	60	86
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	189	sp|Q9BXV9|GON7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	26-UNIMOD:267	ms_run[2]:scan=11984	58.25	3	2841.1208	2841.1208	R	T	60	86
PSM	VAESAQSPAAAHTTDTAGYNAMEESVSR	190	sp|P38398-8|BRCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=13683	66.398	3	2940.2472	2940.2472	K	E	1560	1588
PSM	VPPVPTSPSPASPSPITAGSFR	191	sp|Q504T8|MIDN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=19130	92.796	3	2238.0961	2238.0961	R	S	201	223
PSM	VQTDAFVSNELDDPDDLQCK	192	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4	ms_run[2]:scan=19358	93.935	3	2308.0165	2308.0165	R	R	446	466
PSM	VQTDAFVSNELDDPDDLQCK	193	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=19387	94.064	2	2314.0366	2314.0367	R	R	446	466
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	194	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21,9-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=13965	67.67	3	2835.285	2835.2850	K	A	248	274
PSM	YIDSADLEPITSQEEPVR	195	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:267	ms_run[2]:scan=18469	89.608	2	2070.9985	2070.9985	K	Y	105	123
PSM	QLEVYTSGGDPESVAGEYGR	196	sp|Q9Y262|EIF3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	20-UNIMOD:267	ms_run[1]:scan=16686	80.82872666666667	2	2124.978573	2122.968262	R	H	243	263
PSM	YDDIEGANYFQQANELSK	197	sp|P28331|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=20595	100.08215333333334	2	2104.932900	2103.938529	R	L	656	674
PSM	TEESPASDEAGEKEAKSD	198	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	17-UNIMOD:21	ms_run[1]:scan=1511	8.594881666666666	2	1959.771813	1958.763006	K	-	83	101
PSM	QGGRCSPVPGLSSSPSGSPLHGK	199	sp|Q9H6U6|BCAS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,5-UNIMOD:4,6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=13972	67.70234166666667	3	2391.0037	2391.0075	K	L	475	498
PSM	QASTDAGTAGALTPQHVR	200	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,3-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=11063	53.8848	2	1852.8330	1852.8339	R	A	107	125
PSM	ILQEKLDQPVSAPPSPR	201	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:188,11-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:267	ms_run[1]:scan=13659	66.28755833333334	2	2050.982960	2049.987222	R	D	230	247
PSM	AAPTAASDQPDSAATTEK	202	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=3228	16.492	2	1736.816	1736.8160	R	A	132	150
PSM	AAPTAASDQPDSAATTEK	203	sp|Q9BRP8-2|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=3239	16.538	2	1730.7959	1730.7959	R	A	132	150
PSM	AEDGSVIDYELIDQDAR	204	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=20404	99.127	2	1917.8831	1917.8831	R	D	180	197
PSM	AEDNADTLALVFEAPNQEK	205	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=23862	117.19	2	2073.9855	2073.9855	R	V	92	111
PSM	AQEAEAQSEDDDEDTEEEQGEEKEK	206	sp|Q5C9Z4|NOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=3810	19.151	3	2947.0888	2947.0888	K	G	273	298
PSM	CQLALQNVCDDVDNDDVSLK	207	sp|Q9C0B1|FTO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:4,9-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=20650	100.35	3	2326.0513	2326.0513	R	S	338	358
PSM	DINLQDEDWNEFNDINK	208	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=23757	116.62	2	2120.9287	2120.9287	R	I	285	302
PSM	DLEVTCDPDSGGSQGLR	209	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=11852	57.642	2	1814.798	1814.7980	R	G	1319	1336
PSM	DVDDGLQAAEEVGYPVMIK	210	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=24870	122.85	2	2047.9772	2047.9772	K	A	215	234
PSM	EGVILTNESAASTGQPDNDVTEGQR	211	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	25-UNIMOD:267	ms_run[2]:scan=12815	62.344	3	2597.2081	2597.2081	K	A	477	502
PSM	ELGGLEGDPSPEEDEGIQK	212	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13368	64.982	2	1997.9066	1997.9066	K	A	248	267
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	213	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23066	113.04	2	2441.1802	2441.1802	R	S	258	284
PSM	GNKSPSPPDGSPAATPEIR	214	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=8946	43.662	2	2036.8606	2036.8606	K	V	262	281
PSM	GWGQQDGPGPPSPGQSPSPCR	215	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21,20-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=11694	56.904	2	2237.9189	2237.9189	R	T	1268	1289
PSM	IACDEEFSDSEDEGEGGRR	216	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8240	40.176	2	2316.7879	2316.7879	R	N	385	404
PSM	ILQEKLDQPVSAPPSPR	217	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12661	61.555	2	2033.9588	2033.9588	R	D	230	247
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	218	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=19497	94.608	4	3489.6252	3489.6252	R	I	223	257
PSM	KQETAAVCGETDEEAGESGGEGIFR	219	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14917	72.081	3	2786.078	2786.0780	K	E	1551	1576
PSM	KVVEAVNSDSDSEFGIPK	220	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16085	77.819	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LEDNDSAASDPDAETTAR	221	sp|Q9BYV8-5|CEP41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:267	ms_run[2]:scan=5031	24.882	2	1886.8005	1886.8005	R	T	75	93
PSM	LGIYDADGDGDFDVDDAK	222	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19233	93.332	2	1899.801	1899.8010	K	V	58	76
PSM	LTSIGSDEDEETETYQEK	223	sp|Q9UHW9-6|S12A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=10584	51.394	2	2072.891	2072.8910	R	V	961	979
PSM	LVQDVANNTNEEAGDGTTTATVLAR	224	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	25-UNIMOD:267	ms_run[2]:scan=14234	68.906	3	2569.2495	2569.2495	K	S	97	122
PSM	NGVIQHTGAAAEEFNDDTD	225	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:21	ms_run[2]:scan=11967	58.172	2	2082.8168	2082.8168	R	-	646	665
PSM	NHLSPQQGGATPQVPSPCCR	226	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=10169	49.372	2	2349.9385	2349.9385	K	F	166	186
PSM	QSGEAFVELGSEDDVK	227	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:188	ms_run[2]:scan=16094	77.858	2	1714.7993	1714.7993	R	M	53	69
PSM	RALSSDSILSPAPDAR	228	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,4-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=14124	68.389	2	1834.813	1834.8130	R	A	391	407
PSM	RAYLPDGYENENQLLNSQDC	229	sp|Q9UFW8|CGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:267,17-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=18718	90.759	2	2488.0242	2488.0242	R	-	148	168
PSM	RIIYDSDSESEETLQVK	230	sp|P35251-2|RFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=15092	72.923	2	2170.9072	2170.9072	K	N	64	81
PSM	RSSSSGDQSSDSLNSPTLLAL	231	sp|P15408-3|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21	ms_run[2]:scan=22229	108.73	2	2200.9849	2200.9849	R	-	267	288
PSM	SAAPSTLDSSSTAPAQLGK	232	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:188	ms_run[2]:scan=10364	50.301	2	1793.9103	1793.9103	R	K	209	228
PSM	SEAPETPMEEEAELVLTEK	233	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:188	ms_run[2]:scan=26654	133.8	2	2137.008	2137.0080	K	S	72	91
PSM	SETAPAETATPAPVEKSPAK	234	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:188,17-UNIMOD:21	ms_run[2]:scan=6275	30.876	2	2066.9869	2066.9869	M	K	2	22
PSM	SGEEDFESLASQFSDCSSAK	235	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=23622	115.93	2	2185.9053	2185.9053	K	A	98	118
PSM	SIEGTADDEEEGVSPDTAIR	236	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13223	64.316	2	2089.9288	2089.9288	K	S	638	658
PSM	SLDGALYDDEDDDDIER	237	sp|Q6P3S1|DEN1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=15917	76.979	2	1964.7999	1964.7999	K	A	514	531
PSM	SLEEEGQELPQSADVQR	238	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=12531	60.942	2	1923.9049	1923.9049	R	W	934	951
PSM	SQEGENEEGSEGELVVK	239	sp|Q92835-3|SHIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=8743	42.735	2	1824.8321	1824.8321	K	F	550	567
PSM	SVGDGETVEFDVVEGEK	240	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17625	85.596	2	1794.816	1794.8160	R	G	134	151
PSM	SYEDLTESEDGAASGDSHK	241	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=8831	43.153	2	2076.7797	2076.7797	R	E	56	75
PSM	TDASSASSFLDSDELER	242	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=18447	89.506	2	1838.8045	1838.8045	R	T	330	347
PSM	TLSSPSLQTDGIAATPVPPPPPPK	243	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=19217	93.244	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TSVQTEDDQLIAGQSAR	244	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11116	54.113	2	1817.8755	1817.8755	R	A	284	301
PSM	VENQENVSNLVIEDTELK	245	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:188	ms_run[2]:scan=21267	103.7	2	2078.0475	2078.0475	R	Q	330	348
PSM	VQGSDSDEEVVVATTR	246	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:267	ms_run[2]:scan=9915	48.131	2	1700.8092	1700.8092	K	I	522	538
PSM	YSGAYGASVSDEELK	247	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11666	56.756	2	1574.71	1574.7100	R	R	49	64
PSM	RGGGSGGGEESEGEEVDED	248	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[1]:scan=2958	15.181741666666666	2	1941.686212	1940.678438	R	-	294	313
PSM	QNLYDLDEDDDGIASVPTK	249	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28	ms_run[1]:scan=22650	110.886125	2	2089.9452	2089.9322	K	Q	179	198
PSM	KVVEAVNSDSDSEFGIPK	250	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[1]:scan=15880	76.80005166666668	2	2092.926875	2091.920557	K	K	1515	1533
PSM	YDDIEGANYFQQANELSK	251	sp|P28331|NDUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	18-UNIMOD:188	ms_run[1]:scan=20594	100.078375	2	2110.954637	2109.958658	R	L	656	674
PSM	YYSPCEEHPAETNQNEGAESGTIR	252	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[1]:scan=10198	49.550331666666665	3	2829.111736	2828.126052	R	Q	182	206
PSM	YGDINFDDLNSEQSYNK	253	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=18721	90.77432833333333	2	2020.861422	2020.865030	K	S	197	214
PSM	KVVEAVNSDSDSEFGIPK	254	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=17768	86.28177833333334	2	2080.881516	2079.880299	K	K	1515	1533
PSM	AAPEASSPPASPLQHLLPGK	255	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=21504	104.93	2	2126.9803	2126.9803	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	256	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=20732	100.78	2	2133.0004	2133.0004	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	257	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=20915	101.88	2	2133.0004	2133.0004	K	A	673	693
PSM	AASADSTTEGTPADGFTVLSTK	258	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:188	ms_run[2]:scan=17007	82.474	2	2132.0217	2132.0217	K	S	168	190
PSM	AEDNADTLALVFEAPNQEK	259	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24041	118.2	2	2073.9855	2073.9855	R	V	92	111
PSM	AEDNADTLALVFEAPNQEK	260	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:188	ms_run[2]:scan=23867	117.21	2	2080.0056	2080.0056	R	V	92	111
PSM	AGEAAELQDAEVESSAK	261	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=10806	52.467	2	1709.8051	1709.8051	K	S	637	654
PSM	AGSEECVFYTDETASPLAPDLAKASPK	262	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,23-UNIMOD:188,25-UNIMOD:21,27-UNIMOD:188	ms_run[2]:scan=21766	106.28	3	2945.3444	2945.3444	R	R	610	637
PSM	AQLSSPEDQDDQDDIK	263	sp|Q86US8|EST1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=7756	37.93	2	1808.8008	1808.8008	K	V	996	1012
PSM	AQTPPGPSLSGSKSPCPQEK	264	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7582	37.112	2	2211.9273	2211.9273	K	S	1001	1021
PSM	DDPVTNLNNAFEVAEK	265	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=22163	108.39	2	1774.8374	1774.8374	K	Y	218	234
PSM	DINLQDEDWNEFNDINK	266	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:188	ms_run[2]:scan=23740	116.54	2	2126.9488	2126.9488	R	I	285	302
PSM	DLDEDELLGNLSETELK	267	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=25685	127.7	2	1931.9211	1931.9211	K	Q	14	31
PSM	DLEVTCDPDSGGSQGLR	268	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4	ms_run[2]:scan=11876	57.759	2	1804.7898	1804.7898	R	G	1319	1336
PSM	DYDDIDDDDPFNPQAWR	269	sp|Q9BSA4-2|TTYH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=26580	133.31	2	2105.8478	2105.8478	R	M	102	119
PSM	FSKEEPVSSGPEEAVGK	270	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=9828	47.718	2	1935.7904	1935.7904	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	271	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10025	48.629	3	1935.7904	1935.7904	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	272	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4845	24.026	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	273	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5098	25.202	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	274	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5498	27.067	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GALVVEDNDSGVPVEETK	275	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=13248	64.43	2	1862.9205	1862.9205	R	K	14	32
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	276	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23477	115.18	2	2441.1802	2441.1802	R	S	258	284
PSM	GIPLATGDTSPEPELLPGAPLPPPK	277	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=25056	123.93	3	2543.2924	2543.2924	K	E	33	58
PSM	GIPLATGDTSPEPELLPGAPLPPPK	278	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=25567	126.97	3	2543.2924	2543.2924	K	E	33	58
PSM	GPPASSPAPAPKFSPVTPK	279	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=12842	62.474	2	1991.9159	1991.9159	R	F	97	116
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	280	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17069	82.791	3	2729.1371	2729.1371	K	S	61	87
PSM	GTSFDAAATSGGSASSEK	281	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=5697	27.957	2	1635.732	1635.7320	R	A	121	139
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	282	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=16611	80.46	3	3011.3427	3011.3427	R	D	374	402
PSM	IACDEEFSDSEDEGEGGRR	283	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=8325	40.622	2	2336.8045	2336.8045	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	284	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8026	39.165	2	2316.7879	2316.7879	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	285	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8422	41.186	2	2316.7879	2316.7879	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	286	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9575	46.535	2	2316.7879	2316.7879	R	N	385	404
PSM	IDHLSSSAPGSPPDLLESVPK	287	sp|Q5TC82-2|RC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22335	109.29	2	2305.028	2305.0280	K	S	525	546
PSM	IIEDGDGAGAGTTVNNLEETPVIENR	288	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18328	88.947	3	2683.2937	2683.2937	R	S	1492	1518
PSM	ILQEKLDQPVSAPPSPR	289	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13068	63.578	2	2033.9588	2033.9588	R	D	230	247
PSM	IVLTSLPALAVPPPTPTK	290	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=25681	127.68	2	1900.0782	1900.0782	K	A	329	347
PSM	IVLTSLPALAVPPPTPTK	291	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=25851	128.68	2	1900.0782	1900.0782	K	A	329	347
PSM	KPVTVSPTTPTSPTEGEAS	292	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=8357	40.791	2	1964.898	1964.8980	R	-	505	524
