MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH05.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH05.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	116-UNIMOD:21,134-UNIMOD:4,110-UNIMOD:188,144-UNIMOD:188	0.18	55.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	5749-UNIMOD:21,5739-UNIMOD:21,5740-UNIMOD:188,5744-UNIMOD:188,216-UNIMOD:21,220-UNIMOD:21,5752-UNIMOD:21,1833-UNIMOD:4	0.02	55.0	9	7	6
PRT	sp|Q8NEY1-2|NAV1_HUMAN	Isoform 2 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	198-UNIMOD:188,199-UNIMOD:21,207-UNIMOD:188	0.01	51.0	2	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	322-UNIMOD:21,334-UNIMOD:4	0.07	50.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	185-UNIMOD:21,189-UNIMOD:21	0.09	50.0	1	1	1
PRT	sp|Q9UKY7-2|CDV3_HUMAN	Isoform 2 of Protein CDV3 homolog OS=Homo sapiens OX=9606 GN=CDV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	30-UNIMOD:21	0.23	48.0	2	1	0
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	199-UNIMOD:188	0.10	48.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	1122-UNIMOD:21,1146-UNIMOD:267,1118-UNIMOD:21	0.02	48.0	3	1	0
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	490-UNIMOD:21,494-UNIMOD:188,506-UNIMOD:188,240-UNIMOD:21,257-UNIMOD:267	0.03	47.0	5	3	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	82-UNIMOD:21,91-UNIMOD:188,96-UNIMOD:188,94-UNIMOD:21	0.02	47.0	4	1	0
PRT	sp|Q8TAE6|PP14C_HUMAN	Protein phosphatase 1 regulatory subunit 14C OS=Homo sapiens OX=9606 GN=PPP1R14C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	33-UNIMOD:21,44-UNIMOD:267,65-UNIMOD:267	0.24	47.0	2	1	0
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1517-UNIMOD:21,1519-UNIMOD:21,1510-UNIMOD:188,1527-UNIMOD:188	0.01	47.0	4	1	0
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	100-UNIMOD:21,107-UNIMOD:21	0.03	47.0	1	1	1
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	106-UNIMOD:267	0.04	47.0	2	1	0
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	1800-UNIMOD:21,1823-UNIMOD:188,1802-UNIMOD:21	0.01	47.0	3	1	0
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	1384-UNIMOD:21,1389-UNIMOD:4	0.01	47.0	1	1	1
PRT	sp|Q13367-3|AP3B2_HUMAN	Isoform 3 of AP-3 complex subunit beta-2 OS=Homo sapiens OX=9606 GN=AP3B2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	240-UNIMOD:21	0.03	46.0	1	1	1
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	194-UNIMOD:21	0.00	46.0	1	1	1
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	263-UNIMOD:21,279-UNIMOD:4,283-UNIMOD:267	0.01	46.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	134-UNIMOD:267	0.07	46.0	4	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	64-UNIMOD:188	0.03	46.0	2	1	0
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	197-UNIMOD:188	0.05	46.0	2	1	0
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	64-UNIMOD:21,78-UNIMOD:188,80-UNIMOD:188,62-UNIMOD:21	0.05	46.0	2	1	0
PRT	sp|Q9HAZ1|CLK4_HUMAN	Dual specificity protein kinase CLK4 OS=Homo sapiens OX=9606 GN=CLK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	138-UNIMOD:21,149-UNIMOD:4,156-UNIMOD:267	0.04	46.0	2	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	64-UNIMOD:21,74-UNIMOD:188	0.04	46.0	2	1	0
PRT	sp|O15075-4|DCLK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	413-UNIMOD:21,419-UNIMOD:21	0.06	46.0	1	1	1
PRT	sp|Q8NDI1|EHBP1_HUMAN	EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	660-UNIMOD:21,672-UNIMOD:4	0.03	46.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	1376-UNIMOD:21	0.01	46.0	1	1	0
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	119-UNIMOD:4	0.09	45.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	485-UNIMOD:21	0.04	45.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	128-UNIMOD:21	0.10	45.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	133-UNIMOD:21	0.03	45.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.07	45.0	1	1	1
PRT	sp|P78344-2|IF4G2_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	158-UNIMOD:188	0.02	45.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	651-UNIMOD:188,464-UNIMOD:188	0.06	45.0	7	2	1
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	296-UNIMOD:21,301-UNIMOD:21,309-UNIMOD:188	0.04	45.0	1	1	1
PRT	sp|Q16512-3|PKN1_HUMAN	Isoform 3 of Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	562-UNIMOD:21,552-UNIMOD:188,565-UNIMOD:188	0.04	45.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1,18-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188,9-UNIMOD:21	0.10	45.0	8	2	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	145-UNIMOD:28,164-UNIMOD:21,160-UNIMOD:21,147-UNIMOD:188,151-UNIMOD:188,173-UNIMOD:267,162-UNIMOD:21,155-UNIMOD:21	0.07	45.0	14	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	2-UNIMOD:1,10-UNIMOD:188,22-UNIMOD:267	0.10	45.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4	0.06	44.0	2	1	0
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	113-UNIMOD:21,128-UNIMOD:4,139-UNIMOD:188	0.03	44.0	2	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.05	44.0	1	1	1
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	16-UNIMOD:21	0.07	44.0	1	1	1
PRT	sp|O76024|WFS1_HUMAN	Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	277-UNIMOD:188	0.02	44.0	2	1	0
PRT	sp|P25440-4|BRD2_HUMAN	Isoform 4 of Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	162-UNIMOD:188,178-UNIMOD:21,181-UNIMOD:21,189-UNIMOD:188	0.04	44.0	3	1	0
PRT	sp|Q7Z4S6-3|KI21A_HUMAN	Isoform 3 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	853-UNIMOD:21	0.02	44.0	2	1	0
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1340-UNIMOD:21,1343-UNIMOD:188,1349-UNIMOD:188,1372-UNIMOD:21,1190-UNIMOD:21	0.04	44.0	6	3	2
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1074-UNIMOD:188	0.01	44.0	3	1	0
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	144-UNIMOD:188	0.09	44.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	388-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|Q9H4H8-2|FA83D_HUMAN	Isoform 2 of Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	456-UNIMOD:21	0.05	44.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1153-UNIMOD:21,1235-UNIMOD:21,1481-UNIMOD:21,1526-UNIMOD:21,1522-UNIMOD:21	0.07	44.0	5	4	3
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	140-UNIMOD:21,151-UNIMOD:4,160-UNIMOD:267	0.05	44.0	2	1	0
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	56-UNIMOD:21,74-UNIMOD:188	0.04	44.0	2	1	0
PRT	sp|O00443-2|P3C2A_HUMAN	Isoform 2 of Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	259-UNIMOD:21,252-UNIMOD:188,261-UNIMOD:188	0.04	44.0	2	1	0
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	553-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	221-UNIMOD:21	0.07	44.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	1698-UNIMOD:28,1703-UNIMOD:267,1716-UNIMOD:188	0.02	44.0	3	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	44.0	null	187-UNIMOD:28,188-UNIMOD:188,206-UNIMOD:188	0.04	44.0	4	2	0
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	438-UNIMOD:267	0.03	43.0	2	1	0
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	149-UNIMOD:267	0.11	43.0	2	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	312-UNIMOD:21,314-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	62-UNIMOD:21,66-UNIMOD:21	0.11	43.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:21,244-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	119-UNIMOD:188	0.09	43.0	2	1	0
PRT	sp|Q92887|MRP2_HUMAN	Canalicular multispecific organic anion transporter 1 OS=Homo sapiens OX=9606 GN=ABCC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	283-UNIMOD:21,294-UNIMOD:188,295-UNIMOD:188	0.01	43.0	1	1	1
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	119-UNIMOD:21,120-UNIMOD:267,134-UNIMOD:267,117-UNIMOD:21	0.02	43.0	2	1	0
PRT	sp|Q53SF7|COBL1_HUMAN	Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	273-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	659-UNIMOD:21,657-UNIMOD:21,674-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1152-UNIMOD:21,1163-UNIMOD:188,1168-UNIMOD:188,1151-UNIMOD:21,1154-UNIMOD:21	0.02	43.0	4	1	0
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	153-UNIMOD:21,171-UNIMOD:188	0.01	43.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	770-UNIMOD:4,782-UNIMOD:21,788-UNIMOD:188	0.01	43.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	498-UNIMOD:188,500-UNIMOD:21,513-UNIMOD:4,514-UNIMOD:188	0.01	43.0	3	1	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	72-UNIMOD:21,87-UNIMOD:267	0.01	43.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1	0.10	43.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1104-UNIMOD:21,1114-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	679-UNIMOD:21,683-UNIMOD:21,692-UNIMOD:188	0.03	42.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2202-UNIMOD:4,2204-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	768-UNIMOD:4,774-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	165-UNIMOD:21,167-UNIMOD:188,174-UNIMOD:4,185-UNIMOD:188	0.01	42.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	339-UNIMOD:4,351-UNIMOD:4,352-UNIMOD:4,354-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	255-UNIMOD:21,263-UNIMOD:188,265-UNIMOD:188,306-UNIMOD:188	0.05	42.0	4	2	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	60-UNIMOD:21,63-UNIMOD:21	0.08	42.0	2	1	0
