MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH10.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH10.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null	20-UNIMOD:21,19-UNIMOD:21	0.07	58.0	2	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,39-UNIMOD:267	0.03	55.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	null	157-UNIMOD:188,189-UNIMOD:188	0.15	53.0	3	2	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	127-UNIMOD:21	0.05	51.0	2	1	0
PRT	sp|A7E2V4-5|ZSWM8_HUMAN	Isoform 5 of Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	53-UNIMOD:21	0.01	50.0	1	1	1
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null		0.08	49.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	28-UNIMOD:188,36-UNIMOD:21,42-UNIMOD:188,39-UNIMOD:21	0.06	48.0	2	1	0
PRT	sp|Q10586|DBP_HUMAN	D site-binding protein OS=Homo sapiens OX=9606 GN=DBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	86-UNIMOD:21	0.11	48.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	160-UNIMOD:21,164-UNIMOD:21	0.01	47.0	1	1	1
PRT	sp|Q15149-4|PLEC_HUMAN	Isoform 4 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	4249-UNIMOD:21	0.00	47.0	1	1	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	47.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188,691-UNIMOD:21,696-UNIMOD:21	0.07	47.0	5	2	0
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	110-UNIMOD:21,108-UNIMOD:188,115-UNIMOD:188	0.05	46.0	5	1	0
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	534-UNIMOD:188,540-UNIMOD:21,552-UNIMOD:188,536-UNIMOD:21	0.02	46.0	2	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	169-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.04	46.0	4	1	0
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	181-UNIMOD:21	0.04	46.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1438-UNIMOD:21	0.01	46.0	1	1	1
PRT	sp|P28749-2|RBL1_HUMAN	Isoform 2 of Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	749-UNIMOD:21,762-UNIMOD:21,748-UNIMOD:188,764-UNIMOD:188	0.02	46.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:188	0.11	46.0	2	1	0
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	141-UNIMOD:21,153-UNIMOD:188,154-UNIMOD:188	0.07	45.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	102-UNIMOD:21	0.12	45.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	129-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	154-UNIMOD:188,157-UNIMOD:21,159-UNIMOD:21,166-UNIMOD:188	0.04	45.0	2	1	0
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	178-UNIMOD:21,189-UNIMOD:21	0.10	45.0	1	1	1
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1121-UNIMOD:21,1119-UNIMOD:188,1141-UNIMOD:188	0.01	45.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	214-UNIMOD:21,207-UNIMOD:188,224-UNIMOD:188	0.02	45.0	3	1	0
PRT	sp|Q8TE77|SSH3_HUMAN	Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	null	8-UNIMOD:267,9-UNIMOD:21,28-UNIMOD:267	0.04	45.0	1	1	1
PRT	sp|Q6R327|RICTR_HUMAN	Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1470-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|P09455-2|RET1_HUMAN	Isoform 2 of Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	20-UNIMOD:21	0.14	44.0	1	1	1
PRT	sp|Q9UK58-6|CCNL1_HUMAN	Isoform 4 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	335-UNIMOD:21,342-UNIMOD:21	0.07	44.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	229-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	398-UNIMOD:21,401-UNIMOD:267,1000-UNIMOD:188,1003-UNIMOD:21,1013-UNIMOD:188,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:188	0.02	44.0	2	2	2
PRT	sp|Q8TF44|C2C4C_HUMAN	C2 calcium-dependent domain-containing protein 4C OS=Homo sapiens OX=9606 GN=C2CD4C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	273-UNIMOD:21	0.05	44.0	1	1	1
PRT	sp|Q16514-2|TAF12_HUMAN	Isoform TAFII15 of Transcription initiation factor TFIID subunit 12 OS=Homo sapiens OX=9606 GN=TAF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	21-UNIMOD:21	0.17	44.0	1	1	1
PRT	sp|Q9UJM3|ERRFI_HUMAN	ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	117-UNIMOD:188,124-UNIMOD:4,127-UNIMOD:21,134-UNIMOD:188	0.04	44.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	576-UNIMOD:21,586-UNIMOD:267	0.03	44.0	6	1	0
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	71-UNIMOD:4,72-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q6NYC8|PPR18_HUMAN	Phostensin OS=Homo sapiens OX=9606 GN=PPP1R18 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	490-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|Q9Y2H5|PKHA6_HUMAN	Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	842-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	207-UNIMOD:267,216-UNIMOD:21,225-UNIMOD:267	0.00	44.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	329-UNIMOD:21,336-UNIMOD:267	0.03	43.0	3	1	0
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	85-UNIMOD:21,93-UNIMOD:188	0.03	43.0	3	1	0
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	71-UNIMOD:267,74-UNIMOD:21,86-UNIMOD:267,306-UNIMOD:21,319-UNIMOD:267,156-UNIMOD:21,166-UNIMOD:21	0.15	43.0	5	3	2
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	331-UNIMOD:188,341-UNIMOD:21,350-UNIMOD:188,379-UNIMOD:21,384-UNIMOD:188	0.06	43.0	4	2	0
PRT	sp|Q2M2I8-2|AAK1_HUMAN	Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	18-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	131-UNIMOD:21,146-UNIMOD:267	0.02	43.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	641-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	383-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1531-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|Q14181|DPOA2_HUMAN	DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	147-UNIMOD:21,160-UNIMOD:188	0.04	43.0	2	1	0
PRT	sp|Q5HYK7|SH319_HUMAN	SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	268-UNIMOD:385,268-UNIMOD:4,275-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q7Z5P9|MUC19_HUMAN	Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	4303-UNIMOD:21,4321-UNIMOD:21,4323-UNIMOD:21,4324-UNIMOD:21,4325-UNIMOD:267	0.00	43.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	679-UNIMOD:21,692-UNIMOD:188,683-UNIMOD:21	0.03	42.0	3	1	0
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	90-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	87-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	111-UNIMOD:21	0.02	42.0	1	1	0
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	761-UNIMOD:188,767-UNIMOD:21,776-UNIMOD:21,785-UNIMOD:188,775-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	179-UNIMOD:188	0.12	42.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	247-UNIMOD:21	0.10	42.0	1	1	1
PRT	sp|Q9UIF8-4|BAZ2B_HUMAN	Isoform 4 of Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1818-UNIMOD:21,1823-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|O75379|VAMP4_HUMAN	Vesicle-associated membrane protein 4 OS=Homo sapiens OX=9606 GN=VAMP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	23-UNIMOD:267,30-UNIMOD:21,39-UNIMOD:267	0.13	42.0	2	1	0
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	356-UNIMOD:188,357-UNIMOD:21,372-UNIMOD:188	0.01	42.0	1	1	1
