MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH11.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH11.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	null	19-UNIMOD:21	0.07	60.0	1	1	1
PRT	sp|Q2M2I8-2|AAK1_HUMAN	Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	9-UNIMOD:267,21-UNIMOD:21,37-UNIMOD:267,18-UNIMOD:21	0.03	54.0	2	1	0
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	87-UNIMOD:21,92-UNIMOD:267	0.06	51.0	3	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	242-UNIMOD:4,250-UNIMOD:21,257-UNIMOD:188	0.03	51.0	4	1	0
PRT	sp|Q92551-2|IP6K1_HUMAN	Isoform 2 of Inositol hexakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=IP6K1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	207-UNIMOD:4,212-UNIMOD:21	0.12	51.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	77-UNIMOD:267,90-UNIMOD:21,113-UNIMOD:267	0.04	50.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	50.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	50.0	2	1	0
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	127-UNIMOD:21	0.05	49.0	1	1	1
PRT	sp|Q96T17|MA7D2_HUMAN	MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	233-UNIMOD:21	0.04	48.0	1	1	1
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	169-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.04	48.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	576-UNIMOD:21,586-UNIMOD:267	0.03	48.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188	0.04	48.0	3	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,28-UNIMOD:21,39-UNIMOD:267	0.03	47.0	2	1	0
PRT	sp|Q15742|NAB2_HUMAN	NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	169-UNIMOD:188,171-UNIMOD:21	0.04	47.0	2	1	0
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	108-UNIMOD:188,110-UNIMOD:21,115-UNIMOD:188	0.05	46.0	4	1	0
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	624-UNIMOD:21,623-UNIMOD:21,629-UNIMOD:188	0.03	46.0	2	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	226-UNIMOD:21	0.01	46.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	230-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	1173-UNIMOD:21	0.02	46.0	1	1	1
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	46.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	46.0	1	1	1
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	38-UNIMOD:188	0.11	45.0	2	1	0
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.04	45.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	204-UNIMOD:21	0.05	45.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	88-UNIMOD:21	0.03	44.0	1	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	22-UNIMOD:21,25-UNIMOD:188,35-UNIMOD:188	0.13	44.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2779-UNIMOD:21,2780-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	214-UNIMOD:21,207-UNIMOD:188,224-UNIMOD:188	0.02	44.0	2	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	827-UNIMOD:188,830-UNIMOD:21,843-UNIMOD:188	0.03	44.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	678-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1157-UNIMOD:21,1166-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	532-UNIMOD:21,534-UNIMOD:188,539-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	366-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	612-UNIMOD:21,634-UNIMOD:4	0.04	43.0	1	1	1
PRT	sp|Q6IQ23-3|PKHA7_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	116-UNIMOD:4,119-UNIMOD:21,127-UNIMOD:267	0.03	43.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	247-UNIMOD:21	0.10	43.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	367-UNIMOD:188,370-UNIMOD:21,386-UNIMOD:4,388-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|Q16555-2|DPYL2_HUMAN	Isoform 2 of Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	486-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	846-UNIMOD:21,847-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1384-UNIMOD:21,1389-UNIMOD:4	0.01	42.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	813-UNIMOD:188,829-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	20-UNIMOD:188,21-UNIMOD:21,36-UNIMOD:4,37-UNIMOD:188	0.02	42.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	292-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	308-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9BXB5|OSB10_HUMAN	Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	201-UNIMOD:21,203-UNIMOD:4,206-UNIMOD:267	0.03	42.0	2	1	0