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	391-UNIMOD:4,394-UNIMOD:188,430-UNIMOD:21,435-UNIMOD:188,446-UNIMOD:188	0.05	42.0	4	2	1
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	191-UNIMOD:267	0.06	42.0	2	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	108-UNIMOD:21,109-UNIMOD:21	0.02	42.0	2	1	0
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	68-UNIMOD:267	0.05	42.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	185-UNIMOD:21,190-UNIMOD:188,196-UNIMOD:188	0.02	42.0	2	1	0
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	174-UNIMOD:21	0.15	42.0	2	2	2
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	17-UNIMOD:21	0.14	42.0	2	1	0
PRT	sp|Q6WKZ4-2|RFIP1_HUMAN	Isoform 4 of Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	167-UNIMOD:21,170-UNIMOD:4,184-UNIMOD:188	0.04	42.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	284-UNIMOD:267	0.05	42.0	3	2	1
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	324-UNIMOD:267	0.04	42.0	2	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1779-UNIMOD:21,1782-UNIMOD:21,1788-UNIMOD:21,1914-UNIMOD:188,1915-UNIMOD:21,1928-UNIMOD:188,1932-UNIMOD:21,1793-UNIMOD:21,1433-UNIMOD:21	0.04	42.0	6	5	4
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.03	42.0	1	1	1
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	129-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	184-UNIMOD:21,186-UNIMOD:4,205-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	75-UNIMOD:21,80-UNIMOD:188,84-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1148-UNIMOD:21,1157-UNIMOD:188,1161-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	194-UNIMOD:21,192-UNIMOD:267,205-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	369-UNIMOD:188	0.05	41.0	1	1	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1378-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	502-UNIMOD:188,513-UNIMOD:21,519-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	43-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	243-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	872-UNIMOD:21,868-UNIMOD:188,883-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1558-UNIMOD:4,1561-UNIMOD:21,1568-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	299-UNIMOD:4,311-UNIMOD:267	0.03	41.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	215-UNIMOD:188	0.06	41.0	2	1	0
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	324-UNIMOD:21,328-UNIMOD:267,331-UNIMOD:21,348-UNIMOD:267	0.07	41.0	2	1	0
PRT	sp|Q9P0K1-5|ADA22_HUMAN	Isoform 5 of Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ADAM22	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	819-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q969F2|NKD2_HUMAN	Protein naked cuticle homolog 2 OS=Homo sapiens OX=9606 GN=NKD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	299-UNIMOD:21,315-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	610-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	191-UNIMOD:4,199-UNIMOD:21,198-UNIMOD:188,209-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	483-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	121-UNIMOD:21,122-UNIMOD:21	0.11	41.0	3	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|Q17RY0|CPEB4_HUMAN	Cytoplasmic polyadenylation element-binding protein 4 OS=Homo sapiens OX=9606 GN=CPEB4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	93-UNIMOD:188,97-UNIMOD:21,112-UNIMOD:188	0.04	41.0	1	1	1
PRT	sp|Q9P2K5|MYEF2_HUMAN	Myelin expression factor 2 OS=Homo sapiens OX=9606 GN=MYEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	2-UNIMOD:1,17-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	393-UNIMOD:188,395-UNIMOD:21,402-UNIMOD:4,409-UNIMOD:188	0.01	41.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	176-UNIMOD:21	0.05	40.0	1	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	214-UNIMOD:267	0.05	40.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	432-UNIMOD:21,434-UNIMOD:267,447-UNIMOD:267	0.03	40.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	449-UNIMOD:21,454-UNIMOD:188,462-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q9UHL9-2|GT2D1_HUMAN	Isoform 2 of General transcription factor II-I repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GTF2IRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	448-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	659-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	853-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2114-UNIMOD:21,2126-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q8N1G1|REXO1_HUMAN	RNA exonuclease 1 homolog OS=Homo sapiens OX=9606 GN=REXO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	344-UNIMOD:4,358-UNIMOD:21,370-UNIMOD:4,355-UNIMOD:188,372-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	191-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	1	1	1
PRT	sp|Q9H841-2|NPAL2_HUMAN	Isoform 2 of NIPA-like protein 2 OS=Homo sapiens OX=9606 GN=NIPAL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	360-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	116-UNIMOD:21,118-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q8IUI4|S29P2_HUMAN	Putative protein SNX29P2 OS=Homo sapiens OX=9606 GN=SNX29P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	191-UNIMOD:21	0.10	40.0	1	1	1
PRT	sp|Q9NS73-3|MBIP1_HUMAN	Isoform 3 of MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	91-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	947-UNIMOD:4,952-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	829-UNIMOD:188	0.02	40.0	2	1	0
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	360-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	42-UNIMOD:21	0.11	40.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	307-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	96-UNIMOD:21,104-UNIMOD:4,117-UNIMOD:267	0.07	40.0	1	1	1
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	213-UNIMOD:21,221-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	362-UNIMOD:21,360-UNIMOD:21	0.01	40.0	2	1	0
PRT	sp|P24666-4|PPAC_HUMAN	Isoform 4 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.17	40.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.00	40.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	122-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	467-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q9H5H4|ZN768_HUMAN	Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	157-UNIMOD:188,160-UNIMOD:21,169-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	142-UNIMOD:267,143-UNIMOD:21,150-UNIMOD:188	0.03	40.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	54-UNIMOD:385,54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	202-UNIMOD:28,204-UNIMOD:4,206-UNIMOD:21,216-UNIMOD:188,218-UNIMOD:188	0.03	40.0	2	1	0
PRT	sp|O95819-2|M4K4_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	625-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	198-UNIMOD:267	0.05	39.0	2	1	0
PRT	sp|Q9UID6|ZN639_HUMAN	Zinc finger protein 639 OS=Homo sapiens OX=9606 GN=ZNF639 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	200-UNIMOD:21,206-UNIMOD:4,209-UNIMOD:4	0.04	39.0	1	1	1
PRT	sp|Q63HN8|RN213_HUMAN	E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1258-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q15652-3|JHD2C_HUMAN	Isoform 3 of Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1863-UNIMOD:21,1869-UNIMOD:267,1885-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	1	1	1
PRT	sp|Q8N9B5-2|JMY_HUMAN	Isoform 2 of Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	713-UNIMOD:21,721-UNIMOD:4,733-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	66-UNIMOD:21,67-UNIMOD:21	0.11	39.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	187-UNIMOD:188	0.03	39.0	2	1	0
PRT	sp|Q66K14-2|TBC9B_HUMAN	Isoform 2 of TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	432-UNIMOD:21,435-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	111-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	590-UNIMOD:21,597-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1106-UNIMOD:21,1105-UNIMOD:21,1115-UNIMOD:188	0.01	39.0	2	1	0
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	436-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|P42695|CNDD3_HUMAN	Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	516-UNIMOD:21,519-UNIMOD:267,540-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	661-UNIMOD:4,662-UNIMOD:21,674-UNIMOD:188,675-UNIMOD:188	0.01	39.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	39.0	1	1	1