PRT	sp|O15027-5|SC16A_HUMAN	Isoform 5 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2253-UNIMOD:21,2244-UNIMOD:267,2267-UNIMOD:267	0.01	42.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2155-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	252-UNIMOD:21,256-UNIMOD:267,246-UNIMOD:21,249-UNIMOD:21	0.06	42.0	4	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1,3-UNIMOD:21	0.11	42.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1084-UNIMOD:21,2319-UNIMOD:21	0.02	41.0	2	2	2
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	372-UNIMOD:267,384-UNIMOD:21,386-UNIMOD:267	0.01	41.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	112-UNIMOD:21	0.07	41.0	2	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	89-UNIMOD:188,92-UNIMOD:188,102-UNIMOD:21,103-UNIMOD:21,36-UNIMOD:21,53-UNIMOD:21,31-UNIMOD:188,46-UNIMOD:188,55-UNIMOD:188	0.43	41.0	9	2	0
PRT	sp|Q96L91-4|EP400_HUMAN	Isoform 4 of E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2539-UNIMOD:21,2565-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|O60353-2|FZD6_HUMAN	Isoform 2 of Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	583-UNIMOD:4,588-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q5XUX1-3|FBXW9_HUMAN	Isoform 3 of F-box/WD repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=FBXW9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	59-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q15742-2|NAB2_HUMAN	Isoform 2 of NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	171-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	47-UNIMOD:21,56-UNIMOD:267	0.04	41.0	3	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	141-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	41.0	1	1	1
PRT	sp|Q8IWR0|Z3H7A_HUMAN	Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	210-UNIMOD:21,212-UNIMOD:267	0.02	40.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	500-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	79-UNIMOD:188,80-UNIMOD:188	0.05	40.0	7	1	0
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.29	40.0	1	1	1
PRT	sp|Q9NQ86-4|TRI36_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	636-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	139-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9C0E2|XPO4_HUMAN	Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	521-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	244-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|P62070-2|RRAS2_HUMAN	Isoform 2 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	106-UNIMOD:4,109-UNIMOD:21	0.13	40.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	925-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9Y2F5|ICE1_HUMAN	Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	944-UNIMOD:21,951-UNIMOD:4	0.01	40.0	1	1	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	677-UNIMOD:21,681-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	80-UNIMOD:188,82-UNIMOD:21,86-UNIMOD:188,95-UNIMOD:188	0.04	40.0	1	1	1
PRT	sp|Q71F23-3|CENPU_HUMAN	Isoform 3 of Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	141-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	62-UNIMOD:267,76-UNIMOD:21,77-UNIMOD:267	0.07	40.0	1	1	1
PRT	sp|P51114-3|FXR1_HUMAN	Isoform 3 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	326-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	136-UNIMOD:267,143-UNIMOD:21,147-UNIMOD:21,150-UNIMOD:267,37-UNIMOD:21	0.15	40.0	3	2	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	371-UNIMOD:267,373-UNIMOD:21,376-UNIMOD:21,378-UNIMOD:4,385-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1783-UNIMOD:21,1774-UNIMOD:267,1788-UNIMOD:267	0.01	40.0	2	1	0
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	292-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q5JVS0-2|HABP4_HUMAN	Isoform 2 of Intracellular hyaluronan-binding protein 4 OS=Homo sapiens OX=9606 GN=HABP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	108-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	207-UNIMOD:21,232-UNIMOD:267	0.07	40.0	4	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	225-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	403-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q8IX07|FOG1_HUMAN	Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	898-UNIMOD:267,901-UNIMOD:21,915-UNIMOD:267	0.02	40.0	2	1	0
PRT	sp|Q9Y6Q9-4|NCOA3_HUMAN	Isoform 4 of Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	214-UNIMOD:21,218-UNIMOD:267	0.01	40.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	2861-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q15742|NAB2_HUMAN	NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	171-UNIMOD:21,169-UNIMOD:188	0.04	40.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	22-UNIMOD:21,25-UNIMOD:188,35-UNIMOD:188,36-UNIMOD:21,43-UNIMOD:188	0.17	40.0	3	2	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	106-UNIMOD:188,111-UNIMOD:21,122-UNIMOD:267	0.02	40.0	1	1	0
PRT	sp|P25440|BRD2_HUMAN	Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	298-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q9BZ29-6|DOCK9_HUMAN	Isoform 5 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	926-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	910-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	307-UNIMOD:21,308-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	314-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8IU60-2|DCP2_HUMAN	Isoform 2 of m7GpppN-mRNA hydrolase OS=Homo sapiens OX=9606 GN=DCP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	284-UNIMOD:21,291-UNIMOD:188	0.05	39.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	237-UNIMOD:21,254-UNIMOD:267	0.05	39.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	39.0	2	1	0
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	807-UNIMOD:21,810-UNIMOD:188,814-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	733-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	204-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q13286-5|CLN3_HUMAN	Isoform 5 of Battenin OS=Homo sapiens OX=9606 GN=CLN3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	10-UNIMOD:267,14-UNIMOD:21,24-UNIMOD:267	0.06	39.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	437-UNIMOD:21,983-UNIMOD:21	0.02	39.0	2	2	2
PRT	sp|Q9C075|K1C23_HUMAN	Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	52-UNIMOD:4,65-UNIMOD:21	0.06	39.0	2	1	0
PRT	sp|O15075-3|DCLK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	25-UNIMOD:21,29-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q7Z2E3-13|APTX_HUMAN	Isoform 13 of Aprataxin OS=Homo sapiens OX=9606 GN=APTX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	118-UNIMOD:21,147-UNIMOD:4	0.19	39.0	1	1	1