PSM	LASGEDDPFDSDFSCPVK	293	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=19735	95.856	2	1990.8562	1990.8562	K	L	377	395
PSM	LGESVQDLSSFDEYSSELK	294	sp|Q9UI12-2|VATH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=23570	115.67	2	2131.9797	2131.9797	K	S	324	343
PSM	LSVPTSDEEDEVPAPKPR	295	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13626	66.137	2	2124.9018	2124.9018	K	G	104	122
PSM	NHLSPQQGGATPQVPSPCCR	296	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10265	49.883	2	2359.9468	2359.9468	K	F	166	186
PSM	NPDDITQEEYGEFYK	297	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=17250	83.735	2	1852.8099	1852.8099	R	S	292	307
PSM	QSGEAFVELGSEDDVK	298	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16100	77.886	2	1708.7792	1708.7792	R	M	53	69
PSM	SAEIDSDDTGGSAAQK	299	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2227	11.816	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	300	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=2006	10.805	2	1556.6898	1556.6898	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	301	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=2231	11.834	2	1556.6898	1556.6898	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	302	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=2459	12.891	2	1556.6898	1556.6898	K	Q	814	830
PSM	SASPDDDLGSSNWEAADLGNEER	303	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:267	ms_run[2]:scan=18227	88.453	2	2444.0239	2444.0239	R	K	15	38
PSM	SDAPTGDVLLDEALK	304	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=21567	105.27	2	1548.7978	1548.7978	K	H	124	139
PSM	SDATADDLIDVVEGNR	305	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=23480	115.2	2	1698.7936	1698.7936	R	V	223	239
PSM	SDGGYTYDTSDLAAIK	306	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188	ms_run[2]:scan=16685	80.825	2	1681.7778	1681.7778	K	Q	306	322
PSM	SDLQDELDINELPNCK	307	sp|Q8TF05-2|PP4R1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=20264	98.419	2	1907.8878	1907.8878	R	I	535	551
PSM	SELLLAEEPGFLEGEDGEDTAK	308	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=25051	123.9	2	2348.0907	2348.0907	R	I	149	171
PSM	SETAPAETATPAPVEKSPAK	309	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6826	33.554	2	2073.007	2073.0070	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	310	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=6043	29.633	2	2060.9667	2060.9667	M	K	2	22
PSM	SGDETPGSEVPGDKAAEEQGDDQDSEK	311	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,14-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=7539	36.926	3	2868.1497	2868.1497	R	S	161	188
PSM	SGEEDFESLASQFSDCSSAK	312	sp|Q13526|PIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:4	ms_run[2]:scan=23624	115.93	2	2179.8852	2179.8852	K	A	98	118
PSM	SGGLQTPECLSREGSPIPHDPEFGSK	313	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=17577	85.385	3	3021.2018	3021.2018	R	L	268	294
PSM	SNDIDLEGFDSVVSSTEK	314	sp|Q96B97-3|SH3K1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=23212	113.81	2	1940.8851	1940.8851	R	L	220	238
PSM	SPQKSTVLTNGEAAMQSSNSESK	315	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,4-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=11587	56.386	3	2472.1242	2472.1242	K	K	86	109
PSM	SQEGENEEGSEGELVVK	316	sp|Q92835-3|SHIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=8740	42.721	2	1818.8119	1818.8119	K	F	550	567
PSM	SSGGKGGSCSQAACSNSAQGSDESLITCKA	317	sp|P10321|HLAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4,14-UNIMOD:4,21-UNIMOD:21,24-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=8970	43.765	3	3121.1825	3121.1825	K	-	337	367
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	318	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=18681	90.593	3	2692.1753	2692.1753	R	L	42	66
PSM	SVLDQDDVDTSMEESLK	319	sp|Q8WXH0|SYNE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18738	90.856	2	1909.8463	1909.8463	K	H	755	772
PSM	SYEDLTESEDGAASGDSHK	320	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=8601	42.064	2	2082.7998	2082.7998	R	E	56	75
PSM	TAPRQEAIPDLEDSPPVSDSEEQQESAR	321	sp|Q9BTC0-1|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15678	75.844	3	3240.3497	3240.3497	K	A	792	820
PSM	TEELIESPKLESSEGEIIQTVDR	322	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=24170	118.93	2	2681.2685	2681.2685	K	Q	287	310
PSM	TGSTSSKEDDYESDAATIVQK	323	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=13907	67.397	3	2310.9741	2310.9741	R	C	360	381
PSM	TGSTSSKEDDYESDAATIVQK	324	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=13692	66.438	2	2310.9741	2310.9741	R	C	360	381
PSM	TGSTSSKEDDYESDAATIVQK	325	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=13924	67.473	2	2310.9741	2310.9741	R	C	360	381
PSM	TIQNLYDLDEDDDGIASVPTK	326	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=21802	106.48	2	2327.1112	2327.1112	K	Q	148	169
PSM	TSVQTEDDQLIAGQSAR	327	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11083	53.97	2	1817.8755	1817.8755	R	A	284	301
PSM	TTDEGAKNNEESPTATVAEQGEDITSK	328	sp|Q13451-2|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=12304	59.775	3	2901.2401	2901.2401	M	K	2	29
PSM	TTYDSAEEENKENLYAGK	329	sp|Q9HAW4-2|CLSPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=9360	45.554	2	2140.8838	2140.8838	K	N	79	97
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	330	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=16196	78.398	3	2914.3742	2914.3742	K	H	557	585
PSM	TYVDPHTYEDPNQAVLK	331	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=13313	64.737	2	2068.9143	2068.9143	K	F	587	604
PSM	VDATEESDLAQQYGVR	332	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=15474	74.877	2	1789.8358	1789.8358	K	G	82	98
PSM	VGDGDLSAEEIPENEVSLR	333	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:267	ms_run[2]:scan=18459	89.565	2	2037.973	2037.9730	K	R	221	240
PSM	VIAINVDDPDAANYNDINDVK	334	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=19800	96.144	2	2293.1169	2293.1169	K	R	156	177
PSM	VPPLSLGYGVCPEPPSPGPALVK	335	sp|A4D1S0-2|KLRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=24875	122.88	2	2410.2008	2410.2008	R	L	80	103
PSM	VQDDEVGDGTTSVTVLAAELLR	336	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:267	ms_run[2]:scan=29463	153.57	3	2297.1626	2297.1626	R	E	43	65
PSM	VQDDEVGDGTTSVTVLAAELLR	337	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=29464	153.58	3	2287.1543	2287.1543	R	E	43	65
PSM	VSPESNEDISTTVVYR	338	sp|O94925-3|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13283	64.588	2	1794.8636	1794.8636	K	M	575	591
PSM	VTLLDGTEYSCDLEK	339	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=19143	92.86	2	1747.8282	1747.8282	K	H	222	237
PSM	YNLDEETTSAGSGDDFDQGDNGWK	340	sp|O15321-2|TM9S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	24-UNIMOD:188	ms_run[2]:scan=17648	85.709	3	2626.0675	2626.0675	R	I	268	292
PSM	GADFLVTEVENGGSLGSK	341	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	18-UNIMOD:188	ms_run[1]:scan=20153	97.87165666666667	2	1785.881167	1784.888788	K	K	189	207
PSM	STNGDTFLGGEDFDQALLR	342	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=26570	133.25169333333332	2	2055.958926	2054.954513	K	H	266	285
PSM	QQLSAEELDAQLDAYNAR	343	sp|Q86V81|THOC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,18-UNIMOD:267	ms_run[1]:scan=24106	118.57189833333334	2	2026.9602	2026.9462	K	M	236	254
PSM	QNLYDLDEDDDGIASVPTK	344	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,19-UNIMOD:188	ms_run[1]:scan=22647	110.86846499999999	2	2096.9672	2095.9522	K	Q	179	198
PSM	GIPLATGDTSPEPELLPGAPLPPPK	345	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:21	ms_run[1]:scan=25465	126.367575	2	2544.317344	2543.292423	K	E	33	58
PSM	VEKEEAGGGISEEEAAQYDR	346	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1	ms_run[1]:scan=13448	65.3512	2	2207.9845	2207.9813	M	Q	2	22
PSM	ILQEKLDQPVSAPPSPR	347	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:188,11-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:267	ms_run[1]:scan=12688	61.66672333333333	2	2050.990027	2049.987222	R	D	230	247
PSM	YYSPCEEHPAETNQNEGSESGTIR	348	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[1]:scan=9673	46.95505	3	2845.106228	2844.120967	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	349	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=9723	47.19473833333333	3	2835.100214	2834.112698	R	Q	182	206
PSM	GAGDGSDEEVDGKADGAEAKPAE	350	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21	ms_run[1]:scan=4344	21.65388666666667	2	2254.898690	2253.891061	K	-	1938	1961
PSM	AAVLSDSEDEEKASAK	351	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6777	33.275	2	1740.7858	1740.7858	K	K	69	85
PSM	AEAAASALADADADLEER	352	sp|O43633|CHM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=18929	91.782	3	1797.8256	1797.8256	K	L	198	216
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	353	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=12203	59.245	3	3183.2517	3183.2517	R	-	502	532
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	354	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12724	61.851	3	3173.2435	3173.2435	R	-	502	532
PSM	AGTGVDNVDLEAATR	355	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12210	59.278	2	1487.7216	1487.7216	R	K	76	91
PSM	AISEDSGCDSVTDTEPEDEKVVSYSK	356	sp|Q6ZUJ8|BCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=13137	63.881	3	2926.1951	2926.1951	K	Q	140	166
PSM	APPVDDAEVDELVLQTK	357	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21666	105.77	2	1837.9309	1837.9309	K	R	1315	1332
PSM	ASLGSLEGEAEAEASSPK	358	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18012	87.45	2	1731.8163	1731.8163	K	G	5748	5766
PSM	ASNEKESAAPASPAPSPAPSPTPAPPQK	359	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=6761	33.201	3	2841.2623	2841.2623	R	E	496	524
PSM	ASPNSDDTVLSPQELQK	360	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13275	64.543	2	1827.885	1827.8850	R	V	109	126
PSM	DAEDAMDAMDGAVLDGR	361	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21812	106.53	2	1750.7138	1750.7138	R	E	67	84
PSM	DASDDLDDLNFFNQK	362	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=27424	139.01	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	363	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=30364	159.22	2	1761.7789	1761.7789	K	K	65	80
PSM	DLDEDELLGNLSETELK	364	sp|Q9NYL9|TMOD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:188	ms_run[2]:scan=25688	127.71	2	1937.9413	1937.9413	K	Q	14	31
PSM	DLGSTEDGDGTDDFLTDKEDEK	365	sp|Q15527|SURF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=14796	71.541	3	2480.9592	2480.9592	K	A	180	202
PSM	DPDAQPGGELMLGGTDSK	366	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14310	69.268	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	367	sp|Q6P2E9-2|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=17777	86.329	3	2967.1987	2967.1987	R	V	489	518
PSM	DTSSITSCGDGNVVKQEQLSPK	368	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11563	56.279	2	2429.0781	2429.0781	K	K	719	741
PSM	DYLDFLDDEEDQGIYQSK	369	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=26268	131.36	2	2197.9635	2197.9635	R	V	18	36
PSM	DYLDFLDDEEDQGIYQSK	370	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=26269	131.36	2	2191.9433	2191.9433	R	V	18	36
PSM	DYPDFSPSVDAEAIQK	371	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18637	90.386	2	1780.8156	1780.8156	R	A	14	30
PSM	EAAVSASDILQESAIHSPGTVEK	372	sp|Q96C57|CSTOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=19305	93.682	2	2424.1517	2424.1517	R	E	163	186
PSM	EALELTDTGLLSGSEER	373	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21232	103.52	2	1818.8847	1818.8847	K	V	1302	1319
PSM	EAQAALAEAQEDLESER	374	sp|Q7Z406-4|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18435	89.449	3	1858.8545	1858.8545	R	V	1132	1149
PSM	EIDDTYIEDAADVDAR	375	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=18707	90.705	2	1819.7987	1819.7987	R	K	506	522
PSM	ETTDTDTADQVIASFK	376	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=20740	100.82	2	1746.8255	1746.8255	R	V	838	854
PSM	FSKEEPVSSGPEEAVGK	377	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10045	48.728	2	1935.7904	1935.7904	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	378	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10520	51.104	2	1935.7904	1935.7904	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	379	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3314	16.883	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	380	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4065	20.346	2	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	381	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=3413	17.332	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	382	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=4515	22.47	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	383	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23184	113.66	2	2431.1719	2431.1719	R	S	258	284
PSM	GDVVNQDDLYQALASGK	384	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21175	103.22	2	1791.8639	1791.8639	R	I	246	263
PSM	GGSDDSSKDPIDVNYEK	385	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,8-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=10646	51.712	2	1916.808	1916.8080	R	L	780	797
PSM	GPPASSPAPAPKFSPVTPK	386	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13051	63.499	2	1991.9159	1991.9159	R	F	97	116
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	387	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17464	84.829	3	2729.1371	2729.1371	K	S	61	87
PSM	GTQTYSVLEGDPSENYSK	388	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=13825	67.032	2	1979.9056	1979.9056	K	Y	218	236
PSM	GTSFDAAATSGGSASSEK	389	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5654	27.765	2	1629.7118	1629.7118	R	A	121	139
PSM	GWGQQDGPGPPSPGQSPSPCR	390	sp|Q6F5E8-2|CARL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21,20-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=11790	57.358	3	2237.9189	2237.9189	R	T	1268	1289
PSM	IALPAPRGSGTASDDEFENLR	391	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:267,9-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=20257	98.382	2	2395.0361	2395.0361	R	I	1895	1916
PSM	IALPAPRGSGTASDDEFENLR	392	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=20259	98.393	2	2375.0196	2375.0196	R	I	1895	1916
PSM	ILQEKLDQPVSAPPSPR	393	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=13511	65.6	2	2033.9588	2033.9588	R	D	230	247
PSM	IPGGNIYISPLKSPYK	394	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=20089	97.568	2	1905.9043	1905.9043	R	I	799	815
PSM	IVLTSLPALAVPPPTPTK	395	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=26168	130.7	2	1900.0782	1900.0782	K	A	329	347
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	396	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=16679	80.8	3	2822.2483	2822.2483	K	K	761	786
PSM	KVSSSSPQSGCPSPTIPAGK	397	sp|Q76L83|ASXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=6896	33.889	2	2130.9058	2130.9058	R	V	134	154
PSM	LASEEPPDDEEALATIR	398	sp|Q9UBB4-2|ATX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:267	ms_run[2]:scan=16585	80.332	2	1864.893	1864.8930	K	L	225	242
PSM	LSSEDEEEDEAEDDQSEASGKK	399	sp|Q8NEJ9-2|NGDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=6545	32.17	2	2505.9392	2505.9392	K	S	141	163