PRT	sp|Q8N9M5|TM102_HUMAN	Transmembrane protein 102 OS=Homo sapiens OX=9606 GN=TMEM102 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	216-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	775-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q5M775-2|CYTSB_HUMAN	Isoform 2 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	355-UNIMOD:4,356-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	1	1	1
PRT	sp|Q8NEZ4-3|KMT2C_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2828-UNIMOD:21	0.00	39.0	1	1	1
PRT	sp|O75197|LRP5_HUMAN	Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1599-UNIMOD:21,1611-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	207-UNIMOD:21,209-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	805-UNIMOD:21,809-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	518-UNIMOD:21,541-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	193-UNIMOD:21,205-UNIMOD:188,208-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	1	1	1
PRT	sp|Q9UH99-3|SUN2_HUMAN	Isoform 3 of SUN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	38-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	332-UNIMOD:21,335-UNIMOD:188	0.04	39.0	1	1	0
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	298-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.13	39.0	1	1	1
PRT	sp|Q93050|VPP1_HUMAN	V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens OX=9606 GN=ATP6V0A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	199-UNIMOD:28,217-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	108-UNIMOD:21,109-UNIMOD:21,119-UNIMOD:188,121-UNIMOD:267	0.02	39.0	2	1	0
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	716-UNIMOD:21	0.02	39.0	1	1	0
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	431-UNIMOD:21,439-UNIMOD:4,441-UNIMOD:21,445-UNIMOD:21	0.04	39.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	1	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	7-UNIMOD:21,25-UNIMOD:4	ms_run[2]:scan=9102	44.26	3	3620.4217	3620.4217	R	A	110	145
PSM	SSKASLGSLEGEAEAEASSPK	2	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	5-UNIMOD:21	ms_run[2]:scan=18559	89.392	2	2113.9416	2113.9416	K	G	5745	5766
PSM	APEAAVSEDGKSDDELLSSK	3	sp|Q8NEY1-2|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	11-UNIMOD:188,12-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=11562	56.017	2	2138.9659	2138.9659	K	A	188	208
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	4	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11855	57.384	3	3045.258	3045.2580	R	V	320	347
PSM	SPSGPVKSPPLSPVGTTPVK	5	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12995	62.763	2	2091.0054	2091.0054	K	L	178	198
PSM	AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK	6	sp|Q9UKY7-2|CDV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	3-UNIMOD:21	ms_run[2]:scan=7730	37.734	3	3748.6787	3748.6787	R	A	28	77
PSM	FGIVTSSAGTGTTEDTEAK	7	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=11688	56.624	2	1870.8796	1870.8796	R	K	181	200
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	8	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	5-UNIMOD:21	ms_run[2]:scan=14135	67.992	3	2909.304	2909.3040	R	V	1118	1147
PSM	AESPAEKVPEESVLPLVQK	9	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21,7-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=19523	94.061	2	2141.106	2141.1060	K	S	488	507
PSM	AQAVSEEEEEEEGKSSSPK	10	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21,14-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=5102	24.646	2	2140.9088	2140.9088	K	K	78	97
PSM	GGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQR	11	sp|Q8TAE6|PP14C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	6-UNIMOD:21	ms_run[2]:scan=10158	49.115	3	3565.5779	3565.5779	R	R	28	66
PSM	KVVEAVNSDSDSEFGIPK	12	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16415	78.466	2	2079.8803	2079.8803	K	K	1510	1528
PSM	RPPSPDVIVLSDNEQPSSPR	13	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=15220	72.859	2	2349.0403	2349.0403	R	V	97	117
PSM	SVSTPSEAGSQDSGDGAVGSR	14	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=5202	25.084	2	1949.8563	1949.8563	K	R	86	107
PSM	SVSTPSEAGSQDSGDGAVGSR	15	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	21-UNIMOD:267	ms_run[2]:scan=5230	25.211	2	1959.8645	1959.8645	K	R	86	107
PSM	TLSSPSLQTDGIAATPVPPPPPPK	16	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=19425	93.596	2	2447.2349	2447.2349	R	S	1800	1824
PSM	KGSSSSVCSVASSSDISLGSTK	17	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=13375	64.516995	2	2210.981392	2209.977373	R	T	1382	1404
PSM	AFYGSEEDEAKGAGSEETAAAAAPSR	18	sp|Q13367-3|AP3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=12523	60.439	2	2651.1024	2651.1024	K	K	236	262
PSM	APEAAVSEDGKSDDELLSSK	19	sp|Q8NEY1-2|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:21	ms_run[2]:scan=11572	56.062	2	2126.9257	2126.9257	K	A	188	208
PSM	AQAVSEEEEEEEGKSSSPK	20	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21	ms_run[2]:scan=5205	25.1	2	2128.8685	2128.8685	K	K	78	97
PSM	DAHDVSPTSTDTEAQLTVER	21	sp|Q8IVF2-3|AHNK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=12214	59.046	2	2250.9642	2250.9642	R	Q	189	209
PSM	FGIVTSSAGTGTTEDTEAK	22	sp|P82979|SARNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:188	ms_run[2]:scan=11691	56.641	2	1876.8997	1876.8997	R	K	181	200
PSM	GAPPGSPEPPALLAAPLAAGACPGGR	23	sp|Q9Y4B5|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,22-UNIMOD:4,26-UNIMOD:267	ms_run[2]:scan=23358	113.75	2	2441.1802	2441.1802	R	S	258	284
PSM	GGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQR	24	sp|Q8TAE6|PP14C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21,17-UNIMOD:267,38-UNIMOD:267	ms_run[2]:scan=10217	49.438	3	3585.5944	3585.5944	R	R	28	66
PSM	GVVPLAGTDGETTTQGLDGLSER	25	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	23-UNIMOD:267	ms_run[2]:scan=19916	95.931	2	2282.1266	2282.1266	K	C	112	135
PSM	GVVPLAGTDGETTTQGLDGLSER	26	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=19949	96.072	2	2272.1183	2272.1183	K	C	112	135
PSM	IGGDAGTSLNSNDYGYGGQK	27	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	20-UNIMOD:188	ms_run[2]:scan=11374	55.078	2	1978.8964	1978.8964	K	R	45	65
PSM	KEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	28	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,7-UNIMOD:21,25-UNIMOD:4,35-UNIMOD:188	ms_run[2]:scan=8938	43.51	3	3632.462	3632.4620	R	A	110	145
PSM	QNLYDLDEDDDGIASVPTK	29	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=19355	93.271	2	2106.9593	2106.9593	K	Q	179	198
PSM	SGSPSDNSGAEEMEVSLAKPK	30	sp|P31749-2|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21,19-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=13710	66.096	2	2210.9805	2210.9805	R	H	60	81
PSM	SIEDDEEGHLICQSGDVLR	31	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21,12-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=18719	90.185	2	2260.9547	2260.9547	R	A	138	157
PSM	STIGVMVTASHNPEEDNGVK	32	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=13470	64.943	2	2169.9709	2169.9709	K	L	55	75
PSM	TLSSPSLQTDGIAATPVPPPPPPK	33	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=19434	93.637	2	2453.255	2453.2550	R	S	1800	1824
PSM	YKAQPAPPELNSESEDYSPSSSETVR	34	sp|O15075-4|DCLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=13957	67.223	3	3027.2424	3027.2424	R	S	402	428
PSM	SQQSSGRTSGSDDPGICSNTDSTQAQVLLGK	35	sp|Q8NDI1|EHBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	5-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=15721	75.29149166666666	3	3261.427574	3260.425258	K	K	656	687
PSM	LGAGEGGEASVSPEKTSTTSK	36	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	10-UNIMOD:21	ms_run[1]:scan=30363	160.30535333333336	2	2072.944603	2071.931075	K	G	1367	1388
PSM	AGAIAPCEVTVPAQNTGLGPEK	37	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:4	ms_run[2]:scan=16069	76.859	2	2179.0943	2179.0943	R	T	113	135
PSM	AGLESGAEPGDGDSDTTKK	38	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21	ms_run[2]:scan=4566	22.15	2	1913.7892	1913.7892	K	K	481	500
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	39	sp|P54725-2|RD23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21	ms_run[2]:scan=9458	45.842	3	3001.2673	3001.2673	R	E	120	150
PSM	GSSQPNLSTSHSEQEYGK	40	sp|O95208-3|EPN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21	ms_run[2]:scan=6291	30.281	2	2014.8269	2014.8269	R	A	132	150
PSM	GVVPLAGTNGETTTQGLDGLSER	41	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19299	93.017	2	2271.1343	2271.1343	K	C	112	135
PSM	LAEDAPNFDGPAAEGQPGQK	42	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11976	57.925	2	2010.9283	2010.9283	R	Q	139	159
PSM	LYGSAGPPPTGEEDTAEKDEL	43	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=14323	68.817	2	2174.9855	2174.9855	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	44	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=14592	69.914	2	2174.9855	2174.9855	K	-	634	655