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	82-UNIMOD:21,84-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|O75971-2|SNPC5_HUMAN	Isoform 2 of snRNA-activating protein complex subunit 5 OS=Homo sapiens OX=9606 GN=SNAPC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.26	39.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	333-UNIMOD:188,339-UNIMOD:4,342-UNIMOD:21,348-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|Q9Y561-2|LRP12_HUMAN	Isoform 2 of Low-density lipoprotein receptor-related protein 12 OS=Homo sapiens OX=9606 GN=LRP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	636-UNIMOD:21,642-UNIMOD:267,643-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|O95359-3|TACC2_HUMAN	Isoform 3 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1553-UNIMOD:267,1562-UNIMOD:21,1573-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|Q7KZ85-2|SPT6H_HUMAN	Isoform 2 of Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	358-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q96SK2-3|TM209_HUMAN	Isoform 3 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	268-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P29317|EPHA2_HUMAN	Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	894-UNIMOD:267,897-UNIMOD:21,907-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q76N32-2|CEP68_HUMAN	Isoform 2 of Centrosomal protein of 68 kDa OS=Homo sapiens OX=9606 GN=CEP68	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	478-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	50-UNIMOD:21,55-UNIMOD:4	0.05	39.0	2	1	0
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1156-UNIMOD:21,1166-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	52-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	366-UNIMOD:21,370-UNIMOD:188,383-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	433-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	248-UNIMOD:21,253-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	305-UNIMOD:267,308-UNIMOD:21,318-UNIMOD:267	0.06	38.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	86-UNIMOD:21,88-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	154-UNIMOD:21,156-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1268-UNIMOD:21,1278-UNIMOD:21,1280-UNIMOD:267	0.00	38.0	2	1	0
PRT	sp|Q5JSZ5-5|PRC2B_HUMAN	Isoform 1 of Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	226-UNIMOD:21,233-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q9C0D5-2|TANC1_HUMAN	Isoform 2 of Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1562-UNIMOD:21,1568-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1014-UNIMOD:188,1016-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|Q96T17|MA7D2_HUMAN	MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	228-UNIMOD:188,230-UNIMOD:21,242-UNIMOD:188,255-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	9-UNIMOD:21	0.21	38.0	1	1	1
PRT	sp|Q2M2Z5-5|KIZ_HUMAN	Isoform 5 of Centrosomal protein kizuna OS=Homo sapiens OX=9606 GN=KIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	184-UNIMOD:21,188-UNIMOD:21,196-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	62-UNIMOD:21,66-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q5T5P2|SKT_HUMAN	Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1640-UNIMOD:267,1650-UNIMOD:21,1654-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2029-UNIMOD:21,2037-UNIMOD:21,2048-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	917-UNIMOD:21,922-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|P10644-2|KAP0_HUMAN	Isoform 2 of cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	83-UNIMOD:21	0.06	38.0	2	1	0
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	108-UNIMOD:4,113-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q4KMQ1|TPRN_HUMAN	Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	274-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	731-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	2706-UNIMOD:4,2708-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	592-UNIMOD:21,596-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q13112|CAF1B_HUMAN	Chromatin assembly factor 1 subunit B OS=Homo sapiens OX=9606 GN=CHAF1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	439-UNIMOD:28,447-UNIMOD:267,457-UNIMOD:188,458-UNIMOD:21,467-UNIMOD:188	0.05	38.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	476-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	54-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|Q9NW81-2|DMAC2_HUMAN	Isoform 2 of Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	124-UNIMOD:21,125-UNIMOD:21,127-UNIMOD:21,131-UNIMOD:4	0.13	38.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	4-UNIMOD:21	ms_run[2]:scan=7147	31.279	3	2739.1634	2739.1634	R	A	17	51
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	2	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=11444	49.749	3	3098.1643	3098.1643	R	A	10	40
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	3	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11429	49.692	3	3088.156	3088.1560	R	A	10	40
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	4	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	2-UNIMOD:188,34-UNIMOD:188	ms_run[2]:scan=14058	61.376	3	3961.3987	3961.3987	K	A	156	190
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	5	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	52.0		ms_run[2]:scan=14018	61.187	3	3949.3584	3949.3584	K	A	156	190
PSM	RSSPAAFINPPIGTVTPALK	6	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21	ms_run[2]:scan=23752	107.5	2	2116.1082	2116.1082	K	L	125	145
PSM	KQSAGPNSPTGGGGGGGSGGTR	7	sp|A7E2V4-5|ZSWM8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	8-UNIMOD:21	ms_run[2]:scan=734	5.2678	2	1922.8232	1922.8232	R	M	46	68
PSM	VEKEEAGGGISEEEAAQYDR	8	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=10310	45.096	2	2165.9713	2165.9713	M	Q	2	22
PSM	IVAPGKGILAADESTGSIAK	9	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:188,14-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=17246	76.26	2	1989.0586	1989.0586	R	R	23	43
PSM	KAALPAATTPGPGLETAGPADAPAGAVVGGGSPR	10	sp|Q10586|DBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	32-UNIMOD:21	ms_run[2]:scan=18553	82.455	3	3061.5234	3061.5234	R	G	55	89
PSM	RSSPAAFINPPIGTVTPALK	11	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	3-UNIMOD:21	ms_run[2]:scan=23919	108.51	2	2116.1082	2116.1082	K	L	125	145
PSM	IVAPGKGILAADESTGSIAK	12	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	17-UNIMOD:21	ms_run[2]:scan=16727	73.744	2	1977.0184	1977.0184	R	R	23	43
PSM	SRDESASETSTPSEHSAAPSPQVEVR	13	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=8487	37.376	3	2900.1863	2900.1863	R	T	145	171
PSM	SRSSSVGSSSSYPISPAVSR	14	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:21	ms_run[2]:scan=11615	50.52	2	2076.9477	2076.9477	R	T	4245	4265
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	15	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=19673	87.93	3	2536.2574	2536.2574	K	T	508	533
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	16	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23150	104.41151333333333	3	3112.593433	3111.608898	R	A	655	686
PSM	AAPEASSPPASPLQHLLPGK	17	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=22493	101.15659666666667	2	2127.984123	2126.980288	K	A	686	706
PSM	EKPDSDDDLDIASLVTAK	18	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=22618	101.75	2	1930.9371	1930.9371	R	L	655	673
PSM	GPPASSPAPAPKFSPVTPK	19	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:21	ms_run[2]:scan=13920	60.747	2	1911.9496	1911.9496	R	F	97	116
PSM	GPPASSPAPAPKFSPVTPK	20	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13949	60.876	2	1923.9898	1923.9898	R	F	97	116