PSM	LVQDVANNTNEEAGDGTTTATVLAR	400	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	25-UNIMOD:267	ms_run[2]:scan=14488	70.102	3	2569.2495	2569.2495	K	S	97	122
PSM	NAGDLAPAGGAASASTDEAADAESGTR	401	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10988	53.493	3	2432.0688	2432.0688	R	N	42	69
PSM	NGLAEGTEQEEEEEDEQVR	402	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:267	ms_run[2]:scan=10350	50.234	3	2199.9279	2199.9279	R	L	130	149
PSM	NPDDITQEEYGEFYK	403	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=17446	84.749	2	1852.8099	1852.8099	R	S	292	307
PSM	NYAGEEEEEGSGSSEGFDPPATDR	404	sp|P16989-3|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11777	57.303	3	2529.0052	2529.0052	R	Q	191	215
PSM	QDVDDEYGVSQALAR	405	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=14723	71.22	2	1664.7642	1664.7642	K	G	712	727
PSM	QFYDQALQQAVVDDDANNAK	406	sp|P60033|CD81_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19542	94.838	2	2252.0346	2252.0346	K	A	125	145
PSM	RAYLPDGYENENQLLNSQDC	407	sp|Q9UFW8|CGBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=18723	90.781	2	2478.0159	2478.0159	R	-	148	168
PSM	RGGGSGGGEESEGEEVDED	408	sp|Q96QR8|PURB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=2679	13.932	2	1940.6784	1940.6784	R	-	294	313
PSM	RGSSAAASPGSPPPGR	409	sp|Q86UX6|ST32C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=1296	7.6583	2	1610.6603	1610.6604	R	A	8	24
PSM	SDGGYTYDTSDLAAIK	410	sp|P54136-2|SYRC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16702	80.909	2	1675.7577	1675.7577	K	Q	306	322
PSM	SELLLAEEPGFLEGEDGEDTAK	411	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	22-UNIMOD:188	ms_run[2]:scan=25054	123.92	2	2354.1109	2354.1109	R	I	149	171
PSM	SETAPAETATPAPVEKSPAK	412	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=6232	30.636	2	2060.9667	2060.9667	M	K	2	22
PSM	SIEGTADDEEEGVSPDTAIR	413	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:267	ms_run[2]:scan=13202	64.216	2	2099.937	2099.9370	K	S	638	658
PSM	SLDDDLDGVPLDATEDSK	414	sp|O15042-3|SR140_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=18895	91.617	2	1909.8736	1909.8736	K	K	322	340
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK	415	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=19617	95.226	4	4458.0725	4458.0725	K	K	34	85
PSM	SSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKK	416	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	30-UNIMOD:21	ms_run[2]:scan=10741	52.163	3	3342.6192	3342.6192	R	Q	793	829
PSM	STVTGERQSGDGQESTEPVENK	417	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=3631	18.314	2	2414.0235	2414.0235	K	V	140	162
PSM	SVCGHLENTSVGNSPNPSSAENSFR	418	sp|Q96HH9-5|GRM2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=14368	69.525	3	2816.1138	2816.1138	K	A	108	133
PSM	SVCPGGSSPGSSSGGGRGR	419	sp|Q53LP3|SWAHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=1142	7.0359	2	1864.6925	1864.6925	R	G	219	238
PSM	SVEDDEEGHLICQSGDVLSAR	420	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=18652	90.457	2	2394.9999	2394.9999	R	Y	140	161
PSM	SVPVTVDDDDDDNDPENR	421	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:267	ms_run[2]:scan=8451	41.318	2	2025.8275	2025.8275	K	I	1049	1067
PSM	SYIDRDSEYLLQENEPDGTLDQK	422	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=19874	96.501	3	2807.2175	2807.2175	R	L	161	184
PSM	TDASSASSFLDSDELER	423	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18671	90.551	2	1828.7963	1828.7963	R	T	330	347
PSM	TGGAYGEDLGADYNLSQVCDGK	424	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:4	ms_run[2]:scan=18366	89.122	3	2288.9856	2288.9856	K	V	2450	2472
PSM	TTKTPEDGDYSYEIIEK	425	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,4-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=14389	69.623	2	2079.9328	2079.9328	K	T	1929	1946
PSM	TYVGVVDGENELASPK	426	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=15003	72.489	2	1682.8459	1682.8459	R	L	206	222
PSM	VDGETASDSESRAESAPLPVSADDTPEVLNR	427	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=18685	90.611	3	3293.4573	3293.4573	K	A	27	58
PSM	VGTCLYASPEQLEGSEYDAK	428	sp|Q9BQI3-2|E2AK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=17617	85.561	2	2215.9943	2215.9943	R	S	490	510
PSM	VIGQDHDFSESSEEEAPAEASSGALR	429	sp|P23497-7|SP100_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=15673	75.818	3	2877.1379	2877.1379	R	S	364	390
PSM	VPPLSLGYGVCPEPPSPGPALVK	430	sp|A4D1S0-2|KLRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=24988	123.54	3	2410.2008	2410.2008	R	L	80	103
PSM	VVSSTSEEEEAFTEK	431	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=10868	52.81	2	1670.7523	1670.7523	R	F	131	146
PSM	YYSPCEEHPAETNQNEGSESGTIR	432	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=9314	45.349	3	2844.121	2844.1210	R	Q	182	206
PSM	LVQDVANNTNEEAGDGTTTATVLAR	433	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=14041	68.01567333333332	3	2560.228068	2559.241253	K	S	97	122
PSM	VEKEEAGGGISEEEAAQYDR	434	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,3-UNIMOD:188,20-UNIMOD:267	ms_run[1]:scan=13461	65.40426500000001	3	2224.0084	2224.0097	M	Q	2	22
PSM	SQKQEEENPAEETGEEK	435	sp|O43768|ENSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,3-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=4322	21.554693333333333	2	2014.9045	2014.9001	M	Q	2	19
PSM	LFGASSPPPGAVPSGPPLSR	436	sp|Q8N4L1|T151A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21	ms_run[1]:scan=20351	98.85893333333334	2	1970.976969	1969.966278	K	V	318	338
PSM	ENNVSQPASSSSSSSSSNNGSASPTKTK	437	sp|Q02446|SP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	25-UNIMOD:21	ms_run[1]:scan=1098	6.87148	3	2807.182805	2806.189034	K	S	114	142
PSM	SPQKSTVLTNGEAAMQSSNSESK	438	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,4-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=11671	56.780568333333335	3	2473.106845	2472.124222	K	K	86	109
PSM	AADEEAFEDNSEEYIR	439	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=15848	76.648	2	1896.7889	1896.7889	R	R	300	316
PSM	AAEEAFVNDIDESSPGTEWER	440	sp|P09496-5|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21915	107.07	2	2351.019	2351.0190	R	V	111	132
PSM	AAEEAFVNDIDESSPGTEWER	441	sp|P09496-5|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=21917	107.08	3	2361.0272	2361.0272	R	V	111	132
PSM	AAEEAFVNDIDESSPGTEWER	442	sp|P09496-5|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:267	ms_run[2]:scan=21928	107.14	2	2361.0272	2361.0272	R	V	111	132
PSM	AAESPDQKDTDGGPKEEESPV	443	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=6038	29.614	2	2264.9322	2264.9322	K	-	480	501
PSM	AAPEASSPPASPLQHLLPGK	444	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=20507	99.634	2	2126.9803	2126.9803	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	445	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=20706	100.64	2	2126.9803	2126.9803	K	A	673	693
PSM	AAVQELSSSILAGEDPEER	446	sp|P49768-7|PSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20700	100.61	2	1999.9698	1999.9698	R	G	326	345
PSM	AEDGSVIDYELIDQDAR	447	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20463	99.421	2	1907.8749	1907.8749	R	D	180	197
PSM	AEDNADTLALVFEAPNQEK	448	sp|P12004|PCNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:188	ms_run[2]:scan=24045	118.23	2	2080.0056	2080.0056	R	V	92	111
PSM	AGGEEEDDDDEAAGGR	449	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:267	ms_run[2]:scan=1139	7.0277	2	1601.5953	1601.5953	R	C	357	373
PSM	ATGGLCLLGAYADSDDDDNDVSEK	450	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4	ms_run[2]:scan=21358	104.18	3	2500.0548	2500.0548	K	L	103	127
PSM	DLGSTEDGDGTDDFLTDKEDEK	451	sp|Q15527|SURF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=14827	71.681	2	2480.9592	2480.9592	K	A	180	202
PSM	DQGFRGDGGSTTGLSATPPASLPGSLTNVK	452	sp|P15056|BRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=21030	102.49	3	3047.3638	3047.3638	R	A	385	415
PSM	DSSTSYTETKDPSSGQEVATPPVPQLQVCEPK	453	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	20-UNIMOD:21,29-UNIMOD:4	ms_run[2]:scan=17615	85.55	3	3541.5808	3541.5808	R	E	663	695
PSM	DYLDFLDDEEDQGIYQSK	454	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=26280	131.42	3	2191.9433	2191.9433	R	V	18	36
PSM	EAQAALAEAQEDLESER	455	sp|Q7Z406-4|MYH14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=18450	89.522	2	1858.8545	1858.8545	R	V	1132	1149
PSM	GAGDGSDEEVDGKADGAEAKPAE	456	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5255	25.875	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	457	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=3855	19.39	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	458	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=4297	21.434	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	459	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=5383	26.53	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	460	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23075	113.08	3	2431.1719	2431.1719	R	S	258	284
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	461	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23459	115.1	3	2431.1719	2431.1719	R	S	258	284
PSM	GPAAPLTPGPQSPPTPLAPGQEK	462	sp|O75398-5|DEAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=15810	76.472	3	2293.1451	2293.1451	K	G	165	188
PSM	GPDKLLPYPTLASPASD	463	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=22904	112.18	2	1820.8597	1820.8597	R	-	228	245
PSM	GPSTPKSPGASNFSTLPK	464	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12409	60.319	2	1931.8431	1931.8431	R	I	223	241
PSM	GSSPGIQDTLEAEDGAFETDEAPEDR	465	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20826	101.29	3	2735.1682	2735.1682	K	I	239	265
PSM	GTGQSDDSDIWDDTALIK	466	sp|Q16637-4|SMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=22501	110.11	2	1935.8698	1935.8698	R	A	24	42
PSM	IACDEEFSDSEDEGEGGRR	467	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=8843	43.207	2	2336.8045	2336.8045	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	468	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7584	37.123	2	2316.7879	2316.7879	R	N	385	404
PSM	IACDEEFSDSEDEGEGGRR	469	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9861	47.865	2	2316.7879	2316.7879	R	N	385	404
PSM	IDNDGDGFVTTEELK	470	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15211	73.499	2	1651.7577	1651.7577	R	T	40	55
PSM	IDQYQGADAVGLEEK	471	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12119	58.846	2	1634.7788	1634.7788	R	I	88	103
PSM	IEESETIEDSSNQAAAR	472	sp|Q8N573-5|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=7825	38.234	2	1848.8337	1848.8337	K	E	633	650
PSM	IPSFFPSPEEPPSPSAPSIAK	473	sp|Q12802-4|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=24569	121.08	2	2267.0858	2267.0858	R	S	2677	2698
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	474	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=19365	93.964	3	3489.6252	3489.6252	R	I	223	257
PSM	KAENAEGQTPAIGPDGEPLDETSQMSDLPVK	475	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,22-UNIMOD:21,26-UNIMOD:21,31-UNIMOD:188	ms_run[2]:scan=20318	98.694	3	3395.492	3395.4920	K	V	588	619
PSM	KPFVALGSGEESPLEGW	476	sp|Q9NX74|DUS2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,12-UNIMOD:21	ms_run[2]:scan=26113	130.35	2	1887.8751	1887.8751	K	-	477	494
PSM	KSAEPSANTTLVSETEEEGSVPAFGAAAK	477	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=18380	89.176	3	3037.3206	3037.3206	R	P	159	188
PSM	KSAEPSANTTLVSETEEEGSVPAFGAAAK	478	sp|Q13428-2|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,13-UNIMOD:21,15-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=18425	89.399	3	3049.3609	3049.3609	R	P	159	188
PSM	KVVEAVNSDSDSEFGIPK	479	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=17644	85.691	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LASGEDDPFDSDFSCPVK	480	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4	ms_run[2]:scan=19750	95.925	2	1984.836	1984.8360	K	L	377	395
PSM	LDNVPHTPSSYIETLPK	481	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21787	106.4	2	2075.9313	2075.9313	R	A	45	62
PSM	LEEEDEDEEDGESGCTFLVGLIQK	482	sp|P17655|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4	ms_run[2]:scan=26778	134.65	3	2740.1909	2740.1909	K	H	391	415
PSM	LFGASSPPPGAVPSGPPLSR	483	sp|Q8N4L1|T151A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=20559	99.887	2	1969.9663	1969.9663	K	V	318	338
PSM	LNSELDLDDAILEK	484	sp|Q9NWS8-2|RMND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21960	107.31	2	1586.8039	1586.8039	K	F	78	92
PSM	LQDLDTDYGSGYPNDPK	485	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=13078	63.617	2	1896.8378	1896.8378	K	T	199	216
PSM	LSVPTSDEEDEVPAPKPR	486	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13399	65.132	2	2124.9018	2124.9018	K	G	104	122
PSM	MVPPVVVGSPPGSPSR	487	sp|Q8N1P7|CRBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=15011	72.522	2	1641.795	1641.7950	R	S	216	232
PSM	NAELDPVTTEEQVLDVK	488	sp|O95140|MFN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=22108	108.11	2	1904.9674	1904.9674	R	G	63	80
PSM	NEDITEPQSILAAAEK	489	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188	ms_run[2]:scan=20518	99.687	2	1733.8779	1733.8779	R	A	86	102
PSM	NEDITEPQSILAAAEK	490	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20521	99.697	2	1727.8578	1727.8578	R	A	86	102
PSM	SAAEEKAAQALSVQDK	491	sp|P41440-2|S19A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=11007	53.597	2	1724.7982	1724.7982	R	G	434	450
PSM	SAEIDSDDTGGSAAQK	492	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2003	10.79	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	493	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2446	12.833	2	1550.6696	1550.6696	K	Q	814	830
PSM	SCSEEKIPEDGSLNTTK	494	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,2-UNIMOD:4,6-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=8497	41.536	2	1985.8692	1985.8692	R	-	551	568
PSM	SETAPAETATPAPVEKSPAK	495	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6033	29.591	2	2073.007	2073.0070	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	496	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6365	31.326	2	2073.007	2073.0070	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	497	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=6642	32.662	2	2060.9667	2060.9667	M	K	2	22
PSM	SFSKEELMSSDLEETAGSTSIPK	498	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=20280	98.505	3	2632.0904	2632.0904	K	R	511	534
PSM	SQSSDTEQQSPTSGGGK	499	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:188	ms_run[2]:scan=697	5.2696	2	1685.7436	1685.7436	R	V	456	473
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	500	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=20158	97.898	3	2692.1753	2692.1753	R	L	42	66
PSM	SSPKSEIEVISEPPEEK	501	sp|O75044|SRGP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=15660	75.759	2	1975.943	1975.9430	R	V	795	812
PSM	STPLASPSPSPGRSPQR	502	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6363	31.315	2	1880.8183	1880.8183	R	L	1209	1226
PSM	SVPVTVDDDDDDNDPENR	503	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=8901	43.463	2	2025.8275	2025.8275	K	I	1049	1067
PSM	SVPVTVDDDDDDNDPENR	504	sp|P46100-2|ATRX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=8458	41.358	2	2015.8192	2015.8192	K	I	1049	1067
PSM	SVSVDSGEQREAGTPSLDSEAK	505	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=10073	48.865	2	2328.0118	2328.0118	R	E	116	138