PSM	SHSESASPSALSSSPNNLSPTGWSQPK	45	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21,19-UNIMOD:21,27-UNIMOD:188	ms_run[2]:scan=16538	79	3	2905.2264	2905.2264	R	T	283	310
PSM	STIGVMVTASHNPEEDNGVK	46	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=13465	64.914	2	2163.9508	2163.9508	K	L	55	75
PSM	TTGDISVEKLNLGTDSDSSPQK	47	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	19-UNIMOD:21	ms_run[2]:scan=15821	75.728	2	2371.0792	2371.0792	R	S	544	566
PSM	SETAPAETATPAPVEKSPAKK	48	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5408	26.009138333333333	2	2231.0813	2231.0717	M	K	2	23
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	49	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=29858	157.14226499999998	3	3008.3472	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	50	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=8076	39.44747833333333	3	3009.3482	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	51	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=29501	154.99360166666665	3	3007.3442	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	52	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:28,3-UNIMOD:188,7-UNIMOD:188,16-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=7708	37.61799166666667	3	3029.3872	3029.3772	K	S	145	174
PSM	SGEENPASKPTPVQDVQGDGR	53	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,9-UNIMOD:188,21-UNIMOD:267	ms_run[1]:scan=9018	43.89274	2	2225.0622	2225.0526	M	W	2	23
PSM	AAKLSEGSQPAEEEEDQETPSR	54	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21	ms_run[2]:scan=7479	36.452	2	2467.0388	2467.0388	R	N	236	258
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	55	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12670	61.213	3	3173.2435	3173.2435	R	-	502	532
PSM	AQAVSEEEEEEEGKSSSPK	56	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=3696	18.099	2	2128.8685	2128.8685	K	K	78	97
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	57	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14854	71.22	3	2789.2772	2789.2772	R	T	112	140
PSM	DPDAQPGGELMLGGTDSK	58	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14293	68.682	2	1786.8043	1786.8043	R	Y	236	254
PSM	GSSGSPAHAESYSSGGGGQQK	59	sp|P15408|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:21	ms_run[2]:scan=1491	8.3072	2	2014.8018	2014.8018	R	F	15	36
PSM	GVIPSSLFLQDDEDDDELAGK	60	sp|O76024|WFS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=25508	126.73	2	2262.054	2262.0540	K	S	257	278
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	61	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:21,28-UNIMOD:188	ms_run[2]:scan=19981	96.221	3	2873.3903	2873.3903	R	A	162	190
PSM	KLSSSDAPAQDTGSSAAAVETDASR	62	sp|Q7Z4S6-3|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=10395	50.294	2	2501.0919	2501.0919	R	T	851	876
PSM	LGAGEGGEASVSPEKTSTTSK	63	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21,15-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5581	26.85	2	2083.9713	2083.9713	K	G	1329	1350
PSM	LPPNTNDEVDEDPTGNK	64	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:188	ms_run[2]:scan=7810	38.162	2	1859.848	1859.8480	R	A	1058	1075
PSM	LYGSAGPPPTGEEDTAEKDEL	65	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:188	ms_run[2]:scan=14575	69.841	2	2181.0057	2181.0057	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	66	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=14086	67.8	2	2174.9855	2174.9855	K	-	634	655
PSM	QFYDQALQQAVVDDDANNAK	67	sp|P60033|CD81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	20-UNIMOD:188	ms_run[2]:scan=19676	94.801	2	2258.0547	2258.0547	K	A	125	145
PSM	QNLYDLDEDDDGIASVPTK	68	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:188	ms_run[2]:scan=19345	93.223	2	2112.9795	2112.9795	K	Q	179	198
PSM	SETAPAETATPAPVEKSPAK	69	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=6267	30.183	2	2073.007	2073.0070	M	K	2	22
PSM	SIEDDEEGHLICQSGDVLR	70	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=18724	90.205	2	2250.9464	2250.9464	R	A	138	157
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	71	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21	ms_run[2]:scan=13843	66.715	3	3059.1789	3059.1789	R	S	373	399
PSM	SSSLKSSSSVSSQGSVASSTGSPASIR	72	sp|Q9H4H8-2|FA83D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=9812	47.498	3	2607.2025	2607.2025	R	T	456	483
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTR	73	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=18167	87.464	3	3856.8619	3856.8619	R	G	1153	1189
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	74	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=18722	90.2	3	3904.8619	3904.8619	R	G	1235	1271
PSM	SVEDDEEGHLICQSGDVLSAR	75	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=18729	90.227	2	2394.9999	2394.9999	R	Y	140	161
PSM	SYEDLTESEDGAASGDSHK	76	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=8724	42.578	2	2082.7998	2082.7998	R	E	56	75
PSM	TDLEITDSKVSNLQVSPK	77	sp|O00443-2|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21	ms_run[2]:scan=16214	77.532	2	2052.998	2052.9980	R	S	244	262
PSM	THSVNGITEEADPTIYSGK	78	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=14244	68.472	2	2097.9256	2097.9256	K	V	551	570
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	79	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	5-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=14130	67.968	3	2919.3123	2919.3123	R	V	1118	1147
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	80	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=14441	69.304	3	2909.304	2909.3040	R	V	1118	1147
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	81	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=10881	52.622	2	2835.1244	2835.1244	K	A	213	238
PSM	QAQQERDELADEIANSSGK	82	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,6-UNIMOD:267,19-UNIMOD:188	ms_run[1]:scan=17121	81.90485333333334	2	2086.9808	2086.9733	R	G	1698	1717
PSM	QKGADFLVTEVENGGSLGSK	83	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,2-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=21184	102.24310833333334	2	2031.0282	2030.0352	K	K	187	207
PSM	ADDLLPLGDQTQDGDFGSR	84	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:267	ms_run[2]:scan=20398	98.298	2	2028.9264	2028.9264	R	L	420	439
PSM	ADDLLPLGDQTQDGDFGSR	85	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=20433	98.485	2	2018.9181	2018.9181	R	L	420	439
PSM	AIEQADLLQEEDESPR	86	sp|P61966|AP1S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14884	71.344	2	1841.8643	1841.8643	K	S	134	150
PSM	AIEQADLLQEEDESPR	87	sp|P61966|AP1S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:267	ms_run[2]:scan=14888	71.364	2	1851.8726	1851.8726	K	S	134	150
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	88	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=12598	60.834	3	2970.1217	2970.1217	K	R	299	324
PSM	IDFTPVSPAPSPTRGFGK	89	sp|Q7Z309-5|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19184	92.452	2	2032.9061	2032.9061	R	M	56	74
PSM	ILQEKLDQPVSAPPSPR	90	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12898	62.289	2	2033.9588	2033.9588	R	D	230	247
PSM	KVVEAVNSDSDSEFGIPK	91	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=16676	79.55	2	2079.8803	2079.8803	K	K	1510	1528
PSM	LAEDAPNFDGPAAEGQPGQK	92	sp|P78344-2|IF4G2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	20-UNIMOD:188	ms_run[2]:scan=11987	57.97	2	2016.9484	2016.9484	R	Q	139	159
PSM	LGIYDADGDGDFDVDDAK	93	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=19390	93.438	2	1899.801	1899.8010	K	V	102	120
PSM	LYGSAGPPPTGEEDTAEKDEL	94	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:188	ms_run[2]:scan=14079	67.767	2	2181.0057	2181.0057	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	95	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:188	ms_run[2]:scan=14315	68.784	2	2181.0057	2181.0057	K	-	634	655
PSM	NQSQSQDALVLEDVEKK	96	sp|Q92887|MRP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=16120	77.103	2	2021.9709	2021.9709	K	K	279	296
PSM	SADGSAPAGEGEGVTLQR	97	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8145	39.773	2	1700.7966	1700.7966	K	N	31	49
PSM	SDSRAQAVSEDAGGNEGR	98	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,4-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=3142	15.485	2	1904.7765	1904.7765	R	A	117	135
PSM	SNTISKPYISNTLPSDAPK	99	sp|Q53SF7|COBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=15025	71.976	2	2112.014	2112.0140	R	K	273	292
PSM	SQSESSDEVTELDLSHGK	100	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=12491	60.305	2	2026.8368	2026.8368	R	K	657	675
PSM	SSLSGDEEDELFKGATLK	101	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=20905	100.79	2	2016.9332	2016.9332	R	A	1151	1169
PSM	SSTPSHGQTTATEPTPAQK	102	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=1922	10.097	2	2010.8991	2010.8991	R	T	153	172
PSM	SSVKTPETVVPTAPELQASASTDQPVTSEPTSR	103	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=17822	85.73	3	3476.656	3476.6560	R	T	1481	1514