PRT	sp|Q14181|DPOA2_HUMAN	DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	152-UNIMOD:21,160-UNIMOD:188	0.04	42.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	207-UNIMOD:21,232-UNIMOD:267	0.07	42.0	1	1	1
PRT	sp|Q8WYK2|JDP2_HUMAN	Jun dimerization protein 2 OS=Homo sapiens OX=9606 GN=JDP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	148-UNIMOD:21	0.13	42.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1010-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	121-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	453-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	42.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	85-UNIMOD:21	0.03	42.0	1	1	0
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	365-UNIMOD:21,391-UNIMOD:21	0.03	42.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	3-UNIMOD:21	ms_run[2]:scan=7336	32.8	3	2739.1634	2739.1634	R	A	17	51
PSM	REQGGSGLGSGSSGGGGSTSGLGSGYIGR	2	sp|Q2M2I8-2|AAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	1-UNIMOD:267,13-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=13021	58.699	3	2641.1633	2641.1633	R	V	9	38
PSM	GAGAGHPGAGGAQPPDSPAGVR	3	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	17-UNIMOD:21	ms_run[2]:scan=5682	25.448	2	1962.8698	1962.8698	R	T	71	93
PSM	HGGVCAPAAVATSPPGAIPK	4	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=13611	61.367	2	1936.923	1936.9230	R	E	238	258
PSM	HLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPK	5	sp|Q92551-2|IP6K1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	13-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=20473	93.583	3	3430.5058	3430.5058	K	V	195	228
PSM	HGGVCAPAAVATSPPGAIPK	6	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=13481	60.79064666666667	2	1937.921061	1936.923034	R	E	238	258
PSM	ESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGR	7	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	4-UNIMOD:267,17-UNIMOD:21,40-UNIMOD:267	ms_run[2]:scan=18797	85.702	3	3626.6501	3626.6501	R	R	74	114
PSM	REQGGSGLGSGSSGGGGSTSGLGSGYIGR	8	sp|Q2M2I8-2|AAK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	10-UNIMOD:21	ms_run[2]:scan=13028	58.736	3	2621.1467	2621.1467	R	V	9	38
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	9	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=8039	36.037773333333334	3	3007.3299	3007.3290	K	S	145	174
PSM	RSSPAAFINPPIGTVTPALK	10	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21	ms_run[2]:scan=23650	109.46	2	2116.1082	2116.1082	K	L	125	145
PSM	HGGVCAPAAVATSPPGAIPK	11	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=13779	62.066	2	1936.923	1936.9230	R	E	238	258
PSM	KATSTSTSGAGDVGKEALSGGEASLVEK	12	sp|Q96T17|MA7D2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:21	ms_run[2]:scan=16381	74.405	3	2716.2804	2716.2804	K	V	228	256
PSM	NHLSPQQGGATPQVPSPCCR	13	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	4-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=11189	49.838	2	2279.9805	2279.9805	K	F	166	186
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	14	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=14451	65.481	3	3116.2144	3116.2144	K	N	561	587
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	15	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23099	106.54613666666667	3	3112.592836	3111.608898	R	A	655	686
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	16	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11311	50.317	3	3088.156	3088.1560	R	A	10	40
PSM	HGGVCAPAAVATSPPGAIPK	17	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:4,13-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=13633	61.464	2	1942.9432	1942.9432	R	E	238	258
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	18	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	2-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:21,30-UNIMOD:267	ms_run[1]:scan=11348	50.51686333333333	3	3100.188497	3098.164305	R	A	10	40