PSM	KLSLGQYDNDAGGQLPFSK	21	sp|Q68CZ2-2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,7-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=19491	87.046	2	2129.0233	2129.0233	R	C	534	553
PSM	NHLSPQQGGATPQVPSPCCR	22	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11219	48.873	2	2279.9805	2279.9805	K	F	166	186
PSM	RPLSGPDVGTPQPAGLASGAK	23	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21	ms_run[2]:scan=14748	64.566	2	2055.015	2055.0150	K	L	178	199
PSM	SGKQGSPDQVSPVSEMTSTSLYQDKQEGK	24	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=17541	77.652	3	3177.4173	3177.4173	K	S	1433	1462
PSM	VKSPVSLTAHSLIGASPK	25	sp|P28749-2|RBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=18025	80.004	2	1950.9581	1950.9581	K	Q	747	765
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	26	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21378	95.7411	3	3448.4204	3448.4228	K	L	104	135
PSM	AAPEASSPPASPLQHLLPGK	27	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	6-UNIMOD:21	ms_run[1]:scan=23084	104.08486500000001	2	2047.014592	2047.013957	K	A	686	706
PSM	ATNESEDEIPQLVPIGKK	28	sp|O76021-2|RL1D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=20542	91.897	2	2059.0277	2059.0277	K	T	137	155
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	29	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21	ms_run[2]:scan=21060	94.272	3	3393.3457	3393.3457	K	F	86	114
PSM	GPPASSPAPAPKFSPVTPK	30	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21	ms_run[2]:scan=14140	61.779	2	1911.9496	1911.9496	R	F	97	116
PSM	HYEDGYPGGSDNYGSLSR	31	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	15-UNIMOD:21	ms_run[2]:scan=11797	51.366	2	2052.7851	2052.7851	R	V	115	133
PSM	IAAPELHKGDSDSEEDEPTK	32	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:188,11-UNIMOD:21,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=9146	40.082	2	2338.9646	2338.9646	K	K	147	167
PSM	KSPSGPVKSPPLSPVGTTPVK	33	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=13219	57.662	3	2219.1004	2219.1004	R	L	177	198
PSM	KVSGDSSHTETTAEEVPEDPLLK	34	sp|Q6W2J9-4|BCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=16271	71.587	2	2548.1582	2548.1582	R	A	1119	1142
PSM	NKPGPNIESGNEDDDASFK	35	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21	ms_run[2]:scan=10401	45.438	2	2112.8637	2112.8637	K	I	206	225
PSM	LVTVSRSPPGSGASTPVGPWDQAVQR	36	sp|Q8TE77|SSH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	6-UNIMOD:267,7-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=20685	92.566365	3	2748.3478	2748.3494	A	R	3	29
PSM	AFAHDAGGLPSGTGGLVK	37	sp|Q6R327|RICTR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=16371	72.058	2	1733.8138	1733.8138	R	N	1460	1478
PSM	AGNPAVAAPQSPLSPEGAHFR	38	sp|P09455-2|RET1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=15732	69.072	2	2153.0055	2153.0055	R	A	10	31
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	39	sp|Q9UK58-6|CCNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	19-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=20762	92.92	3	2869.3413	2869.3413	K	E	317	345
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	40	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=7184	31.417	2	2739.1634	2739.1634	R	A	17	51
PSM	GPPASSPAPAPKFSPVTPK	41	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13718	59.846	2	1923.9898	1923.9898	R	F	97	116
PSM	GPSTPKSPGASNFSTLPK	42	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21	ms_run[2]:scan=12558	54.697	2	1851.8768	1851.8768	R	I	223	241
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	43	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	25-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=17082	75.443	3	2941.3846	2941.3846	R	D	374	402
PSM	HGSLSADDSTPDASPGSR	44	sp|Q8TF44|C2C4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:21	ms_run[2]:scan=4362	19.287	2	1835.7323	1835.7323	R	R	260	278
PSM	IPGTPGAGGRLSPENNQVLTK	45	sp|Q16514-2|TAF12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=14471	63.337	2	2185.0892	2185.0892	K	K	10	31
PSM	KLTVNGVCASTPPLTPIK	46	sp|Q9UJM3|ERRFI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,8-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=18641	82.802	2	1987.0616	1987.0616	K	N	117	135
PSM	KVSGDSSHTETTAEEVPEDPLLK	47	sp|Q6W2J9-4|BCOR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,3-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=16273	71.592	2	2560.1984	2560.1984	R	A	1119	1142
PSM	NHLSPQQGGATPQVPSPCCR	48	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11194	48.765	2	2269.9722	2269.9722	K	F	166	186
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	49	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14940	65.382	3	3116.2144	3116.2144	K	N	561	587
PSM	NKPGPNIESGNEDDDASFK	50	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10500	45.834	2	2124.904	2124.9040	K	I	206	225
PSM	RCSDNTEVEVSNLENKQPVESTSAK	51	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=13670	59.643	3	2900.2859	2900.2859	K	S	70	95
PSM	RSVPPATPATPTSPATVDAAVPGAGK	52	sp|Q6NYC8|PPR18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=14591	63.89	3	2495.2421	2495.2421	R	K	478	504
PSM	SLQLPASPAPDPSPRPAYK	53	sp|Q9Y2H5|PKHA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=16585	73.114	2	2071.014	2071.0140	R	V	842	861
PSM	TVIRLPSGSGAASPTGSAVDIR	54	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:267,13-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=18749	83.308	2	2211.1163	2211.1163	K	A	204	226
PSM	VKSPVSLTAHSLIGASPK	55	sp|P28749-2|RBL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	2-UNIMOD:188,3-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=18055	80.15	2	1962.9984	1962.9984	K	Q	747	765
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	56	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=21289	95.32826833333334	3	3442.4009	3442.4027	K	L	104	135
PSM	AHLTVGQAAAGGSGNLLTER	57	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=16176	71.127	2	2001.9633	2001.9633	R	S	317	337
PSM	FIHQQPQSSSPVYGSSAK	58	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=8074	35.512	2	2026.915	2026.9150	R	T	76	94
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	59	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:267,14-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=16596	73.166	3	2669.1873	2669.1873	K	S	61	87
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	60	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14492	63.428	3	4117.4483	4117.4483	K	K	158	194
PSM	LKQLMEQDASSSPSAQVIGLK	61	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,12-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=18900	84.051	3	2321.1741	2321.1741	K	N	330	351
PSM	REQGGSGLGSGSSGGGGSTSGLGSGYIGR	62	sp|Q2M2I8-2|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=13344	58.212	3	2621.1467	2621.1467	R	V	9	38
PSM	SHSQASLAGPGPVDPSNR	63	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=8827	38.835	2	1865.8297	1865.8297	R	S	129	147
PSM	SLGSASPGPGQPPLSSPTRGGVK	64	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	16-UNIMOD:21	ms_run[2]:scan=11756	51.161	2	2213.0842	2213.0842	K	K	626	649
PSM	SRTGSESSQTGTSTTSSR	65	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=676	5.0613	2	1895.7858	1895.7858	R	N	379	397