PSM	TCSDGGPSSELAHSPTNSGK	104	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4705	22.778	2	2067.8205	2067.8205	R	K	769	789
PSM	TSEIEPKNSPEDLGLSLTGDSCK	105	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[2]:scan=18429	88.755	2	2568.1705	2568.1705	K	L	492	515
PSM	TTGDISVEKLNLGTDSDSSPQK	106	sp|Q16512-3|PKN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:188,19-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=15822	75.732	2	2383.1195	2383.1195	R	S	544	566
PSM	VASGSDLHLTDIDSDSNR	107	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=14532	69.673	2	1990.8509	1990.8509	K	G	70	88
PSM	SETAPAETATPAPVEKSPAKK	108	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=30037	158.24266666666668	2	2231.0832	2231.0722	M	K	2	23
PSM	SETAPAAPAAAPPAEKAPVK	109	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1	ms_run[1]:scan=9078	44.162881666666664	2	1915.0099	1915.0046	M	K	2	22
PSM	IGGDAGTSLNSNDYGYGGQK	110	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=11395	55.17595	2	1973.884745	1972.876263	K	R	45	65
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	111	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=29677	156.050065	3	3007.3442	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	112	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=6498	31.291611666666665	3	3007.3402	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	113	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,3-UNIMOD:188,7-UNIMOD:188,16-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=30691	162.50112166666665	3	3029.3922	3029.3772	K	S	145	174
PSM	GADFLVTEVENGGSLGSK	114	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	18-UNIMOD:188	ms_run[1]:scan=20279	97.74542833333334	2	1785.877966	1784.888788	K	K	189	207
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	115	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=12362	59.755	3	3090.3373	3090.3373	R	V	1094	1125
PSM	AAPEASSPPASPLQHLLPGK	116	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,11-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=20949	101.03	2	2133.0004	2133.0004	K	A	673	693
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	117	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=18039	86.836	3	3062.4016	3062.4016	K	S	2194	2221
PSM	APYQENDGYCPDLELSDSEAESDGNKEK	118	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=16074	76.879	3	3239.2762	3239.2762	R	V	759	787
PSM	ASSKGGGGYTCQSGSGWDEFTK	119	sp|P15924|DESP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:21,4-UNIMOD:188,11-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=15404	73.774	2	2357.9663	2357.9663	R	H	164	186
PSM	GCITIIGGGDTATCCAK	120	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=12736	61.51	2	1759.7999	1759.7999	R	W	338	355
PSM	GGVTGSPEASISGSKGDLK	121	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=9496	46.019	2	1837.8861	1837.8861	K	S	5726	5745
PSM	GVVPLAGTDGETTTQGLDGLSER	122	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	23-UNIMOD:267	ms_run[2]:scan=19970	96.17	3	2282.1266	2282.1266	K	C	112	135
PSM	IEDVGSDEEDDSGKDK	123	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1424	8.0321	2	1828.729	1828.7290	K	K	250	266
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	124	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=20171	97.212	3	2861.3501	2861.3501	R	A	162	190
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	125	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13378	64.532	3	2621.1412	2621.1412	K	I	50	74
PSM	KVVEAVNSDSDSEFGIPK	126	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16393	78.364	2	2091.9206	2091.9206	K	K	1510	1528
PSM	LASGEDDPFDSDFSCPVK	127	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=19827	95.516	2	1990.8562	1990.8562	K	L	377	395
PSM	LASGEDDPFDSDFSCPVK	128	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=20044	96.526	2	1990.8562	1990.8562	K	L	377	395
PSM	LGAGEGGEASVSPEKTSTTSK	129	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=5237	25.246	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LGIYDADGDGDFDVDDAK	130	sp|Q12797-7|ASPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:188	ms_run[2]:scan=19397	93.472	2	1905.8212	1905.8212	K	V	102	120
PSM	LPDSDDDEDEETAIQR	131	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:267	ms_run[2]:scan=9539	46.222	2	1856.7787	1856.7787	R	V	176	192
PSM	LPDSDDDEDEETAIQR	132	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=9547	46.257	2	1846.7705	1846.7705	R	V	176	192
PSM	LPPNTNDEVDEDPTGNK	133	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7647	37.321	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LSVPTSDEEDEVPAPKPR	134	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=12912	62.354	2	2124.9018	2124.9018	K	G	104	122
PSM	NAGDLAPAGGAASASTDEAADAESGTR	135	sp|Q9NXV6|CARF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	27-UNIMOD:267	ms_run[2]:scan=11092	53.706	3	2442.077	2442.0770	R	N	42	69
PSM	NTDVAQSPEAPKQEAPAK	136	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,12-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=3928	19.077	2	1971.9342	1971.9342	R	K	179	197
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	137	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:21	ms_run[2]:scan=6028	28.986	3	3336.3553	3336.3553	R	R	157	186
PSM	SASPDDDLGSSNWEAADLGNEERK	138	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=17626	84.723	3	2642.077	2642.0770	R	Q	15	39
PSM	SNVCINGNHVYLEQPEAK	139	sp|Q6WKZ4-2|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,4-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=13932	67.086	2	2156.9657	2156.9657	R	G	167	185
PSM	SSVKTPETVVPAAPELQPSTSTDQPVTPEPTSR	140	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=17607	84.619	3	3512.6924	3512.6924	R	A	1522	1555
PSM	STNGDTFLGGEDFDQALLR	141	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=25844	128.96	2	2054.9545	2054.9545	K	H	266	285
PSM	STNGDTFLGGEDFDQALLR	142	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:267	ms_run[2]:scan=25856	129.04	2	2064.9628	2064.9628	K	H	266	285
PSM	SYEDLTESEDGAASGDSHK	143	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=8693	42.437	2	2076.7797	2076.7797	R	E	56	75
PSM	TDASSASSFLDSDELER	144	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18632	89.79	2	1828.7963	1828.7963	R	T	308	325
PSM	TDLEITDSKVSNLQVSPK	145	sp|O00443-2|P3C2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16269	77.768	2	2065.0383	2065.0383	R	S	244	262
PSM	VQSLEGEKLSPKSDISPLTPR	146	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=17174	82.228	3	2520.1315	2520.1315	K	E	1770	1791
PSM	YAPSGFYIASGDVSGK	147	sp|O75083|WDR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=16728	79.72	2	1617.7675	1617.7675	K	L	66	82
PSM	YQEQGGEASPQRTWEQQQEVVSR	148	sp|Q9UJU6-5|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=13414	64.668	3	2799.225	2799.2250	R	N	121	144
PSM	YYSPCEEHPAETNQNEGSESGTIR	149	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=9326	45.317	3	2844.121	2844.1210	R	Q	182	206
PSM	QKGADFLVTEVENGGSLGSK	150	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28	ms_run[1]:scan=21175	102.20314166666667	2	2018.9882	2017.9952	K	K	187	207
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	151	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7599	37.103320000000004	3	3007.3422	3007.3292	K	S	145	174
PSM	AAVLSDSEDEEKASAK	152	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=5460	26.275	2	1740.7858	1740.7858	K	K	69	85
PSM	AESPAEKVPEESVLPLVQK	153	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=19533	94.103	2	2129.0657	2129.0657	K	S	488	507
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	154	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=12460	60.189	3	3173.2435	3173.2435	R	-	502	532
PSM	AGLASPEEEDAVGKEPLK	155	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=13313	64.262	2	1930.9328	1930.9328	K	A	1144	1162
PSM	AQAVSEEEEEEEGKSSSPK	156	sp|Q9GZR7-2|DDX24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=4983	24.081	2	2128.8685	2128.8685	K	K	78	97
PSM	DSSDSADGRATPSENLVPSSAR	157	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=10249	49.58	3	2297.9761	2297.9761	R	V	184	206
PSM	DSSDSADGRATPSENLVPSSAR	158	sp|Q8N684-2|CPSF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:267,11-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=10042	48.596	2	2317.9927	2317.9927	R	V	184	206
PSM	EGEEAGPGDPLLEAVPK	159	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=19741	95.109	2	1712.8564	1712.8564	K	T	353	370
PSM	ESDQTLAALLSPKESSGGEK	160	sp|P18583-2|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=19205	92.552	2	2125.978	2125.9780	K	E	1368	1388
PSM	GDPGDQTKAEGSSTASSGSQLAEGK	161	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:188,19-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=5879	28.321	3	2456.0743	2456.0743	R	G	495	520
PSM	GKLSAEENPDDSEVPSSSGINSTK	162	sp|Q9Y5Q9-2|TF3C3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=10373	50.185	2	2527.0963	2527.0963	K	S	40	64