PSM	SYEDLTESEDGAASGDSHK	506	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=8586	41.989	2	2076.7797	2076.7797	R	E	56	75
PSM	TIQNLYDLDEDDDGIASVPTK	507	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	21-UNIMOD:188	ms_run[2]:scan=21849	106.72	3	2327.1112	2327.1112	K	Q	148	169
PSM	TPAPPEPGSPAPGEGPSGR	508	sp|P0C1Z6-2|TFPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=7509	36.77	2	1836.8044	1836.8044	R	K	163	182
PSM	TPESQPDTPPGTPLVSQDEKR	509	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9500	46.177	3	2438.0404	2438.0404	R	D	72	93
PSM	TQESGDQDPQEAQKASSATER	510	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=2564	13.385	3	2341.966	2341.9660	R	T	482	503
PSM	TTKTPEDGDYSYEIIEK	511	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=14383	69.594	2	2067.8926	2067.8926	K	T	1929	1946
PSM	TVDFTQDSNYLLTGGQDK	512	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=21040	102.54	2	2006.9528	2006.9528	K	L	105	123
PSM	TVEDEDQDSEEEKDNDSYIK	513	sp|Q9Y5T5-4|UBP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=8203	40.015	2	2466.9435	2466.9435	K	E	97	117
PSM	TVSSPPTSPRPGSAATVSASTSNIIPPR	514	sp|O76094-2|SRP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=16121	77.991	3	2894.3576	2894.3576	K	H	557	585
PSM	VAAAAGSGPSPPGSPGHDR	515	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4324	21.566	2	1846.7401	1846.7401	R	E	38	57
PSM	VAAAAGSGPSPPGSPGHDR	516	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4004	20.081	2	1856.7483	1856.7483	R	E	38	57
PSM	VAESAQSPAAAHTTDTAGYNAMEESVSR	517	sp|P38398-8|BRCA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=13658	66.285	3	2930.239	2930.2390	K	E	1560	1588
PSM	VDENFDCVEADDVEGK	518	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=13744	66.677	2	1845.767	1845.7670	K	I	10	26
PSM	VDNSSLTGESEPQTR	519	sp|P50993|AT1A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:267	ms_run[2]:scan=5446	26.833	2	1628.7517	1628.7517	K	S	211	226
PSM	YIAENGTDPINNQPLSEEQLIDIK	520	sp|Q9UMS4|PRP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23841	117.08	3	2713.3447	2713.3447	K	V	33	57
PSM	YVQLPADEVDTQLLQDAAR	521	sp|Q9Y333|LSM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24495	120.67	3	2144.075	2144.0750	R	K	69	88
PSM	ADHSFSDGVPSDSVEAAKNASNTEK	522	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=14369	69.52785333333333	3	2684.1244	2684.1234	M	L	2	27
PSM	SAEIDSDDTGGSAAQK	523	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=2515	13.156401666666666	2	1551.662645	1550.669624	K	Q	814	830
PSM	TSSKESSPIPSPTSDRK	524	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=3600	18.178281666666667	2	2043.807936	2042.800014	R	A	2159	2176
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK	525	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21	ms_run[1]:scan=19667	95.51227666666668	3	4458.088826	4458.072495	K	K	34	85
PSM	LVQDVANNTNEEAGDGTTTATVLAR	526	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=15108	72.98961833333334	3	2560.231418	2559.241253	K	S	97	122
PSM	ASGADSKGDDLSTAILK	527	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,7-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=15687	75.88420166666667	2	1701.8837	1701.8818	M	Q	2	19
PSM	SGGGTGEEPGSQGLNGEAGPEDSTR	528	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=7720	37.770406666666666	3	2345.988500	2345.000354	K	E	173	198
PSM	KVVEAVNSDSDSEFGIPK	529	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=15667	75.790155	2	2080.886418	2079.880299	K	K	1515	1533
PSM	QIYYSDKYDDEEFEYR	530	sp|P61024|CKS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,7-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=20426	99.24125500000001	2	2160.9217	2160.9130	K	H	5	21
PSM	SAEVETSEGVDESEKK	531	sp|P30519|HMOX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1	ms_run[1]:scan=7438	36.433636666666665	2	1764.7923	1764.7896	M	N	2	18
PSM	YYSPCEEHPAETNQNEGSESGTIR	532	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[1]:scan=9966	48.34004	3	2845.1092	2844.1202	R	Q	182	206
PSM	QTSNRSEPSGEINIDSSGETVGSGER	533	sp|P42695|CNDD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:21,5-UNIMOD:267,26-UNIMOD:267	ms_run[1]:scan=11896	57.846709999999995	3	2792.198274	2792.200092	R	C	515	541
PSM	IDHLSSSAPGSPPDLLESVPK	534	sp|Q5TC82|RC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:188	ms_run[1]:scan=22173	108.43787833333334	3	2312.062385	2311.048155	K	S	525	546
PSM	NPDDITQEEYGEFYK	535	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:188	ms_run[1]:scan=18275	88.67670333333334	2	1853.799913	1852.809869	R	S	292	307
PSM	GVSSQETAGIGASAHLVNFK	536	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=23905	117.44088166666667	2	2132.935305	2131.934066	R	G	197	217
PSM	AACSSSEEDDCVSLSK	537	sp|Q9H019-3|MFR1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,11-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6426	31.608	2	1749.7129	1749.7129	K	A	208	224
PSM	AADEEAFEDNSEEYIR	538	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15622	75.593	2	1886.7806	1886.7806	R	R	300	316
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	539	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=12240	59.431	3	3090.3373	3090.3373	R	V	1094	1125
PSM	AATEALGEKSPDSATVSGYDIMK	540	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=17198	83.451	3	2420.0818	2420.0818	K	S	930	953
PSM	ADPDGPEAQAEACSGER	541	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4	ms_run[2]:scan=6436	31.658	2	1758.7115	1758.7115	K	T	6	23
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	542	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,15-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=19569	94.969	3	3664.6141	3664.6141	R	A	360	392
PSM	APPPPSSPPPGGAPDGSEPSPDFPALLVEK	543	sp|O00459|P85B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=25128	124.35	3	2986.4001	2986.4001	R	L	257	287
PSM	APSTPVPPSPAPAPGLTK	544	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=12161	59.032	2	1763.8859	1763.8859	K	R	87	105
PSM	APSTPVPPSPAPAPGLTK	545	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=12368	60.121	2	1763.8859	1763.8859	K	R	87	105
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	546	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14698	71.108	3	2789.2772	2789.2772	R	T	112	140
PSM	ATSTSTSGAGDVGKEALSGGEASLVEK	547	sp|Q96T17-5|MA7D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=16901	81.889	3	2588.1855	2588.1855	K	V	177	204
PSM	AVTEQGAELSNEER	548	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=6252	30.752	2	1541.7197	1541.7197	K	N	28	42
PSM	DADAGDEDEESEEPR	549	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=2405	12.618	2	1672.6212	1672.6212	R	A	35	50
PSM	DASDDLDDLNFFNQK	550	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=24387	120.1	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	551	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=25217	124.88	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	552	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=25554	126.89	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	553	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=25720	127.9	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	554	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=25890	128.91	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	555	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=26363	131.93	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	556	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=26676	133.95	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	557	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=26978	135.96	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	558	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=27275	137.99	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	559	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25308	125.47	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	560	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25485	126.48	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	561	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25650	127.49	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	562	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25819	128.5	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	563	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=25982	129.52	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	564	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=26142	130.53	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	565	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=26619	133.56	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	566	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27791	141.63	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	567	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=28076	143.64	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	568	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=28213	144.65	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	569	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29495	153.76	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	570	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29850	155.8	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	571	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27364	138.59	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	572	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29687	154.79	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	573	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=30010	156.84	2	1755.7588	1755.7588	K	K	65	80
PSM	DCDLQEDEACYNCGR	574	sp|P62633-8|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=9656	46.882	2	1913.6854	1913.6854	K	G	59	74
PSM	DCDLQEDEACYNCGR	575	sp|P62633-8|CNBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=9658	46.893	2	1903.6771	1903.6771	K	G	59	74
PSM	DDPVTNLNNAFEVAEK	576	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21975	107.39	2	1774.8374	1774.8374	K	Y	218	234
PSM	DFDDLCSLPDLNEK	577	sp|B2RTY4-3|MYO9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4	ms_run[2]:scan=22415	109.68	2	1679.7349	1679.7349	K	T	147	161
PSM	DGLNDDDFEPYLSPQAR	578	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21272	103.73	2	1950.8595	1950.8595	K	P	27	44
PSM	DLADELALVDVIEDK	579	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29451	153.5	2	1656.8458	1656.8458	K	L	43	58
PSM	DLADELALVDVIEDK	580	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=29453	153.51	2	1662.8659	1662.8659	K	L	43	58
PSM	DYAAYNVLDDPELR	581	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21894	106.95	2	1652.7682	1652.7682	R	Q	84	98
PSM	DYAAYNVLDDPELR	582	sp|Q86SX6|GLRX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=21898	106.97	2	1662.7765	1662.7765	R	Q	84	98
PSM	DYLDFLDDEEDQGIYQSK	583	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:188	ms_run[2]:scan=26286	131.46	3	2197.9635	2197.9635	R	V	18	36
PSM	EAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSR	584	sp|Q8IV56|PRR15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:21,32-UNIMOD:267	ms_run[2]:scan=18471	89.62	3	3236.5055	3236.5055	K	E	26	58
PSM	EGPEPPEEVPPPTTPPVPK	585	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=14593	70.598	2	2078.9909	2078.9909	K	V	597	616
PSM	EGTGSTATSSSSTAGAAGK	586	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=845	5.8706	2	1626.7333	1626.7333	K	G	6	25
PSM	EIEMSVDDDDINSSK	587	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=12579	61.163	2	1701.7347	1701.7347	R	V	512	527
PSM	ELAQQVQQVADDYGK	588	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=18205	88.35	2	1690.8162	1690.8162	R	C	176	191
PSM	ENSETVVTGSLDDLVK	589	sp|Q9GZS3|WDR61_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21630	105.58	2	1704.8418	1704.8418	K	V	30	46
PSM	ETTDTDTADQVIASFK	590	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20717	100.7	2	1740.8054	1740.8054	R	V	838	854
PSM	EVLDEDTDEEKETLK	591	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=10317	50.1	2	1871.7925	1871.7925	K	N	990	1005
PSM	FSKEEPVSSGPEEAVGK	592	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10215	49.642	3	1935.7904	1935.7904	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	593	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10235	49.736	2	1935.7904	1935.7904	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	594	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,8-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=9835	47.746	2	1947.8307	1947.8307	K	S	562	579
PSM	FSKEEPVSSGPEEAVGK	595	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:188,8-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=10076	48.88	2	1947.8307	1947.8307	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	596	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=2749	14.244	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	597	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=3645	18.376	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	598	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=5162	25.505	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	599	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=23265	114.08	3	2431.1719	2431.1719	R	S	258	284
PSM	GNEFFCEVDEDYIQDK	600	sp|P67870|CSK2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=23243	113.97	2	2012.8405	2012.8405	R	F	18	34
PSM	GPDKLLPYPTLASPASD	601	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=22694	111.11	2	1820.8597	1820.8597	R	-	228	245
PSM	GSSPGIQDTLEAEDGAFETDEAPEDR	602	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	26-UNIMOD:267	ms_run[2]:scan=20830	101.3	3	2745.1765	2745.1765	K	I	239	265
PSM	GTQTYSVLEGDPSENYSK	603	sp|P52701-4|MSH6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13830	67.052	2	1973.8854	1973.8854	K	Y	218	236
PSM	GTYFPAILNPPPSPATER	604	sp|O75581|LRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=23973	117.8	2	2016.9586	2016.9586	K	S	1478	1496
PSM	IACDEEFSDSEDEGEGGRR	605	sp|Q92769-3|HDAC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:4,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=7155	35.098	2	2316.7879	2316.7879	R	N	385	404
PSM	ICDPYAWLEDPDSEQTK	606	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=23563	115.63	2	2071.914	2071.9140	K	A	24	41
PSM	IDLPEYQGEPDEISIQK	607	sp|Q9BY32-2|ITPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=20127	97.744	2	1978.9831	1978.9831	K	C	23	40
PSM	IEDLSQQAQLAAAEK	608	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=13270	64.519	2	1619.8462	1619.8462	K	F	128	143
PSM	IVLTSLPALAVPPPTPTK	609	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=25849	128.67	2	1894.0581	1894.0581	K	A	329	347
PSM	KPVTVSPTTPTSPTEGEAS	610	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,12-UNIMOD:21	ms_run[2]:scan=8364	40.834	2	1970.9181	1970.9181	R	-	505	524
PSM	KVVEAVNSDSDSEFGIPK	611	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=17176	83.338	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LDEEEEDNEGGEWER	612	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:267	ms_run[2]:scan=9913	48.123	2	1844.7212	1844.7212	R	V	279	294
PSM	LDEEEEDNEGGEWER	613	sp|Q99613-2|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9914	48.127	2	1834.7129	1834.7129	R	V	279	294