PSM	TSVATSTEGKDKDVTLSPVK	66	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=9492	41.618	2	2142.0457	2142.0457	K	A	1515	1535
PSM	AAPEASSPPASPLQHLLPGK	67	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	6-UNIMOD:21	ms_run[1]:scan=22676	102.04704	2	2047.014592	2047.013957	K	A	686	706
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	68	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	16-UNIMOD:21	ms_run[1]:scan=15136	66.31605	3	3107.194239	3106.206140	K	N	561	587
PSM	SPHQLLSPSSFSPSATPSQK	69	sp|Q14181|DPOA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	7-UNIMOD:21	ms_run[1]:scan=19068	84.80454333333333	2	2163.007124	2162.004515	R	Y	141	161
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	70	sp|Q5HYK7|SH319_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=24059	109.26561666666667	3	3065.4187	3065.4200	K	L	268	296
PSM	TTGLSAGVTGTIGLSAGVTGTTR	71	sp|Q7Z5P9|MUC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:21,22-UNIMOD:21,23-UNIMOD:267	ms_run[1]:scan=26475	122.48751999999999	3	2407.959731	2406.975105	R	P	4303	4326
PSM	AAPEASSPPASPLQHLLPGK	72	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22751	102.41	2	2053.0341	2053.0341	K	A	673	693
PSM	AHLTVGQAAAGGSGNLLTER	73	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=16175	71.125	2	2011.9716	2011.9716	R	S	317	337
PSM	ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGR	74	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=19115	85.037	3	3606.6336	3606.6336	R	R	74	114
PSM	FIHQQPQSSSPVYGSSAK	75	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=7874	34.505	2	2026.915	2026.9150	R	T	76	94
PSM	GAGAGHPGAGGAQPPDSPAGVR	76	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=5396	23.477	2	1962.8698	1962.8698	R	T	71	93
PSM	GPPASSPAPAPKFSPVTPK	77	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=13695	59.743	2	1911.9496	1911.9496	R	F	97	116
PSM	GQSTGKGPPQSPVFEGVYNNSR	78	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=14893	65.19	3	2385.0751	2385.0751	R	M	101	123
PSM	IAAPELHKGDSDSEEDEPTK	79	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=9029	39.622	2	2326.9243	2326.9243	K	K	147	167
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	80	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,7-UNIMOD:21,16-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=18106	80.401	3	2754.3222	2754.3222	K	K	761	786
PSM	KVEEEDEEEEEEEEEEEEEEDE	81	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188	ms_run[2]:scan=10612	46.259	3	2804.0146	2804.0146	K	-	179	201
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	82	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=8257	36.322	3	3046.23	3046.2300	K	D	234	260
PSM	KVTLTGDTEDEDSASTSSSLKR	83	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=9425	41.37	3	2486.0463	2486.0463	K	G	1811	1833
PSM	RNLLEDDSDEEEDFFLR	84	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,8-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=27185	126.64	2	2240.9378	2240.9378	R	G	23	40
PSM	SAKSEESLTSLHAVDGDSK	85	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:188,4-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=11399	49.575	2	2051.9451	2051.9451	R	L	354	373
PSM	SGRNDGLLALSSPDAEEPQLPDGTGR	86	sp|O15027-5|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=22741	102.36	3	2731.245	2731.2450	R	E	2242	2268
PSM	SGRNDGLLALSSPDAEEPQLPDGTGR	87	sp|O15027-5|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:267,12-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=22781	102.58	3	2751.2616	2751.2616	R	E	2242	2268
PSM	TDGFAEAIHSPQVAGVPR	88	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=18251	81.049	2	1930.8938	1930.8938	R	F	2146	2164
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	89	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19685	87.984	3	2548.2977	2548.2977	K	T	508	533
PSM	THSTSSSLGSGESPFSR	90	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=9427	41.375	2	1812.7555	1812.7555	R	S	240	257
PSM	SPHQLLSPSSFSPSATPSQK	91	sp|Q14181|DPOA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=19038	84.66435333333334	2	2169.031635	2168.024644	R	Y	141	161
PSM	ASGVAVSDGVIKVFNDMK	92	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=31393	152.47270666666665	2	1957.9228	1957.9215	M	V	2	20
PSM	AAPEASSPPASPLQHLLPGK	93	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=22959	103.49	2	2053.0341	2053.0341	K	A	673	693
PSM	AFGPGLQGGSAGSPARFTIDTK	94	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=20317	90.906	2	2214.047	2214.0470	K	G	1072	1094
PSM	FIHQQPQSSSPVYGSSAK	95	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=7903	34.657	2	2032.9351	2032.9351	R	T	76	94
PSM	GRNAPAAVDEGSISPR	96	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,14-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7067	30.993	2	1695.7844	1695.7845	R	T	371	387
PSM	GRNAPAAVDEGSISPR	97	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=7100	31.11	2	1675.7679	1675.7679	R	T	371	387
PSM	IHIDPEIQDGSPTTSR	98	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=12852	55.891	2	1844.8306	1844.8306	R	R	102	118
PSM	KLEKEEEEGISQESSEEEQ	99	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,4-UNIMOD:188,14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5845	25.351	2	2407.9596	2407.9596	K	-	89	108
PSM	LASPVAPGALTTPGGSAPAQVVHTQPPPR	100	sp|Q96L91-4|EP400_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=18172	80.7	3	2863.4621	2863.4621	R	A	2537	2566
PSM	LREQDCGEPASPAASISR	101	sp|O60353-2|FZD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8202	36.07	2	2022.883	2022.8830	R	L	578	596
PSM	NHLSPQQGGATPQVPSPCCR	102	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=10983	47.865	2	2279.9805	2279.9805	K	F	166	186
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	103	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=14922	65.309	3	3106.2061	3106.2061	K	N	561	587
PSM	RNLLEDDSDEEEDFFLR	104	sp|O75379|VAMP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=27178	126.59	2	2220.9212	2220.9212	R	G	23	40
PSM	SGLAFSRPSQLSTPAASPSASEPR	105	sp|Q5XUX1-3|FBXW9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=17166	75.884	3	2480.1697	2480.1697	K	A	43	67
PSM	SPLELGEKLSPLPGGPGAGDPR	106	sp|Q15742-2|NAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=21221	95.006	3	2223.0937	2223.0937	K	I	162	184
PSM	THSTSSSLGSGESPFSR	107	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=11088	48.289	2	1802.7472	1802.7472	R	S	240	257
PSM	VAAAAGSGPSPPGSPGHDR	108	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=4092	18.141	2	1766.7737	1766.7737	R	E	38	57
PSM	YLSFTPPEKDGFPSGTPALNAK	109	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=24336	110.7	2	2416.1352	2416.1352	K	G	139	161
PSM	QHEAPSNRPLNELLTPQGPSPR	110	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19668	87.91008166666667	3	2520.2010	2520.2020	R	T	167	189
PSM	ALNHSVEDIEPDLLTPR	111	sp|Q8IWR0|Z3H7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=20931	93.686	2	2007.9542	2007.9542	K	Q	196	213
PSM	ASNTSTPTKGNTETSASASQTNHVK	112	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=1488	7.6294	3	2598.1559	2598.1559	K	D	489	514
PSM	DASDDLDDLNFFNQKK	113	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24511	111.75	2	1883.8537	1883.8537	K	K	65	81