PSM	GPDKLLPYPTLASPASD	163	sp|P0C1Z6-2|TFPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=22771	110.64	2	1820.8597	1820.8597	R	-	228	245
PSM	GSLGSQGAKDEPEEELQK	164	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=9688	46.915	2	1980.8677	1980.8677	K	G	1368	1386
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	165	sp|P25440-4|BRD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=19978	96.206	3	2861.3501	2861.3501	R	A	162	190
PSM	KETESEAEDNLDDLEK	166	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=13598	65.575	2	1943.7885	1943.7885	K	H	868	884
PSM	KQETAAVCGETDEEAGESGGEGIFR	167	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15102	72.328	3	2786.078	2786.0780	K	E	1551	1576
PSM	LNQVCFDDDGTSSPQDR	168	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=10992	53.187	2	1962.8253	1962.8253	K	L	295	312
PSM	LQDLDTDYGSGYPNDPK	169	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=13230	63.844	2	1902.8579	1902.8579	K	T	199	216
PSM	LQDLDTDYGSGYPNDPK	170	sp|O75792|RNH2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13244	63.913	2	1896.8378	1896.8378	K	T	199	216
PSM	LSEGSQPAEEEEDQETPSR	171	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:267	ms_run[2]:scan=6377	30.715	2	2126.9115	2126.9115	K	N	239	258
PSM	SEAEDEDDEDYVPYVPLR	172	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=20799	100.21	2	2139.912	2139.9120	R	Q	23	41
PSM	SEVERPASIPLSSGYSTASSDSTPR	173	sp|Q9C0F1|CEP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=14932	71.55	3	2660.1967	2660.1967	K	A	324	349
PSM	SGSPSDNSGAEEMEVSLAKPK	174	sp|P31749-2|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=13669	65.892	2	2198.9403	2198.9403	R	H	60	81
PSM	SNSTETLSPAKSPSSSTGSIASSR	175	sp|Q9P0K1-5|ADA22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=8990	43.742	2	2418.0912	2418.0912	R	K	819	843
PSM	SQIFSTASDNQPTVTIK	176	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=15901	76.061	2	1841.9466	1841.9466	K	V	448	465
PSM	SQSESSDEVTELDLSHGK	177	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=12476	60.243	2	2032.857	2032.8570	R	K	657	675
PSM	SQVLVEHVVPASEPAAR	178	sp|Q969F2|NKD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=13862	66.783	2	1867.9193	1867.9193	R	A	299	316
PSM	SQVLVEHVVPASEPAAR	179	sp|Q969F2|NKD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=13858	66.771	2	1877.9276	1877.9276	R	A	299	316
PSM	SSLSGDEEDELFKGATLK	180	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=20683	99.667	2	2016.9332	2016.9332	R	A	1151	1169
PSM	SVEDDEEGHLICQSGDVLSAR	181	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,12-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=18735	90.256	2	2405.0082	2405.0082	R	Y	140	161
PSM	SYSSPDITQAIQEEEKR	182	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=18491	89.059	2	2059.9099	2059.9099	R	K	610	627
PSM	SYSSPDITQAIQEEEKR	183	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=18694	90.076	2	2059.9099	2059.9099	R	K	610	627
PSM	TCDSITPSKSSPVPVSDTQK	184	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=8285	40.503	2	2212.9923	2212.9923	R	L	190	210
PSM	TCDSITPSKSSPVPVSDTQK	185	sp|Q76FK4-2|NOL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,9-UNIMOD:188,10-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=8348	40.795	2	2225.0326	2225.0326	R	L	190	210
PSM	TCSDGGPSSELAHSPTNSGK	186	sp|Q86YV5|PRAG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:4,14-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=4744	22.939	2	2073.8406	2073.8406	R	K	769	789
PSM	TDASSASSFLDSDELER	187	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:267	ms_run[2]:scan=18599	89.621	2	1838.8045	1838.8045	R	T	308	325
PSM	TQSLPVTEKVTENQIPAK	188	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=13668	65.889	2	2062.0348	2062.0348	K	N	483	501
PSM	TSEIEPKNSPEDLGLSLTGDSCK	189	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=18706	90.134	3	2556.1302	2556.1302	K	L	492	515
PSM	TTKSPSDSGYSYETIGK	190	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:188,4-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=10072	48.731	2	1911.8542	1911.8542	R	T	1912	1929
PSM	TTKSPSDSGYSYETIGK	191	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=10084	48.783	2	1899.8139	1899.8139	R	T	1912	1929
PSM	TTKTPEDGDYSYEIIEK	192	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=14539	69.704	2	2067.8926	2067.8926	K	T	1929	1946
PSM	TVIRLPSGSGAASPTGSAVDIR	193	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=18125	87.248	2	2271.0661	2271.0661	K	A	204	226
PSM	VANPSGNLTETYVQDR	194	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12675	61.24	2	1762.8486	1762.8486	R	G	1297	1313
PSM	YRIQEQESSGEEDSDLSPEER	195	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=11591	56.148	3	2642.0058	2642.0058	K	E	114	135
PSM	YYSPCEEHPAETNQNEGAESGTIR	196	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9769	47.308	3	2818.1178	2818.1178	R	Q	182	206
PSM	YYSPCEEHPAETNQNEGSESGTIR	197	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9469	45.89	3	2834.1127	2834.1127	R	Q	182	206
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	198	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=30962	164.39154666666664	3	3007.3432	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	199	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=29084	152.45593833333334	3	3007.3432	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	200	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:188,7-UNIMOD:188,16-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=7481	36.46485833333333	3	3029.3872	3029.3772	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	201	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=7821	38.218015	3	3007.3422	3007.3292	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	202	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=30821	163.38593500000002	3	3007.3432	3007.3292	K	S	145	174
PSM	TSEIEPKNSPEDLGLSLTGDSCK	203	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	7-UNIMOD:188,9-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:188	ms_run[1]:scan=19461	93.76412833333333	3	2569.164802	2568.170503	K	L	492	515
PSM	SQQQEQQDPLEKQQLSPSPGQEAGILPETEK	204	sp|Q17RY0|CPEB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	12-UNIMOD:188,16-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=18164	87.44974166666667	3	3539.704316	3538.686726	K	A	82	113
PSM	ADANKAEVPGATGGDSPHLQPAEPPGEPR	205	sp|Q9P2K5|MYEF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=13666	65.88420333333333	3	2986.3550	2986.3453	M	R	2	31
PSM	KYSASSGGLCEEATAAK	206	sp|Q9UHV7|MED13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:188,3-UNIMOD:21,10-UNIMOD:4,17-UNIMOD:188	ms_run[1]:scan=8759	42.73603833333333	2	1821.814834	1820.805454	R	V	393	410
PSM	AASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATK	207	sp|Q9UKY7-2|CDV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=7758	37.896	4	3748.6787	3748.6787	R	A	28	77
PSM	AATSGVPSIYAPSTYAHLSPAK	208	sp|Q86X29-6|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	19-UNIMOD:21	ms_run[2]:scan=19787	95.319	2	2268.0828	2268.0828	K	T	158	180
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	209	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=18244	87.856	3	3062.4016	3062.4016	K	S	2194	2221
PSM	AEDGSVIDYELIDQDAR	210	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:267	ms_run[2]:scan=20662	99.566	2	1917.8831	1917.8831	R	D	198	215
PSM	ALEEGDGSVSGSSPRSDISQPASQDGMR	211	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21,15-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=11946	57.805	3	2919.2457	2919.2457	R	R	420	448
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	212	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,17-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=14974	71.741	3	2795.2973	2795.2973	R	T	112	140
PSM	AVTPVPTKTEEVSNLK	213	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,8-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=10475	50.664	2	1803.9422	1803.9422	R	T	447	463
PSM	AVVQVFEGTSGIDAK	214	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16734	79.74	2	1519.7882	1519.7882	K	K	94	109
PSM	DDGVFVQEVTQNSPAAR	215	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17715	85.142	2	1831.8701	1831.8701	R	T	29	46
PSM	DTTKLEPASPPEDTSAEVSR	216	sp|Q9UHL9-2|GT2D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=10278	49.703	3	2208.9788	2208.9788	K	A	440	460
PSM	EKPDSDDDLDIASLVTAK	217	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=22987	111.78	2	2010.9035	2010.9035	R	L	655	673
PSM	ELDALDANDELTPLGR	218	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:267	ms_run[2]:scan=21197	102.32	2	1750.8613	1750.8613	R	I	838	854
PSM	ESGVVAVSPEKSESPQKEDGLSSQLK	219	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13518	65.177	3	2874.2937	2874.2937	R	S	2113	2139
PSM	ETAVQCDVGDLQPPPAKPASPAQVQSSQDGGCPK	220	sp|Q8N1G1|REXO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,20-UNIMOD:21,32-UNIMOD:4	ms_run[2]:scan=14948	71.624	4	3598.6069	3598.6069	K	E	339	373