PSM	LDHALNSPTSPCEEVIK	614	sp|Q96FC7-3|PHIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=13337	64.842	2	2074.8779	2074.8779	R	N	6	23
PSM	LEFEETEEPDFTALCQK	615	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4	ms_run[2]:scan=22400	109.61	2	2084.9249	2084.9249	R	L	47	64
PSM	LEVDEDFEEDNAAK	616	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=13262	64.488	2	1628.7149	1628.7149	R	V	391	405
PSM	LGDEDEEIDGDTNK	617	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=6455	31.751	2	1554.6629	1554.6629	K	Y	816	830
PSM	LKSSTSFANIQENSN	618	sp|Q86WC4|OSTM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=11088	53.992	2	1718.7513	1718.7513	R	-	320	335
PSM	LQDLDTDYGSGYPNDPK	619	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:188	ms_run[2]:scan=13088	63.656	2	1902.8579	1902.8579	K	T	199	216
PSM	LSVPTSDEEDEVPAPKPR	620	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13315	64.748	3	2124.9018	2124.9018	K	G	104	122
PSM	LVQDVANNTNEEAGDGTTTATVLAR	621	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14228	68.879	3	2559.2413	2559.2413	K	S	97	122
PSM	NPDDITNEEYGEFYK	622	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=17548	85.25	2	1838.7942	1838.7942	R	S	300	315
PSM	NPDDITNEEYGEFYK	623	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16869	81.73	2	1832.7741	1832.7741	R	S	300	315
PSM	NPDDITNEEYGEFYK	624	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17055	82.734	2	1832.7741	1832.7741	R	S	300	315
PSM	QNLYDLDEDDDGIASVPTK	625	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19127	92.782	2	2106.9593	2106.9593	K	Q	179	198
PSM	QNLYDLDEDDDGIASVPTK	626	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19283	93.575	3	2106.9593	2106.9593	K	Q	179	198
PSM	QTSNRSEPSGEINIDSSGETVGSGER	627	sp|P42695|CNDD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:267,6-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=11817	57.487	3	2792.2001	2792.2001	R	C	515	541
PSM	QTSNRSEPSGEINIDSSGETVGSGER	628	sp|P42695|CNDD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=11825	57.523	3	2772.1836	2772.1836	R	C	515	541
PSM	RASGQAFELILSPR	629	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=22680	111.04	2	1703.7797	1703.7797	K	S	14	28
PSM	RASGQAFELILSPR	630	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,3-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=22886	112.09	2	1723.7963	1723.7963	K	S	14	28
PSM	RNSSSPVSPASVPGQR	631	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=6598	32.449	2	1804.7773	1804.7773	R	R	655	671
PSM	RPPSPDVIVLSDNEQPSSPR	632	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,4-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=15299	73.918	3	2369.0569	2369.0569	R	V	97	117
PSM	SAVCIADPLPTPSQEKSQTELPDEK	633	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19417	94.213	3	2831.3339	2831.3339	K	I	355	380
PSM	SCSEEKIPEDGSLNTTK	634	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=9135	44.511	2	1973.8289	1973.8289	R	-	551	568
PSM	SDLQDELDINELPNCK	635	sp|Q8TF05-2|PP4R1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:4	ms_run[2]:scan=20302	98.613	2	1901.8677	1901.8677	R	I	535	551
PSM	SETAPAETATPAPVEKSPAK	636	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=30807	162.32	2	2073.007	2073.0070	M	K	2	22
PSM	SFSKEELMSSDLEETAGSTSIPK	637	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:188,9-UNIMOD:21,10-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=20483	99.51	3	2644.1307	2644.1307	K	R	511	534
PSM	SGDSEVYQLGDVSQK	638	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=12696	61.702	2	1616.7625	1616.7625	R	T	67	82
PSM	SGDSEVYQLGDVSQK	639	sp|Q04837|SSBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12697	61.705	2	1610.7424	1610.7424	R	T	67	82
PSM	SGIETFSPPPPPPK	640	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=14079	68.183	2	1529.7167	1529.7167	R	S	706	720
PSM	SGIETFSPPPPPPK	641	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=14293	69.189	2	1529.7167	1529.7167	R	S	706	720
PSM	SGIETFSPPPPPPK	642	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21,14-UNIMOD:188	ms_run[2]:scan=14207	68.782	2	1535.7368	1535.7368	R	S	706	720
PSM	SGSLDDSFSDFQELPASSK	643	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	19-UNIMOD:188	ms_run[2]:scan=21049	102.57	2	2021.9161	2021.9161	K	T	306	325
PSM	SPDEEDYDYESYEK	644	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11519	56.089	2	1767.6635	1767.6635	R	T	1881	1895
PSM	SPDEEDYDYESYEK	645	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:188	ms_run[2]:scan=11539	56.177	2	1773.6837	1773.6837	R	T	1881	1895
PSM	SPQVLGSSLSVRSPTGSPSR	646	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=14235	68.908	2	2157.9821	2157.9821	K	L	975	995
PSM	SSPEPVALTESETEYVIR	647	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:267	ms_run[2]:scan=21746	106.18	2	2015.9927	2015.9927	K	C	632	650
PSM	TAPRQEAIPDLEDSPPVSDSEEQQESAR	648	sp|Q9BTC0-1|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15436	74.691	3	3240.3497	3240.3497	K	A	792	820
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	649	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=17720	86.032	3	2925.2471	2925.2471	R	R	67	93
PSM	TLSSPSLQTDGIAATPVPPPPPPK	650	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=19428	94.266	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TQNDVDIADVAYYFEK	651	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27477	139.42	2	1889.8683	1889.8683	K	D	203	219
PSM	TTGEENGVEAEEWGK	652	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=10256	49.836	2	1640.7261	1640.7261	K	F	78	93
PSM	TVQTAAANAASTAASSAAQNAFK	653	sp|O15126|SCAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	23-UNIMOD:188	ms_run[2]:scan=20331	98.755	3	2157.0758	2157.0758	K	G	312	335
PSM	VAAAAGSGPSPPGSPGHDR	654	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4226	21.111	2	1856.7483	1856.7483	R	E	38	57
PSM	VASETHSEGSEYEELPK	655	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=10757	52.235	2	1976.8348	1976.8348	R	R	1130	1147
PSM	VFLQGPAPVGTPSFNR	656	sp|Q8IWZ3|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=20082	97.532	2	1775.8635	1775.8635	R	Q	2313	2329
PSM	VIAINVDDPDAANYNDINDVK	657	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19876	96.511	3	2287.0968	2287.0968	K	R	156	177
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQR	658	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=23218	113.84	3	2991.3833	2991.3833	K	K	139	166
PSM	VPPLSLGYGVCPEPPSPGPALVK	659	sp|A4D1S0-2|KLRG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=25028	123.76	2	2410.2008	2410.2008	R	L	80	103
PSM	VQGSDSDEEVVVATTR	660	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9961	48.326	2	1690.801	1690.8010	K	I	522	538
PSM	VSLLDDTVYECVVEK	661	sp|P11171-4|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=23935	117.6	2	1773.8802	1773.8802	K	H	5	20
PSM	VSSQGNLIPARPAPAPPLYSSLT	662	sp|Q13443|ADAM9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:267,20-UNIMOD:21	ms_run[2]:scan=21776	106.34	2	2425.2282	2425.2282	K	-	797	820
PSM	VTLLDGTEYSCDLEK	663	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4	ms_run[2]:scan=19157	92.92	2	1741.808	1741.8080	K	H	222	237
PSM	VTPDIEESLLEPENEK	664	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20429	99.256	2	1840.8942	1840.8942	K	I	200	216
PSM	VTPDIEESLLEPENEK	665	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:188	ms_run[2]:scan=20412	99.165	2	1846.9143	1846.9143	K	I	200	216
PSM	VVSSTSEEEEAFTEK	666	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10900	52.97	2	1670.7523	1670.7523	R	F	131	146
PSM	VVVTVEQTEEELER	667	sp|O15269|SPTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:267	ms_run[2]:scan=18045	87.602	2	1668.8446	1668.8446	R	A	446	460
PSM	YNDWSDDDDDSNESK	668	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188	ms_run[2]:scan=5860	28.668	2	1809.6545	1809.6545	R	S	57	72
PSM	YYSPCEEHPAETNQNEGAESGTIR	669	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9840	47.765	3	2818.1178	2818.1178	R	Q	182	206
PSM	ADHSFSDGVPSDSVEAAK	670	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,18-UNIMOD:188	ms_run[1]:scan=12545	61.00618666666667	2	1865.8348	1865.8370	M	N	2	20
PSM	SAEIDSDDTGGSAAQK	671	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:188	ms_run[1]:scan=2514	13.152796666666667	2	1556.693501	1556.689753	K	Q	814	830
PSM	TEDGGEFEEGASENNAK	672	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=5687	27.91021	2	1782.712301	1782.718031	K	E	434	451
PSM	NPDDITQEEYGEFYK	673	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:188	ms_run[1]:scan=17786	86.37225	2	1852.815010	1852.809869	R	S	292	307
PSM	SEAPETPMEEEAELVLTEK	674	sp|Q5JTH9|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0		ms_run[1]:scan=26599	133.43107333333333	2	2132.0142	2130.9872	K	S	72	91
PSM	NPDDITNEEYGEFYK	675	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:188	ms_run[1]:scan=17756	86.20858166666666	2	1839.785774	1838.794218	R	S	300	315
PSM	AQAVSEEEEEEEGKSSSPK	676	sp|Q9GZR7|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	5-UNIMOD:21	ms_run[1]:scan=5520	27.16341	2	2129.8572	2128.8682	K	K	78	97
PSM	LVQDVANNTNEEAGDGTTTATVLAR	677	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	25-UNIMOD:267	ms_run[1]:scan=14804	71.57101666666667	3	2570.236855	2569.249522	K	S	97	122
PSM	GDVVNQDDLYQALASGK	678	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	17-UNIMOD:188	ms_run[1]:scan=21685	105.88000833333332	2	1798.877999	1797.884037	R	I	246	263
PSM	TEELIESPKLESSEGEIIQTVDR	679	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21	ms_run[1]:scan=24214	119.16341000000001	3	2681.287201	2681.268453	K	Q	602	625
PSM	DASDDLDDLNFFNQK	680	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=24470	120.54523833333333	2	1756.767338	1755.758774	K	K	65	80
PSM	DASDDLDDLNFFNQK	681	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=26456	132.54790333333335	2	1756.778029	1755.758774	K	K	65	80
PSM	CTSHSETPTVDDEEKVDER	682	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=10232	49.72231166666666	2	2295.8834	2295.8833	R	A	671	690
PSM	QNLYDLDEDDDGIASVPTK	683	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	19-UNIMOD:188	ms_run[1]:scan=19297	93.64752	2	2112.987764	2112.979453	K	Q	179	198
PSM	VEKEEAGGGISEEEAAQYDR	684	sp|Q9UBE0|SAE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=13439	65.31540666666666	3	2207.9790	2207.9813	M	Q	2	22
PSM	ADKEAAFDDAVEER	685	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,3-UNIMOD:188,14-UNIMOD:267	ms_run[1]:scan=13662	66.30150333333333	2	1622.7390	1622.7390	M	V	2	16
PSM	ADPDGPEAQAEACSGER	686	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:4,17-UNIMOD:267	ms_run[1]:scan=6447	31.71477	2	1769.722772	1768.719775	K	T	6	23
PSM	SQKQEEENPAEETGEEK	687	sp|O43768|ENSA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1	ms_run[1]:scan=4257	21.24959666666667	2	2002.8647	2002.8598	M	Q	2	19
PSM	DTAEGVSQELISAGLVDGR	688	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=24275	119.48364666666666	2	1916.965009	1915.948700	R	D	459	478
PSM	TEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQAR	689	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=16590	80.35653666666667	4	4616.995859	4616.985787	R	D	68	114
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	690	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21	ms_run[1]:scan=18857	91.44438833333334	3	2693.170889	2692.175281	R	L	42	66
PSM	AAPEASSPPASPLQHLLPGK	691	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=20914	101.87	2	2126.9803	2126.9803	K	A	673	693
PSM	AEAAASALADADADLEER	692	sp|O43633|CHM2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18933	91.8	3	1787.8174	1787.8174	K	L	198	216
PSM	AEDGSVIDYELIDQDAR	693	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20929	101.95	2	1907.8749	1907.8749	R	D	180	197
PSM	AEEAQKTESVDNEGE	694	sp|Q15651|HMGN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:188	ms_run[2]:scan=1778	9.76	2	1640.7109	1640.7109	K	-	85	100
PSM	AEGSEAAELAEIYAK	695	sp|Q9NUQ8-2|ABCF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18858	91.448	2	1550.7464	1550.7464	R	L	274	289
PSM	AEGSEAAELAEIYAK	696	sp|Q9NUQ8-2|ABCF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=18859	91.451	2	1556.7665	1556.7665	R	L	274	289
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	697	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=11881	57.78	3	3173.2435	3173.2435	R	-	502	532
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	698	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=13254	64.454	3	3173.2435	3173.2435	R	-	502	532
PSM	AGLESGAEPGDGDSDTTK	699	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4600	22.878	2	1705.7279	1705.7279	K	K	481	499
PSM	ALQEGQPEEDETDDR	700	sp|Q96BZ8|LENG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=4875	24.161	2	1730.7231	1730.7231	R	R	225	240
PSM	AQEAPGQAEPPAAAEVQGAGNENEPR	701	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:267	ms_run[2]:scan=10624	51.595	3	2597.1982	2597.1982	R	E	113	139
PSM	AQLSSPEDQDDQDDIK	702	sp|Q86US8|EST1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=7741	37.861	2	1808.8008	1808.8008	K	V	996	1012
PSM	ASLLTDEEDVDMALDQR	703	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=23917	117.51	2	1929.8865	1929.8865	K	F	996	1013
PSM	ASPITNDGEDEFVPSDGLDKDEYTFSPGK	704	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=22253	108.84	3	3209.3602	3209.3602	K	S	1394	1423
PSM	AVTEQGAELSNEER	705	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6247	30.719	2	1531.7114	1531.7114	K	N	28	42
PSM	DADAGDEDEESEEPR	706	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2395	12.574	2	1662.6129	1662.6129	R	A	35	50
PSM	DASDDLDDLNFFNQK	707	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=24902	123.05	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	708	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=25043	123.86	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	709	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=25072	124.02	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	710	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=25374	125.89	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	711	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=26050	129.92	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	712	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=26204	130.93	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	713	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=26515	132.94	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	714	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=26822	134.95	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	715	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=27130	136.99	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	716	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=27857	142.05	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	717	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=28135	144.08	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	718	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=29289	152.51	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	719	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=24974	123.45	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	720	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=26300	131.54	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	721	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=26765	134.56	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	722	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27073	136.58	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	723	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27508	139.62	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	724	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=28351	145.65	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	725	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=28487	146.66	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	726	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=30311	158.87	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	727	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=30462	159.89	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	728	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=25147	124.46	2	1755.7588	1755.7588	K	K	65	80