PSM	DASDDLDDLNFFNQKK	114	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24709	112.76	2	1883.8537	1883.8537	K	K	65	81
PSM	DLEAEHVEVEDTTLNR	115	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15139	66.331	2	1868.8752	1868.8752	R	C	15	31
PSM	FFIPKSPTSSNEPENR	116	sp|Q9NQ86-4|TRI36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=14205	62.104	2	1928.867	1928.8670	K	V	631	647
PSM	FNEEHIPDSPFVVPVASPSGDAR	117	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=26000	119.77	2	2546.1479	2546.1479	K	R	2303	2326
PSM	GLLYDSDEEDEERPAR	118	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=13449	58.67	2	1972.8051	1972.8051	R	K	134	150
PSM	HASPILPITEFSDIPR	119	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=27528	128.72	2	1871.9183	1871.9183	K	R	304	320
PSM	HASPILPITEFSDIPR	120	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=27361	127.71	2	1871.9183	1871.9183	K	R	304	320
PSM	HQQQLLASPGSSTVDNK	121	sp|Q9C0E2|XPO4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=9243	40.518	2	1888.868	1888.8680	R	M	514	531
PSM	IHAESLLLDSPAVAK	122	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=18622	82.729	2	1648.8533	1648.8533	R	S	370	385
PSM	IHIDPEIQDGSPTTSR	123	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=13055	56.905	2	1844.8306	1844.8306	R	R	102	118
PSM	ILQEKLDQPVSAPPSPR	124	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=13858	60.463	2	1953.9925	1953.9925	R	D	230	247
PSM	KFQEQECPPSPEPTR	125	sp|P62070-2|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=6578	28.773	2	1908.8077	1908.8077	R	K	100	115
PSM	KGGEFDEFVNDDTDDDLPISK	126	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=22966	103.51	2	2435.0054	2435.0054	K	K	913	934
PSM	KLDFNSPGGSSPVENSDCSTNSR	127	sp|Q9Y2F5|ICE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=11482	49.895	3	2534.0381	2534.0381	R	L	934	957
PSM	KLEKEEEEGISQESSEEEQ	128	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6332	27.571	2	2395.9193	2395.9193	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	129	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=7010	30.781	2	2395.9193	2395.9193	K	-	89	108
PSM	KLSLGQYDNDAGGQLPFSK	130	sp|Q68CZ2-2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,3-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=22809	102.71	2	2129.0233	2129.0233	R	C	534	553
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	131	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=18307	81.321	3	2742.2819	2742.2819	K	K	761	786
PSM	KRSVAVSDEEEVEEEAER	132	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=13419	58.523	2	2249.909	2249.9090	R	R	675	693
PSM	KTSEEEKNGSEELVEK	133	sp|Q9H0C8|ILKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:188,3-UNIMOD:21,7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=3479	15.376	2	1932.9063	1932.9063	R	K	80	96
PSM	LRPISDDSESIEESDTR	134	sp|Q71F23-3|CENPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=11586	50.388	2	2027.8685	2027.8685	K	R	132	149
PSM	NHLSPQQGGATPQVPSPCCR	135	sp|Q9H4L4|SENP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=10958	47.752	2	2269.9722	2269.9722	K	F	166	186
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	136	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=14672	64.253	3	3106.2061	3106.2061	K	N	561	587
PSM	RADLNQGIGEPQSPSR	137	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,15-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7372	32.07	2	1823.843	1823.8430	R	R	62	78
PSM	RGPNYTSGYGTNSELSNPSETESER	138	sp|P51114-3|FXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:21	ms_run[2]:scan=12188	53.023	3	2811.1621	2811.1621	R	K	306	331
PSM	RIDFIPVSPAPSPTR	139	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,8-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=21917	98.374	2	1831.8538	1831.8538	K	G	136	151
PSM	RLSNSSLCSIEEEHR	140	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,6-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=12173	52.953	2	1995.8026	1995.8026	R	M	371	386
PSM	RTAFYNEDDSEEEQR	141	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=7978	35.036	2	1967.7534	1967.7534	R	Q	1774	1789
PSM	RTAFYNEDDSEEEQR	142	sp|Q8WWQ0|PHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,10-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=8012	35.21	2	1987.77	1987.7700	R	Q	1774	1789
PSM	SDKSPDLAPTPAPQSTPR	143	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=8604	37.898	2	1943.899	1943.8990	R	N	289	307
PSM	SLPAPVAQRPDSPGGGLQAPGQK	144	sp|Q5JVS0-2|HABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=13984	61.01	2	2307.1373	2307.1373	K	R	97	120
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	145	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=11868	51.701	3	2696.2583	2696.2583	R	R	207	233
PSM	STTPPPAEPVSLPQEPPKPR	146	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=14290	62.486	2	2204.0878	2204.0878	K	V	225	245
PSM	THSTSSSLGSGESPFSR	147	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=9419	41.348	2	1802.7472	1802.7472	R	S	240	257
PSM	TKEYVSNDAAQSDDEEKLQSQPTDTDGGR	148	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=9423	41.365	3	3263.3739	3263.3739	R	L	392	421
PSM	TPADRGPSPAPAPAASPQPGSR	149	sp|Q8IX07|FOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:267,8-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=5405	23.518	2	2184.0228	2184.0228	R	G	894	916
PSM	TPHDILEDINASPEMR	150	sp|Q9Y6Q9-4|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=21181	94.83	2	1926.8422	1926.8422	K	Q	203	219
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	151	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21	ms_run[2]:scan=10355	45.257	3	2919.2268	2919.2268	R	S	2860	2891
PSM	VAAAAGSGPSPPGSPGHDR	152	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=3943	17.438	2	1776.782	1776.7820	R	E	38	57
PSM	VAAAAGSGPSPPGSPGHDR	153	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=4172	18.509	2	1776.782	1776.7820	R	E	38	57
PSM	SPLELGEKLSPLPGGPGAGD	154	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	10-UNIMOD:21	ms_run[1]:scan=23051	103.928735	2	1969.9402	1969.9393	K	P	162	182
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	155	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21	ms_run[1]:scan=23260	104.965655	3	3096.564981	3095.580500	R	A	655	686
PSM	GDVTAEEAAGASPAKANGQENGHVK	156	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:21	ms_run[1]:scan=4989	21.674276666666668	3	2488.087231	2487.102725	R	S	11	36
PSM	GQSTGKGPPQSPVFEGVYNNSR	157	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:188,11-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=15200	66.61488	3	2402.104983	2401.103452	R	M	101	123
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	158	sp|P25440|BRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	17-UNIMOD:21	ms_run[1]:scan=20348	91.05436999999999	3	2782.387632	2781.383758	R	A	282	310
PSM	GDVTAEEAAGASPAKANGQENGHVK	159	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:21,15-UNIMOD:188,25-UNIMOD:188	ms_run[1]:scan=6053	26.228918333333336	2	2500.123349	2499.142983	R	S	11	36
PSM	GDVTAEEAAGASPAKANGQENGHVKSNGDLSPK	160	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:21,15-UNIMOD:188,25-UNIMOD:188,26-UNIMOD:21,33-UNIMOD:188	ms_run[1]:scan=8704	38.33947	3	3383.511019	3383.516625	R	G	11	44