PSM	ETAVQCDVGDLQPPPAKPASPAQVQSSQDGGCPK	221	sp|Q8N1G1|REXO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:4,17-UNIMOD:188,20-UNIMOD:21,32-UNIMOD:4,34-UNIMOD:188	ms_run[2]:scan=14966	71.711	4	3610.6472	3610.6472	K	E	339	373
PSM	GADFLVTEVENGGSLGSK	222	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:188	ms_run[2]:scan=22704	110.26	2	1784.8888	1784.8888	K	K	174	192
PSM	GADFLVTEVENGGSLGSK	223	sp|P14618-3|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=22718	110.34	2	1778.8687	1778.8687	K	K	174	192
PSM	GCITIIGGGDTATCCAK	224	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12704	61.375	2	1753.7797	1753.7797	R	W	338	355
PSM	GGVTGSPEASISGSKGDLK	225	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=9476	45.922	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GVGIISEGNETVEDIAAR	226	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=21084	101.72	2	1828.9167	1828.9167	K	L	599	617
PSM	GVIPSSLFLQDDEDDDELAGK	227	sp|O76024|WFS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:188	ms_run[2]:scan=25500	126.68	2	2268.0741	2268.0741	K	S	257	278
PSM	IEDLSQQAQLAAAEK	228	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13320	64.298	2	1613.8261	1613.8261	K	F	128	143
PSM	IQPDSHSLSYGTLPDGSDSTK	229	sp|Q9H841-2|NPAL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21	ms_run[2]:scan=13646	65.799	2	2283.9897	2283.9897	K	S	354	375
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	230	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=13624	65.691	3	2621.1412	2621.1412	K	I	50	74
PSM	KETESEAEDNLDDLEK	231	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,5-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=13597	65.572	2	1955.8287	1955.8288	K	H	868	884
PSM	KIVEPEVVGESDSEVEGDAWR	232	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=19417	93.559	3	2489.04	2489.0400	R	M	106	127
PSM	LDVKSIDDEDVDENEDDVYGNSSGR	233	sp|Q8IUI4|S29P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=16713	79.672	3	2864.1509	2864.1509	K	K	187	212
PSM	LGAGEGGEASVSPEKTSTTSK	234	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=5471	26.329	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LQSPIKEENTTAVEEIGR	235	sp|Q9NS73-3|MBIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=14320	68.803	2	2093.0042	2093.0042	K	T	89	107
PSM	LSEEAECPNPSTPSKAAK	236	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4970	24.012	2	1994.8656	1994.8656	K	F	941	959
PSM	LSEGSQPAEEEEDQETPSR	237	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6330	30.471	2	2116.9033	2116.9033	K	N	239	258
PSM	LSGSNPYTTVTPQIINSK	238	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17325	83.048	2	1919	1919.0000	K	W	605	623
PSM	LSVPTSDEEDEVPAPKPR	239	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=13354	64.432	2	2124.9018	2124.9018	K	G	104	122
PSM	NPDDITQEEYGEFYK	240	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=17505	84.018	2	1852.8099	1852.8099	R	S	292	307
PSM	SAEIDSDDTGGSAAQK	241	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=2153	11.119	2	1550.6696	1550.6696	K	Q	814	830
PSM	SASPDDDLGSSNWEAADLGNEERK	242	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=17831	85.774	3	2642.077	2642.0770	R	Q	15	39
PSM	SDSRAQAVSEDAGGNEGR	243	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=3232	15.926	2	1884.7599	1884.7599	R	A	117	135
PSM	SEAGHASSPDSEVTSLCQK	244	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,17-UNIMOD:4,19-UNIMOD:188	ms_run[2]:scan=10125	48.959	2	2074.861	2074.8610	K	E	353	372
PSM	SETAPAETATPAPVEKSPAK	245	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:188,17-UNIMOD:21	ms_run[2]:scan=6333	30.486	2	2066.9869	2066.9869	M	K	2	22
PSM	SEVERPASIPLSSGYSTASSDSTPR	246	sp|Q9C0F1|CEP44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:267,8-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=14927	71.526	3	2680.2132	2680.2132	K	A	324	349
PSM	SPSDSSTASTPVAEQIER	247	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=10027	48.527	2	1860.8701	1860.8701	R	A	337	355
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	248	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=20191	97.312	3	2692.1753	2692.1753	R	L	42	66
PSM	SSLGQSASETEEDTVSVSKK	249	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=9440	45.771	2	2147.9471	2147.9471	R	E	302	322
PSM	SVSESHTSCPAESASDAAPLQR	250	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,9-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=9137	44.423	2	2375.9929	2375.9929	K	S	96	118
PSM	TGSESPKVCSDQSSGSGTGK	251	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1200	7.0469	2	2034.8201	2034.8201	R	G	213	233
PSM	TGSTSSKEDDYESDAATIVQK	252	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=13850	66.742	3	2310.9741	2310.9741	R	C	360	381
PSM	TGSTSSKEDDYESDAATIVQK	253	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=13856	66.766	2	2310.9741	2310.9741	R	C	360	381
PSM	TLSSPSLQTDGIAATPVPPPPPPK	254	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=19601	94.443	3	2447.2349	2447.2349	R	S	1800	1824
PSM	VDSAATSGYEIGNPPDYR	255	sp|P24666-4|PPAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13837	66.692	2	1910.8646	1910.8646	R	G	42	60
PSM	VQSGSESVIQEYVDLR	256	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=23064	112.15	2	1807.8952	1807.8952	K	T	1273	1289
PSM	VTQHESDNENEIQIQNK	257	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=6492	31.266	2	2104.9063	2104.9063	R	L	117	134
PSM	VVSEDFLQDVSASTK	258	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:188	ms_run[2]:scan=20706	99.778	2	1629.8193	1629.8193	R	S	453	468
PSM	YESQNTELKTQSPEFEAQSSK	259	sp|Q9H5H4|ZN768_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:188,12-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=10288	49.749	3	2522.1253	2522.1253	R	F	149	170
PSM	QAQQERDELADEIANSSGK	260	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28	ms_run[1]:scan=17129	81.96031833333333	2	2070.9538	2070.9449	R	G	1698	1717
PSM	SETAPAETATPAPVEKSPAKK	261	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7106	34.42966666666667	2	2231.0812	2231.0717	M	K	2	23
PSM	SETAPAETATPAPVEKSPAK	262	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8512	41.60245833333333	2	2102.9855	2102.9768	M	K	2	22
PSM	TVEVAEGEAVRTPQSVTAK	263	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:267,12-UNIMOD:21,19-UNIMOD:188	ms_run[1]:scan=10299	49.81156166666666	2	2068.030957	2067.022014	R	Q	132	151
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	264	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=7120	34.49939166666667	3	3007.3402	3007.3292	K	S	145	174
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	265	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=11505	55.73857333333333	3	3261.3762	3261.3652	R	G	54	87
PSM	QPCPSESDIITEEDKSK	266	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:188,17-UNIMOD:188	ms_run[1]:scan=14087	67.80269	2	2036.8734	2036.8683	K	K	202	219
PSM	QPCPSESDIITEEDKSK	267	sp|O75475|PSIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=14112	67.89630666666666	2	2024.8345	2024.8281	K	K	202	219
PSM	YRIQEQESSGEEDSDLSPEER	268	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=10629	51.38827166666667	3	2643.008244	2642.005847	K	E	114	135
PSM	DSPLQGSGQQNSQAGQRNSTSSIEPR	269	sp|O95819-2|M4K4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	19-UNIMOD:21	ms_run[1]:scan=8864	43.192395	3	2809.233973	2808.242407	R	L	607	633
PSM	GADFLVTEVENGGSLGSK	270	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	18-UNIMOD:188	ms_run[1]:scan=23356	113.74120500000001	2	1785.879550	1784.888788	K	K	189	207
PSM	ALQDLENAASGDATVR	271	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:267	ms_run[2]:scan=15231	72.914	2	1639.8041	1639.8041	K	Q	183	199
PSM	ALQDLENAASGDATVR	272	sp|Q9NQG5|RPR1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15239	72.949	2	1629.7958	1629.7958	K	Q	183	199
PSM	ANSSGLYKCELCEFNSK	273	sp|Q9UID6|ZN639_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=16544	79.023	2	2085.8537	2085.8537	R	Y	198	215
PSM	ASLGSLEGEAEAEASSPKGK	274	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=19764	95.22	2	1996.899	1996.8990	K	F	5748	5768
PSM	EAAEPLSEPKEDQEAAELLSEPEEESER	275	sp|Q63HN8|RN213_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=19532	94.1	3	3220.382	3220.3820	R	H	1239	1267
PSM	EKPDSDDDLDIASLVTAK	276	sp|Q86V48-2|LUZP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=23185	112.79	2	2010.9035	2010.9035	R	L	655	673
PSM	EQDNSESPNGRTSPLVSQNNEQGSTLR	277	sp|Q15652-3|JHD2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,11-UNIMOD:267,27-UNIMOD:267	ms_run[2]:scan=9296	45.175	3	3043.3383	3043.3383	R	D	1859	1886
PSM	ESSPLYSPTFSDSTSAVKEK	278	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=15325	73.385	2	2238.9933	2238.9933	R	T	1791	1811
PSM	FLGSDEEDKDSLQELSTEQK	279	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,9-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=17801	85.601	3	2389.0613	2389.0613	K	C	427	447
PSM	FNDSEGDDTEETEDYR	280	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8247	40.294	2	1920.7133	1920.7133	K	Q	392	408