PSM	DASTLQSQKAEGTGDAK	729	sp|O00479|HMGN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=1823	9.977	2	1785.7782	1785.7782	R	-	74	91
PSM	DSSTSYTETKDPSSGQEVATPPVPQLQVCEPK	730	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	20-UNIMOD:21,29-UNIMOD:4	ms_run[2]:scan=17828	86.581	3	3541.5808	3541.5808	R	E	663	695
PSM	DTSFLGSDDIGNIDVR	731	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22260	108.88	2	1722.8061	1722.8061	K	E	397	413
PSM	DVDASPSPLSVQDLK	732	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16841	81.583	2	1569.7886	1569.7886	R	G	405	420
PSM	EADTVELAELGPLLEEK	733	sp|Q96A54|PAQR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:188	ms_run[2]:scan=27009	136.18	2	1860.9664	1860.9664	R	G	21	38
PSM	EAISDEDEDEALYQK	734	sp|Q9C0B7|TNG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=11465	55.83	2	1759.7731	1759.7731	K	V	553	568
PSM	EAQSSQATPVQTSQPDSSNIVKVSPR	735	sp|Q8IZH2-2|XRN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	24-UNIMOD:21	ms_run[2]:scan=11569	56.306	3	2820.3291	2820.3291	K	E	1610	1636
PSM	EDAGDNDDTEGAIGVR	736	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=7237	35.46	2	1642.6946	1642.6946	R	N	377	393
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	737	sp|P54725-2|RD23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=9333	45.429	3	3001.2673	3001.2673	R	E	120	150
PSM	EDTESLEIFQNEVAR	738	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=21026	102.47	2	1778.8323	1778.8323	K	Q	271	286
PSM	EGGDGEEQDVGDAGR	739	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=2219	11.784	2	1499.6	1499.6000	R	L	292	307
PSM	EIESEIDSEEELINK	740	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18556	90.019	2	1775.8313	1775.8313	K	K	755	770
PSM	ELAQQVQQVADDYGK	741	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=18188	88.263	2	1696.8364	1696.8364	R	C	176	191
PSM	ESEITDEDIDGILER	742	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=21761	106.25	2	1732.8003	1732.8003	K	G	666	681
PSM	EVEDKESEGEEEDEDEDLSK	743	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=6675	32.819	2	2418.8959	2418.8959	K	Y	147	167
PSM	EVEDKESEGEEEDEDEDLSK	744	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:188,7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6492	31.902	2	2430.9362	2430.9362	K	Y	147	167
PSM	FSKEEPVSSGPEEAVGK	745	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=9614	46.712	2	1935.7904	1935.7904	K	S	562	579
PSM	GAGDGSDEEVDGKADGAEAKPAE	746	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3689	18.551	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	747	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4465	22.251	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	748	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=1876	10.202	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	749	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=2135	11.382	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	750	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23169	113.59	3	2441.1802	2441.1802	R	S	258	284
PSM	GIPLATGDTSPEPELLPGAPLPPPK	751	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=25392	125.97	3	2543.2924	2543.2924	K	E	33	58
PSM	GPDKLLPYPTLASPASD	752	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:188,13-UNIMOD:21	ms_run[2]:scan=22402	109.62	2	1826.8799	1826.8799	R	-	228	245
PSM	GPPASSPAPAPKFSPVTPK	753	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13005	63.3	3	1991.9159	1991.9159	R	F	97	116
PSM	GTELDDGIQADSGPINDTDANPR	754	sp|P55210-4|CASP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	23-UNIMOD:267	ms_run[2]:scan=14694	71.086	3	2380.0654	2380.0654	R	Y	163	186
PSM	GYAYVEFENPDEAEK	755	sp|Q15287|RNPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16747	81.108	2	1759.7577	1759.7577	K	A	204	219
PSM	GYNDDYYEESYFTTR	756	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18522	89.845	2	1921.7643	1921.7643	K	T	89	104
PSM	IDHLSSSAPGSPPDLLESVPK	757	sp|Q5TC82-2|RC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=22370	109.47	3	2311.0482	2311.0482	K	S	525	546
PSM	IDQYQGADAVGLEEK	758	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=12124	58.872	2	1640.7989	1640.7989	R	I	88	103
PSM	IVLTSLPALAVPPPTPTK	759	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=25677	127.66	2	1894.0581	1894.0581	K	A	329	347
PSM	LASETEDNDNSLGDILQASDNLSR	760	sp|Q9NZ52-3|GGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=24450	120.44	3	2576.1838	2576.1838	K	V	143	167
PSM	LCSTEEETAELLSK	761	sp|P49441|INPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=16968	82.256	2	1614.7754	1614.7754	R	V	96	110
PSM	LCSTEEETAELLSK	762	sp|P49441|INPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:4	ms_run[2]:scan=16972	82.288	2	1608.7553	1608.7553	R	V	96	110
PSM	LGDEDEEIDGDTNK	763	sp|P09884|DPOLA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6445	31.705	2	1548.6427	1548.6427	K	Y	816	830
PSM	LIVDEAINEDNSVVSLSQPK	764	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=21727	106.09	3	2169.1165	2169.1165	R	M	26	46
PSM	LLDAEDVDVPSPDEK	765	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15921	76.996	2	1640.7781	1640.7781	R	S	270	285
PSM	LLDAEDVDVPSPDEK	766	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=15965	77.237	2	1646.7982	1646.7982	R	S	270	285
PSM	LLSGPKETPAAQSPTRGPSDTK	767	sp|P53814-5|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=7222	35.396	3	2477.0642	2477.0642	K	R	265	287
PSM	LNSELDLDDAILEK	768	sp|Q9NWS8-2|RMND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=21962	107.33	2	1592.8241	1592.8241	K	F	78	92
PSM	LSEGSQPAEEEEDQETPSR	769	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6183	30.374	2	2116.9033	2116.9033	K	N	239	258
PSM	LTVEDPVTVEYITR	770	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20959	102.12	2	1633.8563	1633.8563	R	Y	26	40
PSM	LVQDVANNTNEEAGDGTTTATVLAR	771	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14445	69.896	3	2559.2413	2559.2413	K	S	97	122
PSM	NHLSPQQGGATPQVPSPCCR	772	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=9780	47.477	3	2349.9385	2349.9385	K	F	166	186
PSM	NPDDITNEEYGEFYK	773	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=17056	82.736	2	1838.7942	1838.7942	R	S	300	315
PSM	NPDDITQEEYGEFYK	774	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17447	84.751	2	1846.7897	1846.7897	R	S	292	307
PSM	NSTECTLILTEGDSAK	775	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=14194	68.719	2	1737.8091	1737.8091	R	T	451	467
PSM	NSYVAGQYDDAASYQR	776	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11131	54.177	2	1806.7809	1806.7809	R	L	105	121
PSM	NYTDEAIETDDLTIK	777	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17658	85.761	2	1739.8101	1739.8101	K	L	105	120
PSM	QDENDDDDDWNPCK	778	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=8757	42.803	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	779	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=8981	43.817	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	780	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=9198	44.823	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	781	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4	ms_run[2]:scan=9427	45.84	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	782	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9041	44.1	2	1770.6371	1770.6371	K	A	188	202
PSM	QDENDDDDDWNPCK	783	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9267	45.119	2	1770.6371	1770.6371	K	A	188	202
PSM	QDENDDDDDWNPCK	784	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=9489	46.125	2	1770.6371	1770.6371	K	A	188	202
PSM	QLQQAQAAGAEQEVEK	785	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=7759	37.939	2	1732.8687	1732.8687	K	F	46	62
PSM	QSDDEVYAPGLDIESSLK	786	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=21904	107.01	2	1970.9416	1970.9416	K	Q	385	403
PSM	RYASGSSASLGGPESAVA	787	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:21	ms_run[2]:scan=10902	52.982	2	1745.7622	1745.7622	R	-	4498	4516
PSM	SAEIDSDDTGGSAAQK	788	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2973	15.251	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAEIDSDDTGGSAAQK	789	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2659	13.835	2	1550.6696	1550.6696	K	Q	814	830
PSM	SAVCIADPLPTPSQEKSQTELPDEK	790	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=19163	92.957	3	2819.2936	2819.2936	K	I	355	380
PSM	SAVCIADPLPTPSQEKSQTELPDEK	791	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=19368	93.978	3	2819.2936	2819.2936	K	I	355	380
PSM	SAVEAQNEVTENPK	792	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:188	ms_run[2]:scan=4788	23.757	2	1520.7414	1520.7414	K	Q	562	576
PSM	SDISPLTPRESSPLYSPTFSDSTSAVKEK	793	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=20086	97.554	3	3365.4394	3365.4394	K	T	1782	1811
PSM	SEAEDEDDEDYVPYVPLR	794	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20550	99.841	2	2139.912	2139.9120	R	Q	23	41
PSM	SEDPDQQYLILNTAR	795	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17653	85.735	2	1761.8533	1761.8533	R	K	500	515
PSM	SETAPAETATPAPVEK	796	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=6140	30.137	2	1603.8037	1603.8037	M	S	2	18
PSM	SETAPAETATPAPVEKSPAK	797	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=29803	155.49	2	2073.007	2073.0070	M	K	2	22
PSM	SGAGSSPETKEQNSALPTSSQDEELMEVVEK	798	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=22357	109.4	3	3343.4651	3343.4651	R	S	1214	1245
PSM	SGTPPRQGSITSPQANEQSVTPQRR	799	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=7743	37.872	2	2918.2474	2918.2474	K	S	846	871
PSM	SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK	800	sp|P16989-3|YBOX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=19614	95.214	4	4458.0725	4458.0725	K	K	34	85
PSM	SQPKAPPVDDAEVDELVLQTK	801	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=21762	106.26	2	2358.1356	2358.1356	R	R	1311	1332
PSM	SSKASLGSLEGEAEAEASSPKGK	802	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17085	82.868	3	2458.9907	2458.9907	K	F	5745	5768
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	803	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=20372	98.974	3	2692.1753	2692.1753	R	L	42	66
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	804	sp|Q8N2F6-6|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,3-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=19932	96.799	3	2704.2155	2704.2155	R	L	42	66
PSM	SSTGEASENGLEDIDR	805	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:267	ms_run[2]:scan=10734	52.136	2	1688.7365	1688.7365	K	I	137	153
PSM	SSVLIAQQTDTSDPEK	806	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:188	ms_run[2]:scan=9325	45.393	2	1723.8572	1723.8572	K	V	453	469
PSM	SVPTSTVFYPSDGVATEK	807	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	18-UNIMOD:188	ms_run[2]:scan=16262	78.724	2	1889.9354	1889.9354	R	A	439	457
PSM	SWLSPRVSPPASPGP	808	sp|Q9Y4U1|MMAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=19716	95.747	2	1613.7603	1613.7603	R	-	268	283
PSM	SWLSPRVSPPASPGP	809	sp|Q9Y4U1|MMAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=19521	94.742	2	1613.7603	1613.7603	R	-	268	283
PSM	TASESISNLSEAGSIKKGER	810	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=10346	50.216	2	2302.9485	2302.9485	K	E	191	211
PSM	TDASSASSFLDSDELER	811	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	17-UNIMOD:267	ms_run[2]:scan=18484	89.665	3	1838.8045	1838.8045	R	T	330	347
PSM	TDDYLDQPCYETINR	812	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=15476	74.887	2	1911.8184	1911.8184	R	I	149	164
PSM	TEGDEEAEEEQEENLEASGDYK	813	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:188	ms_run[2]:scan=12258	59.52	3	2506.0086	2506.0086	K	Y	10	32
PSM	TEQEEDEELLSESR	814	sp|P28370-2|SMCA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12050	58.539	2	1692.7326	1692.7326	R	K	149	163
PSM	TFEEALARGDAASSPAPAASVGSSQGGAR	815	sp|Q8WVB6|CTF18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=14648	70.859	3	2877.2332	2877.2332	R	K	51	80
PSM	TLSSPSLQTDGIAATPVPPPPPPK	816	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=19021	92.239	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TNSPAYSDISDAGEDGEGKVDSVK	817	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=13790	66.871	3	2520.0541	2520.0541	K	S	840	864
PSM	TPGVLLPGAGGAAGFGMTSPPPPTSPSR	818	sp|Q6ZTU2-4|E400N_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	27-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23596	115.8	3	2666.2803	2666.2803	R	T	133	161
PSM	TSEIEPKNSPEDLGLSLTGDSCK	819	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=18198	88.313	3	2568.1705	2568.1705	K	L	492	515
PSM	TTYDSAEEENKENLYAGK	820	sp|Q9HAW4-2|CLSPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21,11-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9377	45.622	2	2152.924	2152.9240	K	N	79	97
PSM	TVIRLPSGSGAASPTGSAVDIR	821	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18648	90.441	3	2271.0661	2271.0661	K	A	204	226
PSM	TYADYESVNECMEGVCK	822	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=15918	76.982	3	2059.8269	2059.8269	R	M	18	35
PSM	VAAAAGSGPSPPGSPGHDR	823	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4064	20.342	2	1846.7401	1846.7401	R	E	38	57
PSM	VDATEESDLAQQYGVR	824	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15479	74.901	2	1779.8275	1779.8275	K	G	82	98
PSM	VDDDLGTIESLEEAK	825	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=20407	99.138	2	1638.7932	1638.7932	K	K	1380	1395
PSM	VDVECPDVNIEGPEGK	826	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:4	ms_run[2]:scan=14672	70.981	2	1755.7985	1755.7985	K	W	2802	2818
PSM	VFDDESDEKEDEEYADEK	827	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=10528	51.138	3	2270.8264	2270.8264	K	G	637	655
PSM	VIAINVDDPDAANYNDINDVK	828	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	21-UNIMOD:188	ms_run[2]:scan=19784	96.069	3	2293.1169	2293.1169	K	R	156	177
PSM	VQTDAFVSNELDDPDDLQCK	829	sp|Q9UI10-3|EI2BD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=19374	94.006	3	2314.0366	2314.0367	R	R	446	466
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	830	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=13482	65.485	3	2823.2448	2823.2448	K	A	248	274
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	831	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=13954	67.617	3	2823.2448	2823.2448	K	A	248	274