PSM	AAPEASSPPASPLQHLLPGK	161	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=21184	94.845	2	2047.014	2047.0140	K	A	673	693
PSM	AEPYVASEYKTVHEELTK	162	sp|Q9BZ29-6|DOCK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=19714	88.12	2	2172.998	2172.9980	K	S	920	938
PSM	ATNESEDEIPQLVPIGKK	163	sp|O76021-2|RL1D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=20501	91.727	2	2046.9875	2046.9875	K	T	137	155
PSM	AVTIANSPSKPSEKDSVVSLESQK	164	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=13345	58.214	3	2580.2684	2580.2684	K	T	197	221
PSM	AVTIANSPSKPSEKDSVVSLESQK	165	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=13066	56.952	2	2580.2684	2580.2684	K	T	197	221
PSM	DASDDLDDLNFFNQKK	166	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=24909	113.79	2	1883.8537	1883.8537	K	K	65	81
PSM	DRPGSPESPLLDAPFSR	167	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=22048	99.018	2	1919.8779	1919.8779	R	A	906	923
PSM	GRASSHSSQTQGGGSVTK	168	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=684	5.0931	2	1890.7622	1890.7622	R	K	301	319
PSM	HASPILPITEFSDIPR	169	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=27513	128.63	2	1881.9265	1881.9265	K	R	304	320
PSM	HSPIAPSSPSPQVLAQK	170	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=12441	54.131	2	1822.8979	1822.8979	R	Y	305	322
PSM	HSQQLFPDGSPGDQWVK	171	sp|Q8IU60-2|DCP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21065	94.291	2	2010.8932	2010.8932	R	H	275	292
PSM	HSYPPALGSPGALAGAGVGAAGPLER	172	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=23038	103.86	3	2462.1983	2462.1983	R	R	229	255
PSM	HTGPNSPDTANDGFVR	173	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=8063	35.471	2	1773.7347	1773.7347	K	L	99	115
PSM	ILQEKLDQPVSAPPSPR	174	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=13557	59.168	2	1953.9925	1953.9925	R	D	230	247
PSM	IPGGNIYISPLKSPYK	175	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=21051	94.235	2	1837.9782	1837.9782	R	I	799	815
PSM	KAVPMAPAPASPGSSNDSSAR	176	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=7105	31.121	2	2076.93	2076.9300	R	S	723	744
PSM	KLEKEEEEGISQESSEEEQ	177	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6535	28.58	2	2395.9193	2395.9193	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	178	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=6802	29.77	2	2395.9193	2395.9193	K	-	89	108
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	179	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[2]:scan=15761	69.211	3	2717.3078	2717.3078	R	R	31	56
PSM	KTEFLDLDNSPLSPPSPR	180	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=24252	110.24	2	2091.9878	2091.9878	K	T	189	207
PSM	LKQLMEQDASSSPSAQVIGLK	181	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=18882	83.965	3	2309.1338	2309.1338	K	N	330	351
PSM	LREQGTESRSSTPLPTISSSAENTR	182	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=11840	51.566	2	2863.275	2863.2750	K	Q	149	174
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	183	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14671	64.25	3	3116.2144	3116.2144	K	N	561	587
PSM	NKPGPNIESGNEDDDASFK	184	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=10412	45.481	3	2112.8637	2112.8637	K	I	206	225
PSM	RFSDSEGEETVPEPR	185	sp|Q13286-5|CLN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,5-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=10409	45.465	2	1833.7685	1833.7685	R	L	10	25
PSM	RFSEGVLQSPSQDQEK	186	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=11023	48.02	2	1913.852	1913.8520	R	L	427	443
PSM	SCPPPGGSWGSGRSSPLLGGNGK	187	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=14873	65.109	2	2291.0154	2291.0154	R	A	51	74
PSM	SFGTRPLSSGFSPEEAQQQDEEFEK	188	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=21048	94.221	3	2909.2393	2909.2393	R	K	976	1001
PSM	SGKSPSPSPTSPGSLRK	189	sp|O15075-3|DCLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=4347	19.226	2	1828.8122	1828.8122	R	Q	20	37
PSM	SGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKK	190	sp|Q7Z2E3-13|APTX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,30-UNIMOD:4	ms_run[2]:scan=20191	90.311	3	3725.6476	3725.6476	R	G	118	154
PSM	SGQGFHGNSEVNAILSPR	191	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=17660	78.192	2	1958.8875	1958.8875	R	S	67	85
PSM	SHVTEEEEEEEEEESDS	192	sp|O75971-2|SNPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5467	23.802	2	2021.7345	2021.7345	K	-	52	69
PSM	SKGFGFVCFSSPEEATK	193	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,8-UNIMOD:4,11-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=22900	103.19	2	1968.8731	1968.8731	R	A	332	349
PSM	SLFSVESDDTDTENERR	194	sp|Q9Y561-2|LRP12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,16-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=14723	64.46	2	2098.8595	2098.8595	R	D	627	644
PSM	SRQELASGLPSPAATQELPVER	195	sp|O95359-3|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,11-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=19656	87.851	3	2435.1961	2435.1961	R	A	1552	1574
PSM	STTPPPAEPVSLPQEPPKPR	196	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=14735	64.503	2	2204.0878	2204.0878	K	V	225	245
PSM	TPADRGPSPAPAPAASPQPGSR	197	sp|Q8IX07|FOG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:267,8-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=5341	23.226	3	2184.0228	2184.0228	R	G	894	916
PSM	TRTPASINATPANINLADLTR	198	sp|Q7KZ85-2|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=22563	101.51	3	2289.1478	2289.1478	R	A	349	370
PSM	VKAQTPPGPSLSGSKSPCPQEK	199	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,5-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7578	32.948	3	2457.151	2457.1510	K	S	999	1021
PSM	VKLGSPDSTSPSSSPTFWNYSR	200	sp|Q96SK2-3|TM209_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=20755	92.888	3	2479.1057	2479.1057	R	S	256	278
PSM	VSIRLPSTSGSEGVPFR	201	sp|P29317|EPHA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:267,7-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=21926	98.415	3	1887.9359	1887.9359	R	T	891	908
PSM	WKSEEEVESDDEYLALPAR	202	sp|Q76N32-2|CEP68_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=20779	93.002	2	2345.0101	2345.0101	R	L	470	489
PSM	DASDDLDDLNFFNQKK	203	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=24972	114.09573166666667	2	1884.845061	1883.853737	K	K	65	81
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	204	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=18212	80.87245666666666	3	2336.013715	2336.011742	R	S	38	64
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	205	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=15180	66.51996	3	3117.197680	3116.214409	K	N	561	587
PSM	SGGGGGGGFGRVSLAGACGVGGYGSR	206	sp|P13647|K2C5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	13-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=18001	79.88002833333333	2	2336.011724	2336.011742	R	S	38	64
PSM	ADHRSSPNVANQPPSPGGK	207	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=2574	11.83	2	2074.8623	2074.8623	R	S	1152	1171
PSM	AHLTVGQAAAGGSGNLLTER	208	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=16399	72.178	2	2011.9716	2011.9716	R	S	317	337
PSM	APVPEPGLDLSLSPRPDSPQPR	209	sp|Q8TAP8|PPR35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:21	ms_run[2]:scan=21651	97.124	3	2404.1788	2404.1788	R	H	35	57