PSM	GAASPVLQEDHCDSLPSVLQVEEK	281	sp|Q8N9B5-2|JMY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,12-UNIMOD:4,24-UNIMOD:188	ms_run[2]:scan=21938	106.16	3	2693.2351	2693.2351	K	T	710	734
PSM	GAEAANVTGPGGVPVQGSK	282	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=8257	40.345	2	1694.8588	1694.8588	K	Y	119	138
PSM	GGVTGSPEASISGSKGDLK	283	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=9695	46.941	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GPFVEAEVPDVDLECPDAK	284	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=22336	108.3	2	2085.9565	2085.9565	K	L	1819	1838
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	285	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=17420	83.579	3	2729.1371	2729.1371	K	S	61	87
PSM	GVVPLAGTDGETTTQGLDGLSER	286	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19918	95.943	2	2272.1183	2272.1183	K	C	112	135
PSM	IAQLEEELEEEQGNTELINDR	287	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=22651	109.98	3	2471.1664	2471.1664	R	L	1731	1752
PSM	IEDVGSDEEDDSGKDK	288	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1674	9.0892	2	1828.729	1828.7290	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	289	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=2053	10.682	2	1828.729	1828.7290	K	K	250	266
PSM	IINEPTAAAIAYGLDK	290	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21619	104.54	2	1658.8879	1658.8879	R	K	172	188
PSM	IINEPTAAAIAYGLDK	291	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=21630	104.6	2	1664.9081	1664.9081	R	K	172	188
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	292	sp|Q66K14-2|TBC9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=11828	57.272	3	3339.4545	3339.4545	R	Q	409	441
PSM	KLSSSDAPAQDTGSSAAAVETDASR	293	sp|Q7Z4S6-3|KI21A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=7937	38.758	3	2501.0919	2501.0919	R	T	851	876
PSM	KVVEAVNSDSDSEFGIPK	294	sp|Q02880-2|TOP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,8-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=16169	77.335	3	2091.9206	2091.9206	K	K	1510	1528
PSM	LASGEDDPFDSDFSCPVK	295	sp|Q99567|NUP88_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=20040	96.507	2	1984.836	1984.8360	K	L	377	395
PSM	LDSSPSVSSTLAAKDDPDGK	296	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=10664	51.55	2	2068.9202	2068.9202	K	Q	1187	1207
PSM	LGAGEGGEASVSPEKTSTTSK	297	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=5886	28.352	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LPPNTNDEVDEDPTGNK	298	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:188	ms_run[2]:scan=7612	37.151	2	1859.848	1859.8480	R	A	1058	1075
PSM	LSEEAECPNPSTPSKAAK	299	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5186	25.018	2	1994.8656	1994.8656	K	F	941	959
PSM	LTVVDTPGYGDAINCR	300	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=15724	75.306	2	1749.8356	1749.8356	R	D	97	113
PSM	MDRTPPPPTLSPAAITVGR	301	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=17563	84.383	3	2135.984	2135.9840	R	G	587	606
PSM	NEEENIYSVPHDSTQGK	302	sp|Q9NRY4|RHG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=7884	38.493	2	2025.8317	2025.8317	R	I	1099	1116
PSM	NEEENIYSVPHDSTQGK	303	sp|Q9NRY4|RHG35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=7889	38.509	2	2031.8518	2031.8518	R	I	1099	1116
PSM	NPDDITNEEYGEFYK	304	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:188	ms_run[2]:scan=17071	81.626	2	1838.7942	1838.7942	R	S	422	437
PSM	NTDVAQSPEAPKQEAPAK	305	sp|Q9P2E9-3|RRBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=3933	19.098	2	1959.8939	1959.8939	R	K	179	197
PSM	QTSNRSEPSGEINIDSSGETVGSGER	306	sp|P42695|CNDD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21,5-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=11615	56.278	3	2792.2001	2792.2001	R	C	515	541
PSM	SAEIDSDDTGGSAAQK	307	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:188	ms_run[2]:scan=2150	11.106	2	1556.6898	1556.6898	K	Q	814	830
PSM	SETAPAETATPAPVEKSPAKK	308	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=4842	23.373	2	2189.0617	2189.0617	M	K	2	23
PSM	SGCSDLEEAVDSGADKK	309	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:4,4-UNIMOD:21,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=12932	62.442	2	1858.7695	1858.7695	K	F	659	676
PSM	SGDEEFKGEDELCDSGR	310	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11681	56.597	2	2008.7357	2008.7357	R	Q	339	356
PSM	SGKQGSPDQVSPVSEMTSTSLYQDK	311	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=18477	89.003	3	2735.1997	2735.1997	K	Q	1433	1458
PSM	SPSDVSASESPQHDVVDLGSTAPLK	312	sp|Q8N9M5|TM102_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=17858	85.904	3	2602.18	2602.1800	K	T	209	234
PSM	SPSTTYLHTPTPSEDAAIPSK	313	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=15192	72.722	3	2279.0359	2279.0359	R	S	775	796
PSM	SQEQLAAELAEYTAK	314	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21331	103.03	2	1650.8101	1650.8101	K	I	413	428
PSM	SSKCSTAGSSPNSVSELSLASLTEK	315	sp|Q5M775-2|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=21019	101.37	3	2606.1783	2606.1783	K	I	352	377
PSM	SSLSGDEEDELFKGATLK	316	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=20340	98.024	2	2004.8929	2004.8929	R	A	1151	1169
PSM	SSLSGDEEDELFKGATLK	317	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=20763	100.06	2	2004.8929	2004.8929	R	A	1151	1169
PSM	SSSPAPADIAQTVQEDLR	318	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23411	114.05	2	1883.9225	1883.9225	K	T	230	248
PSM	SSVKTPETVVPAAPELQPSTSTDQPVTPEPTSR	319	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=17804	85.623	3	3512.6924	3512.6924	R	A	1522	1555
PSM	STGEAFVQFASQEIAEK	320	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=24902	122.95	2	1840.8843	1840.8843	R	A	151	168
PSM	STVTNEVKTEVLSPNSK	321	sp|Q8NEZ4-3|KMT2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=12277	59.368	2	1911.9191	1911.9191	K	V	2816	2833
PSM	SYFHLFPPPPSPCTDSS	322	sp|O75197|LRP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=23482	114.46	2	2014.8172	2014.8172	R	-	1599	1616
PSM	TAANKSPCETISSPSSTLESK	323	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10285	49.734	2	2274.0087	2274.0087	K	D	202	223
PSM	TAPRQEAIPDLEDSPPVSDSEEQQESAR	324	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=15765	75.477	3	3240.3497	3240.3497	K	A	792	820
PSM	TQSSASLAASYAAQQHPQAAASYR	325	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=13445	64.8	2	2554.1477	2554.1477	R	G	518	542
PSM	VDIEAPDVSLEGPEGK	326	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18058	86.915	2	1653.8097	1653.8097	K	L	1162	1178
PSM	VINEPTAAALAYGLDK	327	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21057	101.58	2	1644.8723	1644.8723	R	S	219	235
PSM	VVSSTSEEEEAFTEKFLK	328	sp|Q8N573-2|OXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=24450	120.11	2	2151.0063	2151.0063	R	I	191	209
PSM	YLTESYGTGQDIDDR	329	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=11776	57.034	2	1731.7588	1731.7588	R	I	167	182
PSM	YRIQEQESSGEEDSDLSPEER	330	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=11384	55.126	3	2642.0058	2642.0058	K	E	114	135
PSM	YSQGDDDGSSSSGGSSVAGSQSTLFKDSPLR	331	sp|Q9UH99-3|SUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	28-UNIMOD:21	ms_run[2]:scan=15956	76.317	3	3158.3313	3158.3313	R	T	11	42
PSM	SETAPAETATPAPVEKSPAKK	332	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7486	36.483333333333334	2	2231.0812	2231.0717	M	K	2	23
PSM	DDDIAALVVDNGSGMCK	333	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=25138	124.47634666666666	2	1820.8022	1820.7912	M	A	2	19
PSM	AATSGVPSIYAPSTYAHLSPAK	334	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	19-UNIMOD:21,22-UNIMOD:188	ms_run[1]:scan=19786	95.31507166666667	2	2275.114648	2274.102894	K	T	314	336
PSM	EGNTTEDDFPSSPGNGNKSSNSSEER	335	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:21	ms_run[1]:scan=7280	35.44460333333333	3	2822.086650	2821.094799	R	T	295	321
PSM	SVAGGEIRGDTGGEDTAAPGR	336	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1	ms_run[1]:scan=9789	47.39978333333333	2	2013.9417	2013.9347	M	F	2	23
PSM	QAEIENPLEDPVTGDYVHK	337	sp|Q93050|VPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,19-UNIMOD:188	ms_run[1]:scan=21703	104.97499333333333	2	2142.0289	2142.0207	R	S	199	218
PSM	LSVPTSDEEDEVPAPKPR	338	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=13037	62.96765	2	2126.914603	2124.901763	K	G	104	122
PSM	LSVPTSDEEDEVPAPKPR	339	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:21,6-UNIMOD:21,16-UNIMOD:188,18-UNIMOD:267	ms_run[1]:scan=12714	61.41686333333333	2	2141.942045	2140.930161	K	G	104	122
PSM	SYSSPDITQAIQEEEKR	340	sp|P40818|UBP8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21	ms_run[1]:scan=19070	91.91324499999999	2	2060.907203	2059.909945	R	K	716	733
PSM	SGGLQTPECLSREGSPIPHDPEFGSK	341	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=17723	85.180015	3	3023.217218	3021.201801	R	L	431	457