PSM	VSNSPEPQKAVEQEDELSDVSQGGSK	832	sp|O60271-3|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21,9-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=13515	65.622	3	2835.285	2835.2850	K	A	248	274
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	833	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=19054	92.404	3	3044.2802	3044.2802	K	-	135	164
PSM	VVSEDFLQDVSASTK	834	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:188	ms_run[2]:scan=20471	99.459	2	1629.8193	1629.8193	R	S	453	468
PSM	YLTESYGTGQDIDDR	835	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	15-UNIMOD:267	ms_run[2]:scan=11758	57.205	2	1741.767	1741.7670	R	I	167	182
PSM	YNDWSDDDDDSNESK	836	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5876	28.729	2	1803.6344	1803.6344	R	S	57	72
PSM	TSSKESSPIPSPTSDRK	837	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=3822	19.210758333333334	2	2043.807936	2042.800014	R	A	2159	2176
PSM	GADFLVTEVENGGSLGSK	838	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=20224	98.21758	2	1779.863352	1778.868659	K	K	189	207
PSM	SETAPAETATPAPVEKSPAK	839	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6766	33.221745	2	2102.9804	2102.9768	M	K	2	22
PSM	NPDDITQEEYGEFYK	840	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188	ms_run[1]:scan=18046	87.60441999999999	2	1853.803328	1852.809869	R	S	292	307
PSM	NPDDITQEEYGEFYK	841	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=17941	87.09089166666666	2	1847.800447	1846.789740	R	S	292	307
PSM	PSPSESPEPWKPFPAVSPEPR	842	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21,11-UNIMOD:188,17-UNIMOD:21	ms_run[1]:scan=20393	99.07626333333333	3	2484.078493	2483.090689	K	R	281	302
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	843	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=23654	116.09609833333334	4	4615.109407	4615.077956	R	Q	475	520
PSM	LVQDVANNTNEEAGDGTTTATVLAR	844	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=13959	67.642905	3	2560.228068	2559.241253	K	S	97	122
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	845	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=12365	60.10634666666667	3	3928.654413	3927.670193	R	Q	329	367
PSM	DASDDLDDLNFFNQK	846	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=24283	119.52746499999999	2	1756.755838	1755.758774	K	K	65	80
PSM	DASDDLDDLNFFNQK	847	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:188	ms_run[1]:scan=30174	157.94804333333335	2	1762.788348	1761.778903	K	K	65	80
PSM	DASDDLDDLNFFNQK	848	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=24651	121.55674499999999	2	1756.756353	1755.758774	K	K	65	80
PSM	SEKSVEAAAELSAK	849	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,3-UNIMOD:188,14-UNIMOD:188	ms_run[1]:scan=13097	63.693243333333335	2	1472.7758	1472.7756	M	D	2	16
PSM	STNGDTFLGGEDFDQALLR	850	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	19-UNIMOD:267	ms_run[1]:scan=26573	133.26739666666666	2	2065.966807	2064.962782	K	H	266	285
PSM	CELLYEGPPDDEAAMGIK	851	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:4	ms_run[1]:scan=20824	101.27543	2	2007.909574	2006.896530	R	S	369	387
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	852	sp|Q8N2F6-2|ARM10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=20639	100.29706166666666	3	2693.176157	2692.175281	R	L	42	66
PSM	AAPEERDLTQEQTEK	853	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1	ms_run[1]:scan=9106	44.3834	2	1785.8376	1785.8376	M	L	2	17
PSM	ADKEAAFDDAVEER	854	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1	ms_run[1]:scan=13686	66.41197	2	1606.7111	1606.7106	M	V	2	16
PSM	PASPSSPEHLPATPAESPAQR	855	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=10679	51.87927333333333	2	2286.974465	2285.971908	R	F	232	253
PSM	VAAAAGSGPSPPGSPGHDR	856	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=4111	20.552936666666668	2	1847.746102	1846.740058	R	E	38	57
PSM	SCSEEKIPEDGSLNTTK	857	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,2-UNIMOD:4,6-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=9539	46.35719666666667	2	1986.855465	1985.869176	R	-	551	568
PSM	SAEIDSDDTGGSAAQK	858	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:188	ms_run[1]:scan=2670	13.890908333333334	2	1557.682027	1556.689753	K	Q	814	830
PSM	GAGDGSDEEVDGKADGAEAKPAE	859	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=3069	15.723215	3	2265.936147	2265.931319	K	-	1938	1961
PSM	SPQKSTVLTNGEAAMQSSNSESK	860	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=9421	45.81675166666667	3	2461.067432	2460.083964	K	K	86	109
PSM	VISDLTPVSELPLTARPRSR	861	sp|Q8IUR6|CRERF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,6-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=28955	150.11351666666667	3	2528.111527	2526.108690	K	K	508	528
PSM	AADEEAFEDNSEEYIR	862	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=15625	75.606	2	1896.7889	1896.7889	R	R	300	316
PSM	AAESPDQKDTDGGPKEEESPV	863	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21,8-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6032	29.588	2	2276.9725	2276.9725	K	-	480	501
PSM	AASADSTTEGTPADGFTVLSTK	864	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:188	ms_run[2]:scan=17099	82.94	3	2132.0217	2132.0217	K	S	168	190
PSM	AASSSSSSSSSSSSDDSEEEKAAATPK	865	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:21	ms_run[2]:scan=3259	16.622	3	2656.0509	2656.0509	K	K	214	241
PSM	AEDGSVIDYELIDQDAR	866	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20398	99.098	3	1907.8749	1907.8749	R	D	180	197
PSM	AEDGSVIDYELIDQDAR	867	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20668	100.44	2	1907.8749	1907.8749	R	D	180	197
PSM	AGGEEEDDDDEAAGGR	868	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1138	7.0251	2	1591.587	1591.5870	R	C	357	373
PSM	AGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAK	869	sp|Q86XP3-2|DDX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	37-UNIMOD:21,41-UNIMOD:188	ms_run[2]:scan=15613	75.551	4	3897.7498	3897.7498	K	G	602	643
PSM	ALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETR	870	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	27-UNIMOD:21,36-UNIMOD:267	ms_run[2]:scan=21236	103.54	4	3935.8593	3935.8593	R	A	355	391
PSM	APPPPSSPPPGGAPDGSEPSPDFPALLVEK	871	sp|O00459|P85B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=24954	123.34	3	2986.4001	2986.4001	R	L	257	287
PSM	APSTPVPPSPAPAPGLTK	872	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=12150	58.985	2	1763.8859	1763.8859	K	R	87	105
PSM	APSTPVPPSPAPAPGLTK	873	sp|Q96EZ8-3|MCRS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=12205	59.25	2	1769.906	1769.9060	K	R	87	105
PSM	ARSVDALDDLTPPSTAESGSRSPTSNGGR	874	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=14923	72.103	3	3140.285	3140.2850	R	S	335	364
PSM	ASGESEEASPSLTAEER	875	sp|O15550|KDM6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=7479	36.619	2	1758.7783	1758.7783	K	E	30	47
PSM	ASLLTDEEDVDMALDQR	876	sp|P52948-6|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=23920	117.53	2	1919.8782	1919.8782	K	F	996	1013
PSM	ASNLENSTYDLYTIPK	877	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19917	96.715	2	1827.8891	1827.8891	R	D	383	399
PSM	ASPNSDDTVLSPQELQK	878	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:188	ms_run[2]:scan=13301	64.675	2	1833.9052	1833.9052	R	V	109	126
PSM	AYEDDGDDYSSIMVK	879	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=14945	72.203	2	1712.7183	1712.7183	K	A	1062	1077
PSM	DAQNSSDSSFEKNVEITEQLANGR	880	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=21980	107.42	3	2718.177	2718.1770	K	H	80	104
PSM	DASDDLDDLNFFNQK	881	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=27567	140.02	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	882	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=27707	141.02	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	883	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=27997	143.06	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	884	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=28277	145.09	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	885	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=28688	148.14	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	886	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=29146	151.51	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	887	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=30002	156.79	2	1761.7789	1761.7789	K	K	65	80
PSM	DASDDLDDLNFFNQK	888	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=27650	140.62	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	889	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=29040	150.74	2	1755.7588	1755.7588	K	K	65	80
PSM	DASDDLDDLNFFNQK	890	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=29179	151.74	2	1755.7588	1755.7588	K	K	65	80
PSM	DATNVGDEGGFAPNILENK	891	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19755	95.947	2	1959.9174	1959.9174	K	E	110	129
PSM	DESASETSTPSEHSAAPSPQVEVR	892	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:21	ms_run[2]:scan=8962	43.73	3	2577.0868	2577.0868	R	T	147	171
PSM	DFVDDDDDDDLER	893	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12604	61.284	2	1582.5907	1582.5907	R	V	44	57
PSM	DGQVINETSQHHDDLE	894	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=8065	39.339	2	1915.7585	1915.7585	R	-	451	467
PSM	DRPGSPESPLLDAPFSR	895	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=20460	99.406	3	1999.8442	1999.8442	R	A	906	923
PSM	DSYLILETLPTEYDSR	896	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=26556	133.18	2	1923.9341	1923.9341	K	V	156	172
PSM	DVESVQTPSKAVGASFPLYEPAK	897	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,10-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=21206	103.39	3	2511.2337	2511.2337	R	M	322	345
PSM	DYDDIDDDDPFNPQAWR	898	sp|Q9BSA4-2|TTYH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:267	ms_run[2]:scan=26733	134.35	2	2105.8478	2105.8478	R	M	102	119
PSM	EADGSETPEPFAAEAK	899	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11009	53.609	2	1647.7264	1647.7264	R	F	234	250
PSM	EAPETDTSPSLWDVEFAK	900	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:188	ms_run[2]:scan=23730	116.49	2	2026.9467	2026.9467	K	Q	267	285
PSM	EDLISAFGTDDQTEICK	901	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=21453	104.66	2	1940.8673	1940.8673	K	Q	69	86
PSM	EEPLSEEEPCTSTAIASPEKK	902	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=11791	57.36	2	2411.0451	2411.0451	K	K	498	519
PSM	EGVILTNESAASTGQPDNDVTEGQR	903	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12830	62.414	3	2587.1998	2587.1998	K	A	477	502
PSM	EHYPVSSPSSPSPPAQPGGVSR	904	sp|O75179-4|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,10-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=10492	50.974	3	2389.0016	2389.0016	K	N	1443	1465
PSM	EIESEIDSEEELINK	905	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=18561	90.042	2	1781.8514	1781.8514	K	K	755	770
PSM	ELEASEELDTICPK	906	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=16907	81.92	2	1638.7754	1638.7754	K	A	218	232
PSM	ENLTDLVVDTDTLGESTQPQR	907	sp|Q14676-3|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:267	ms_run[2]:scan=23959	117.74	3	2340.132	2340.1320	R	E	643	664
PSM	ENPSEEAQNLVEFTDEEGYGR	908	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:267	ms_run[2]:scan=23749	116.59	3	2422.0436	2422.0436	R	Y	118	139
PSM	EVEDKESEGEEEDEDEDLSK	909	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=6942	34.115	2	2418.8959	2418.8959	K	Y	147	167
PSM	EWPVSSFNRPFPNSP	910	sp|Q96H12|MSD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=24454	120.46	2	1839.7981	1839.7981	K	-	261	276
PSM	FSKEEPVSSGPEEAVGK	911	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=9368	45.59	3	1935.7904	1935.7904	K	S	562	579
PSM	GADDAADADTAIINAEGGQNNSEEKKEYFI	912	sp|Q9BY67-5|CADM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	22-UNIMOD:21,25-UNIMOD:188,26-UNIMOD:188	ms_run[2]:scan=22962	112.47	3	3247.4233	3247.4233	K	-	385	415
PSM	GAGDGSDEEVDGKADGAEAKPAE	913	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,13-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=3000	15.389	3	2265.9313	2265.9313	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	914	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=1411	8.1659	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	915	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=5611	27.562	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	916	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23365	114.6	3	2441.1802	2441.1802	R	S	258	284
PSM	GGDDYSEDEGDSSVSR	917	sp|Q99871-3|HAUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=4076	20.395	2	1673.6289	1673.6289	R	A	21	37
PSM	GIPLATGDTSPEPELLPGAPLPPPK	918	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=25233	124.95	3	2543.2924	2543.2924	K	E	33	58
PSM	GIPLATGDTSPEPELLPGAPLPPPK	919	sp|O75821|EIF3G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=25257	125.1	3	2549.3126	2549.3126	K	E	33	58
PSM	GPDKLLPYPTLASPASD	920	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=22300	109.1	2	1820.8597	1820.8597	R	-	228	245
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	921	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16616	80.48	3	2729.1371	2729.1371	K	S	61	87
PSM	GSSPTPPCSPVQPSKQLEYLAR	922	sp|Q9NUL3-4|STAU2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=19149	92.885	3	2558.1278	2558.1278	K	I	264	286
PSM	ICTLPSPPSPLASLAPVADSSTR	923	sp|Q9UER7-3|DAXX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,9-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=25750	128.08	3	2426.1792	2426.1792	K	V	588	611
PSM	IDVTAPDVSIEEPEGK	924	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16739	81.076	2	1697.836	1697.8360	K	L	785	801
PSM	IEESETIEDSSNQAAAR	925	sp|Q8N573-5|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=7822	38.223	3	1848.8337	1848.8337	K	E	633	650
PSM	IKPTGLLTIPSPQI	926	sp|Q8TEA7-3|TBCK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,11-UNIMOD:21	ms_run[2]:scan=25989	129.55	2	1562.878	1562.8780	K	-	817	831
PSM	ILQEKLDQPVSAPPSPR	927	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12814	62.342	3	2033.9588	2033.9588	R	D	230	247
PSM	IQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPK	928	sp|Q12948|FOXC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:188,11-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21,34-UNIMOD:188	ms_run[2]:scan=19676	95.56	3	3501.6655	3501.6655	R	I	223	257
PSM	ISTPQTNTVPIKPLISTPPVSSQPK	929	sp|Q9BTA9-5|WAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=19975	97.022	3	2801.442	2801.4420	R	V	352	377
PSM	IVLTSLPALAVPPPTPTK	930	sp|O75398-5|DEAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=25516	126.67	2	1900.0782	1900.0782	K	A	329	347
PSM	KLEGNSPQGSNQGVK	931	sp|P61006|RAB8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=1420	8.2005	2	1701.7124	1701.7124	K	I	176	191
PSM	KLEKEEEEGISQESSEEEQ	932	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,4-UNIMOD:188,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=4317	21.53	3	2487.9259	2487.9259	K	-	89	108
PSM	KVVEAVNSDSDSEFGIPK	933	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16746	81.106	3	2091.9206	2091.9206	K	K	1510	1528
PSM	LASPQPSYAADANDSKAEYSDVLAK	934	sp|Q5TGY3|AHDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=16639	80.609	3	2690.2113	2690.2113	K	L	594	619