PSM	ASSPIKQSHEPVPDTSVEK	210	sp|Q9ULM3|YETS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,6-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=7387	32.132	2	2127.0288	2127.0288	K	G	365	384
PSM	DASDDLDDLNFFNQKK	211	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=24515	111.76	2	1895.894	1895.8940	K	K	65	81
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	212	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=15337	67.268	3	3044.152	3044.1520	K	L	595	622
PSM	DYDEEEQGYDSEKEKK	213	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=3257	14.588	2	2070.7943	2070.7943	R	E	423	439
PSM	ERSPALKSPLQSVVVR	214	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=16427	72.291	2	1924.9537	1924.9537	R	R	246	262
PSM	EVAEGGLPRAESPSPAPPPGLR	215	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:267,12-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=15375	67.444	3	2283.1163	2283.1163	R	G	297	319
PSM	FTDKDQQPSGSEGEDDDAEAALKK	216	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10150	44.453	3	2740.079	2740.0790	K	E	78	102
PSM	GLRDSHSSEEDEASSQTDLSQTISK	217	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12895	56.09	3	2866.1543	2866.1543	R	K	150	175
PSM	HGSFHEDEDPIGSPR	218	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=10338	45.194	2	1838.6662	1838.6662	R	L	1266	1281
PSM	HIISATSLSTSPTELGSR	219	sp|Q5JSZ5-5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=16288	71.655	3	1945.9386	1945.9386	R	N	216	234
PSM	HPASLTSSGSSGSPSSSIK	220	sp|Q9C0D5-2|TANC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=5576	24.224	2	1858.8405	1858.8405	R	M	1550	1569
PSM	HTGPNSPDTANDGFVR	221	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=8289	36.48	2	1773.7347	1773.7347	K	L	99	115
PSM	IAEFTTNLTEEEEKSK	222	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=14836	64.945	2	1879.9454	1879.9454	R	S	1001	1017
PSM	IHAESLLLDSPAVAK	223	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,15-UNIMOD:188	ms_run[2]:scan=18723	83.162	2	1648.8533	1648.8533	R	S	370	385
PSM	KATSTSTSGAGDVGKEALSGGEASLVEK	224	sp|Q96T17|MA7D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,3-UNIMOD:21,15-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=16588	73.13	3	2734.3408	2734.3408	K	V	228	256
PSM	KLEKEEEEGISQESSEEEQ	225	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5374	23.383	2	2395.9193	2395.9193	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	226	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5882	25.549	2	2395.9193	2395.9193	K	-	89	108
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	227	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,6-UNIMOD:21,16-UNIMOD:188,23-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=15643	68.679	3	2735.3682	2735.3682	R	R	31	56
PSM	PGPTPSGTNVGSSGRSPSK	228	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=2616	11.972	2	1848.8367	1848.8367	M	A	2	21
PSM	RASPPVSPIPVSEYCESENKWSQEK	229	sp|Q2M2Z5-5|KIZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=19461	86.899	3	3063.3086	3063.3086	K	H	182	207
PSM	RIDFIPVSPAPSPTR	230	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=21923	98.402	2	1811.8373	1811.8373	K	G	136	151
PSM	RIDFTPVSPAPSPTR	231	sp|Q7Z309-5|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=16000	70.35	2	1799.8009	1799.8009	K	G	55	70
PSM	RQEQPSIESTSPISR	232	sp|Q5T5P2|SKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,11-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=9020	39.585	2	1813.8474	1813.8474	R	T	1640	1655
PSM	SCPPPGGSWGSGRSSPLLGGNGK	233	sp|Q9C075|K1C23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=14597	63.914	2	2291.0154	2291.0154	R	A	51	74
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	234	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,18-UNIMOD:21,29-UNIMOD:188	ms_run[2]:scan=18058	80.165	3	3165.3676	3165.3677	R	G	2020	2049
PSM	SNSAPLIHGLSDTSPVFQAEAPSAR	235	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=24673	112.57	3	2631.233	2631.2330	R	R	35	60
PSM	SPPVLGSAAASPVHLK	236	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=15230	66.761	2	1615.843	1615.8430	K	S	907	923
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	237	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=11789	51.325	2	2696.2583	2696.2583	R	R	207	233
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	238	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=33217	162.83	3	2696.2583	2696.2583	R	R	207	233
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	239	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=12155	52.889	3	2686.2501	2686.2501	R	R	207	233
PSM	TDSREDEISPPPPNPVVK	240	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=12257	53.32	2	2055.9514	2055.9514	R	G	75	93
PSM	TDSREDEISPPPPNPVVK	241	sp|P10644-2|KAP0_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=12500	54.421	2	2055.9514	2055.9514	R	G	75	93
PSM	THSTSSSLGSGESPFSR	242	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=11495	49.956	2	1812.7555	1812.7555	R	S	240	257
PSM	TPGGLCRISASGPESLLGGPGGASAAPAAGSK	243	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=22276	100.1	3	2930.3957	2930.3957	R	V	103	135
PSM	VESGDPSLHPPPSPGTPSATPASPPASATPSQR	244	sp|Q4KMQ1|TPRN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	23-UNIMOD:21	ms_run[2]:scan=13243	57.773	3	3256.5038	3256.5038	K	Q	252	285
PSM	VGSLDNVGHLPAGGAVK	245	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=15255	66.881	2	1669.8189	1669.8189	K	T	729	746
PSM	SPLELGEKLSPLPGGPGAGD	246	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	8-UNIMOD:188,10-UNIMOD:21	ms_run[1]:scan=23081	104.069345	2	1975.9605	1975.9594	K	P	162	182
PSM	DASDDLDDLNFFNQKK	247	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[1]:scan=25012	114.31072666666667	2	1895.882945	1895.893995	K	K	65	81
PSM	DASDDLDDLNFFNQKK	248	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=25164	115.10820166666666	2	1884.846812	1883.853737	K	K	65	81
PSM	IPCESPPLEVVDTTASTKR	249	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=17620	77.98725166666667	3	2180.027618	2179.023201	K	H	2704	2723
PSM	HGSGADSDYENTQSGDPLLGLEGKR	250	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=19755	88.31785166666667	3	2764.127905	2762.122214	R	F	590	615
PSM	QAPAPTVIRDPPSITPAVKSPLPGPSEEK	251	sp|Q13112|CAF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,9-UNIMOD:267,19-UNIMOD:188,20-UNIMOD:21,29-UNIMOD:188	ms_run[1]:scan=21544	96.52915333333333	3	3063.5961	3063.5955	R	T	439	468
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK	252	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:21	ms_run[1]:scan=26474	122.48391666666667	4	4931.349807	4931.348895	R	H	475	524
PSM	HGSFHEDEDPIGSPR	253	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:267	ms_run[1]:scan=10394	45.41097833333333	2	1848.674066	1848.674493	R	L	1266	1281
PSM	SGKNSQEDSEDSEDKDVK	254	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	5-UNIMOD:21	ms_run[1]:scan=913	5.804451666666667	2	2076.806217	2075.816833	R	T	50	68
PSM	TSAGWTSRTSLPCPTLASLR	255	sp|Q9NW81-2|DMAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,7-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=18746	83.292935	3	2403.021585	2400.993980	R	Y	119	139