PSM	LCEELEYSELLDK	935	sp|Q9H4L5-8|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=21484	104.82	2	1639.7651	1639.7651	R	A	492	505
PSM	LDTDDLDEIEKIAN	936	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:188	ms_run[2]:scan=23336	114.45	2	1608.7826	1608.7826	R	-	357	371
PSM	LDTDDLDEIEKIAN	937	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=22878	112.05	2	1602.7625	1602.7625	R	-	357	371
PSM	LKSSTSFANIQENSN	938	sp|Q86WC4|OSTM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,14-UNIMOD:21	ms_run[2]:scan=11126	54.157	2	1724.7714	1724.7714	R	-	320	335
PSM	LQIGPPSPGEAQGPLLPSPAR	939	sp|Q9HCH0-2|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:21	ms_run[2]:scan=21430	104.53	3	2161.0933	2161.0933	K	G	430	451
PSM	LRTNLQPLESTQSQDF	940	sp|Q9Y248|PSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21	ms_run[2]:scan=18970	91.967	2	1955.899	1955.8990	K	-	170	186
PSM	LVQDVANNTNEEAGDGTTTATVLAR	941	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14252	68.982	4	2559.2413	2559.2413	K	S	97	122
PSM	NEDLEEIASTDLK	942	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19343	93.861	2	1475.6991	1475.6991	R	Y	65	78
PSM	NPDDITNEEYGEFYK	943	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=16864	81.709	2	1838.7942	1838.7942	R	S	300	315
PSM	NPDDITNEEYGEFYK	944	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=17529	85.128	2	1838.7942	1838.7942	R	S	300	315
PSM	NPDDITQEEYGEFYK	945	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17251	83.738	2	1846.7897	1846.7897	R	S	292	307
PSM	NPDDITQEEYGEFYK	946	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=17667	85.801	2	1846.7897	1846.7897	R	S	292	307
PSM	NQDATVYVGGLDEK	947	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:188	ms_run[2]:scan=12402	60.287	2	1513.7356	1513.7356	R	V	10	24
PSM	NSHELGPCPEDGSDAPLEDSTADAAASPGP	948	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4,27-UNIMOD:21	ms_run[2]:scan=15360	74.266	3	3043.2026	3043.2026	R	-	1493	1523
PSM	PAEATSSPTSPERPR	949	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1696	9.3784	2	1741.7074	1741.7074	R	H	211	226
PSM	PAEATSSPTSPERPR	950	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1920	10.392	2	1741.7074	1741.7074	R	H	211	226
PSM	QAGGFLGPPPPSGKFS	951	sp|Q9UM00-1|TMCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=17361	84.305	2	1622.7494	1622.7494	K	-	173	189
PSM	QDENDDDDDWNPCK	952	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=8237	40.162	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	953	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=9652	46.87	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	954	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=10085	48.922	2	1764.6169	1764.6169	K	A	188	202
PSM	QWVDTDDTSSENTVVPPETYVK	955	sp|P15927|RFA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18422	89.386	2	2509.1496	2509.1496	R	V	106	128
PSM	RASGQAFELILSPR	956	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:267,3-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=22470	109.95	2	1723.7963	1723.7963	K	S	14	28
PSM	RIITYNEAMDSPDQ	957	sp|Q7Z417-2|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=12596	61.239	2	1731.7175	1731.7175	K	-	107	121
PSM	RPPSPDVIVLSDNEQPSSPR	958	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:267,4-UNIMOD:21,18-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=16026	77.533	3	2369.0569	2369.0569	R	V	97	117
PSM	SATKVTADVINAAEK	959	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=13644	66.218	2	1596.776	1596.7760	R	L	55	70
PSM	SEAEDEDDEDYVPYVPLR	960	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=20531	99.752	2	2149.9203	2149.9203	R	Q	23	41
PSM	SEAPETPMEEEAELVLTEK	961	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=26902	135.46	2	2130.9878	2130.9878	K	S	72	91
PSM	SETAPAETATPAPVEKSPAK	962	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=7063	34.644	2	2073.007	2073.0070	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	963	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=29935	156.36	2	2073.007	2073.0070	M	K	2	22
PSM	SGGLQTPECLSREGSPIPHDPEFGSK	964	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=17375	84.377	3	3021.2018	3021.2018	R	L	268	294
PSM	SGGLQTPECLSREGSPIPHDPEFGSK	965	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=17792	86.401	3	3021.2018	3021.2018	R	L	268	294
PSM	SGGLQTPECLSREGSPIPHDPEFGSK	966	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=19251	93.424	3	3021.2018	3021.2018	R	L	268	294
PSM	SGSANSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPR	967	sp|Q86YD5-2|LRAD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,38-UNIMOD:267	ms_run[2]:scan=18145	88.062	3	3770.6532	3770.6532	R	D	248	286
PSM	SGTPPRQGSITSPQANEQSVTPQRR	968	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=7798	38.113	3	2918.2474	2918.2474	K	S	846	871
PSM	SHVEDGDIAGAPASSPEAPPAEQDPVQLK	969	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=16090	77.84	3	3071.3162	3071.3162	K	T	830	859
PSM	SLDDDLDGVPLDATEDSK	970	sp|O15042-3|SR140_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18891	91.598	2	1903.8535	1903.8535	K	K	322	340
PSM	SPGLVPPSPEFAPR	971	sp|Q9H5H4|ZN768_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:21	ms_run[2]:scan=17991	87.357	2	1529.7279	1529.7279	R	S	90	104
PSM	SQSSDTEQQSPTSGGGK	972	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=700	5.2849	2	1679.7235	1679.7235	R	V	456	473
PSM	SRDPAYELLITGGTYA	973	sp|O60637-3|TSN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,11-UNIMOD:21	ms_run[2]:scan=23578	115.71	2	1815.832	1815.8320	R	-	174	190
PSM	SRDPAYELLITGGTYA	974	sp|O60637-3|TSN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:21	ms_run[2]:scan=24295	119.59	2	1805.8237	1805.8237	R	-	174	190
PSM	SSPEPVALTESETEYVIR	975	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:267	ms_run[2]:scan=21718	106.05	2	2015.9927	2015.9927	K	C	632	650
PSM	SSPKSEIEVISEPPEEK	976	sp|O75044|SRGP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=15555	75.261	2	1963.9027	1963.9027	R	V	795	812
PSM	SSPKSEIEVISEPPEEK	977	sp|O75044|SRGP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,4-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=15420	74.61	2	1975.943	1975.9430	R	V	795	812
PSM	SSPKSNDSDLQEYELEVK	978	sp|Q53EP0-2|FND3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=15866	76.727	2	2146.9307	2146.9307	R	R	253	271
PSM	STTELDDYSTNKNGNNK	979	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,12-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5800	28.427	2	1991.8512	1991.8512	R	Y	1089	1106
PSM	SVCGHLENTSVGNSPNPSSAENSFR	980	sp|Q96HH9-5|GRM2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,3-UNIMOD:4,14-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=14141	68.459	3	2816.1138	2816.1138	K	A	108	133
PSM	SYTSGPGSRISSSSFSR	981	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=10595	51.444	2	1921.7609	1921.7609	R	V	24	41
PSM	TCDISFSDPDDLLNFK	982	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=26807	134.85	2	1891.8605	1891.8605	K	L	46	62
PSM	TDGEGEDPECLGEGK	983	sp|Q8WZA9|IRGQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:4	ms_run[2]:scan=6818	33.507	2	1591.6308	1591.6308	R	M	331	346
PSM	TDYNASVSVPDSSGPER	984	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10559	51.284	2	1779.7911	1779.7911	R	I	70	87
PSM	TGIEQGSDAGYLCESQK	985	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:4	ms_run[2]:scan=11014	53.628	2	1841.8102	1841.8102	K	F	310	327
PSM	TLSSPSLQTDGIAATPVPPPPPPK	986	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=19264	93.486	3	2453.255	2453.2550	R	S	1800	1824
PSM	TPDTSTYCYETAEK	987	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=8151	39.781	2	1664.6876	1664.6876	R	I	2034	2048
PSM	TPEDGDYSYEIIEK	988	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15303	73.948	2	1657.7359	1657.7359	K	T	1932	1946
PSM	TRTPASINATPANINLADLTR	989	sp|Q7KZ85-2|SPT6H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=22711	111.2	3	2369.1142	2369.1142	R	A	349	370
PSM	TSSKESSPIPSPTSDRK	990	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4048	20.267	2	2042.8	2042.8000	R	A	2159	2176
PSM	TVFPGAVPVLPASPPPK	991	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	13-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21736	106.13	2	1758.9417	1758.9417	K	D	217	234
PSM	TVIRLPSGSGAASPTGSAVDIR	992	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=18429	89.421	3	2271.0661	2271.0661	K	A	204	226
PSM	TVTLPENEDELESTNR	993	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=13873	67.24	2	1855.8675	1855.8675	K	R	870	886
PSM	VDATEESDLAQQYGVR	994	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:267	ms_run[2]:scan=15454	74.787	3	1789.8358	1789.8358	K	G	82	98
PSM	VDENFDCVEADDVEGK	995	sp|O14929-2|HAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=13722	66.572	2	1839.7469	1839.7469	K	I	10	26
PSM	VDQDDDQDSSSLK	996	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=1777	9.7575	2	1450.606	1450.6060	R	L	186	199
PSM	VFDDESDEKEDEEYADEK	997	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=10529	51.14	2	2270.8264	2270.8264	K	G	637	655
PSM	VFLQGPAPVGTPSFNR	998	sp|Q8IWZ3|ANKH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:21	ms_run[2]:scan=20016	97.202	2	1765.8553	1765.8553	R	Q	2313	2329
PSM	VGTCLYASPEQLEGSEYDAK	999	sp|Q9BQI3-2|E2AK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=17574	85.37	3	2215.9943	2215.9943	R	S	490	510
PSM	VPPVPTSPSPASPSPITAGSFR	1000	sp|Q504T8|MIDN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=18928	91.778	2	2228.0878	2228.0878	R	S	201	223
PSM	VQVQDNEGCPVEALVK	1001	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=16014	77.477	2	1789.8976	1789.8976	R	D	709	725
PSM	VSGTLDTPEKTVDSQGPTPVCTPTFLER	1002	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:21,21-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=20060	97.427	3	3191.4135	3191.4135	K	R	217	245
PSM	VSSTATTQDVIETLAEK	1003	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=21552	105.18	2	1791.9102	1791.9102	R	F	62	79
PSM	VVSSTSEEEEAFTEK	1004	sp|Q8N573-3|OXR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:188	ms_run[2]:scan=10880	52.883	2	1676.7724	1676.7724	R	F	131	146
PSM	YDYEEVEAEGANK	1005	sp|P36871-3|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=10654	51.757	2	1515.6365	1515.6365	R	M	231	244
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	1006	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	28-UNIMOD:21	ms_run[2]:scan=21429	104.53	3	4103.5812	4103.5812	K	R	79	117
PSM	YLTESYGTGQDIDDR	1007	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11744	57.141	2	1731.7588	1731.7588	R	I	167	182
PSM	TPEDGDYSYEIIEK	1008	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=15269	73.779885	2	1657.733532	1657.735913	K	T	1932	1946
PSM	SDAAVDTSSEITTKDLK	1009	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,14-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=13846	67.11562166666667	2	1833.9265	1833.9241	M	E	2	19
PSM	QLDDKDEEINQQSQLVEK	1010	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28	ms_run[1]:scan=14130	68.41074833333333	2	2141.0095	2141.0119	K	L	431	449
PSM	VSEEAESQQQWDTSKGEQVSQNGLPAEQGSPR	1011	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:188,30-UNIMOD:21,32-UNIMOD:267	ms_run[1]:scan=13072	63.59520833333334	3	3582.571862	3581.587841	K	M	2109	2141
PSM	SETAPAETATPAPVEKSPAK	1012	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=8167	39.84326666666667	2	2023.0123	2023.0104	M	K	2	22
PSM	NPDDITQEEYGEFYK	1013	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:188	ms_run[1]:scan=17855	86.71240833333334	2	1853.817067	1852.809869	R	S	292	307
PSM	NPDDITNEEYGEFYK	1014	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:188	ms_run[1]:scan=17772	86.29943333333334	2	1839.785774	1838.794218	R	S	300	315
PSM	QTAGQGSPCEEQEEPRAPVAPTPPTLIK	1015	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=18552	90.00270666666667	3	3050.4162	3050.4052	K	S	1174	1202
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	1016	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:21	ms_run[1]:scan=5844	28.608243333333334	3	3337.340271	3336.355264	R	R	157	186
PSM	GDVVNQDDLYQALASGK	1017	sp|Q9UBQ7|GRHPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=21681	105.86184333333334	2	1792.858009	1791.863908	R	I	246	263
PSM	TTEVGSVSEVKKDSSQLGTDATK	1018	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=11609	56.48742666666667	3	2488.1559	2488.1576	M	E	2	25
PSM	DASDDLDDLNFFNQK	1019	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	15-UNIMOD:188	ms_run[1]:scan=24091	118.48219666666665	2	1762.7742	1761.7782	K	K	65	80
PSM	DASDDLDDLNFFNQK	1020	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:188	ms_run[1]:scan=24712	121.92071166666668	2	1762.776373	1761.778903	K	K	65	80
PSM	SEKSVEAAAELSAK	1021	sp|P20962|PTMS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=13092	63.67351	2	1460.7337	1460.7353	M	D	2	16
PSM	CTSHSETPTVDDEEKVDER	1022	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:267	ms_run[1]:scan=10194	49.53398833333333	3	2311.9112	2311.9117	R	A	671	690
PSM	QNLYDLDEDDDGIASVPTK	1023	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:28,19-UNIMOD:188	ms_run[1]:scan=22768	111.49055166666666	2	2096.9672	2095.9522	K	Q	179	198
PSM	KVVEAVNSDSDSEFGIPK	1024	sp|Q02880|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[1]:scan=15893	76.86451833333334	3	2092.926822	2091.920557	K	K	1515	1533
PSM	GYNDDYYEESYFTTR	1025	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:267	ms_run[1]:scan=18748	90.89843	2	1932.765663	1931.772522	K	T	89	104
PSM	DLNGIDLTPVQDTPVASR	1026	sp|Q96BJ3|AIDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	18-UNIMOD:267	ms_run[1]:scan=20303	98.61720166666667	2	1920.975945	1919.982790	K	K	195	213
PSM	GPRTPPGPPPPDDDEDD	1027	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=6753	33.164175	2	1852.7161	1852.7147	R	P	181	198
PSM	EHYPVSSPSSPSPPAQPGGVSR	1028	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=10470	50.882056666666664	3	2379.995706	2378.993372	K	N	2036	2058
PSM	ENNVSQPASSSSSSSSSNNGSASPTKTK	1029	sp|Q02446|SP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	25-UNIMOD:21	ms_run[1]:scan=1146	7.053955	3	2807.182805	2806.189034	K	S	114	142
PSM	NLSLSSSTPPLPSPGR	1030	sp|O43516|WIPF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,16-UNIMOD:267	ms_run[1]:scan=17244	83.704695	2	1698.828719	1698.821735	R	S	338	354
PSM	TSFTSVSRSGGGGGGGFGR	1031	sp|P13647|K2C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=11204	54.53109666666667	3	1889.744641	1889.745871	R	V	30	49
PSM	GTYFPAILNPPPSPATER	1032	sp|O75581|LRP6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21,18-UNIMOD:267	ms_run[1]:scan=24014	118.03409666666666	2	2016.974517	2016.958563	K	S	1478	1496
PSM	GGSGGSYGGGGSGGGYGGGSGSR	1033	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=13980	67.73578333333333	2	2111.572515	2110.585755	R	G	491	514
PSM	GSESSSDSDSDSERSSCSSR	1034	sp|Q3L8U1|CHD9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=8108	39.586598333333335	3	2429.635979	2427.648551	R	S	2127	2147
PSM	SPQKSTVLTNGEAAMQSSNSESK	1035	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=11656	56.71025	3	2461.067162	2460.083964	K	K	86	109
PSM	VQSLEGEKLSPKSDISPLTPR	1036	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=16940	82.08752166666667	3	2520.136891	2520.131519	K	E	1770	1791