PSM	SPLELGEKLSPLPGGPGAGD	19	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	8-UNIMOD:188,10-UNIMOD:21	ms_run[1]:scan=22676	104.39088000000001	2	1975.9592	1975.9594	K	P	162	182
PSM	SPLELGEKLSPLPGGPGAGD	20	sp|Q15742|NAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	10-UNIMOD:21	ms_run[1]:scan=22655	104.2818	2	1969.9400	1969.9393	K	P	162	182
PSM	GAGAGHPGAGGAQPPDSPAGVR	21	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=5471	24.473	2	1972.878	1972.8780	R	T	71	93
PSM	GAGAGHPGAGGAQPPDSPAGVR	22	sp|Q13884-2|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=5687	25.482	2	1972.878	1972.8780	R	T	71	93
PSM	GPPASSPAPAPKFSPVTPK	23	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13111	59.152	2	1923.9898	1923.9898	R	F	97	116
PSM	HGSGPNIILTGDSSPGFSK	24	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:21	ms_run[2]:scan=17182	78.211	2	1949.8884	1949.8884	R	E	611	630
PSM	HIISATSLSTSPTELGSR	25	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:21	ms_run[2]:scan=16049	72.821	2	1935.9303	1935.9303	R	N	216	234
PSM	HYEDGYPGGSDNYGSLSR	26	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:21	ms_run[2]:scan=11744	52.368	2	2052.7851	2052.7851	R	V	216	234
PSM	LKPGGVGAPSSSSPSPSPSAR	27	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:21	ms_run[2]:scan=6863	30.932	2	2001.9521	2001.9521	K	P	1159	1180
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	28	sp|Q9ULU4-19|PKCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=19391	88.486	3	2548.2977	2548.2977	K	T	508	533
PSM	QHEAPSNRPLNELLTPQGPSPR	29	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=19248	87.82868666666667	3	2520.2024	2520.2020	R	T	167	189
PSM	DHDDAAESLIEQTTALNK	30	sp|Q9NVK5-3|FGOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=21428	98.095	2	1969.9229	1969.9229	R	R	21	39
PSM	DHDDAAESLIEQTTALNK	31	sp|Q9NVK5-3|FGOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:188	ms_run[2]:scan=21436	98.137	2	1975.943	1975.9430	R	R	21	39
PSM	KPEEEEEEELEETAQEK	32	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11908	53.204	2	2074.9066	2074.9066	R	K	62	79
PSM	KTEFLDLDNSPLSPPSPR	33	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21	ms_run[2]:scan=23992	111.26	2	2091.9878	2091.9878	K	T	189	207
PSM	FIHQQPQSSSPVYGSSAK	34	sp|P49023-2|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=6644	29.968	2	2026.915	2026.9150	R	T	76	94
PSM	GDVTAEEAAGASPAKANGQENGHVK	35	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21,15-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5374	24.09	2	2499.143	2499.1430	R	S	11	36
PSM	GPPASSPAPAPKFSPVTPK	36	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:188,14-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=13372	60.344	2	1923.9898	1923.9898	R	F	97	116
PSM	HGSGPNIILTGDSSPGFSK	37	sp|Q53ET0|CRTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=17166	78.147	2	1955.9086	1955.9086	R	E	611	630
PSM	KQHYLSSEDEPDDNPDVLDSR	38	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=15488	70.238	3	2618.0211	2618.0211	R	I	2774	2795
PSM	NKPGPNIESGNEDDDASFK	39	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	9-UNIMOD:21	ms_run[2]:scan=10310	45.718	2	2112.8637	2112.8637	K	I	206	225
PSM	STAQQELDGKPASPTPVIVASHTANK	40	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:188,13-UNIMOD:21,26-UNIMOD:188	ms_run[2]:scan=12264	55.098	3	2738.3679	2738.3679	R	E	818	844
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	41	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	11-UNIMOD:21	ms_run[1]:scan=23087	106.48540166666666	3	3096.565587	3095.580500	R	A	655	686
PSM	AAPEASSPPASPLQHLLPGK	42	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21	ms_run[2]:scan=22461	103.25	2	2047.014	2047.0140	K	A	673	693
PSM	ADHRSSPNVANQPPSPGGK	43	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=2564	11.842	2	2074.8623	2074.8623	R	S	1152	1171
PSM	AQGEPVAGHESPKIPYEK	44	sp|O94979-7|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=10375	46.033	2	2027.9756	2027.9756	R	Q	522	540
PSM	FASDDEHDEHDENGATGPVK	45	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=5556	24.781	2	2248.8546	2248.8546	K	R	364	384
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	46	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=16097	73.05	3	2762.2735	2762.2735	K	Q	609	638
PSM	HGSPTAPICLGSPEFTDQGR	47	sp|Q6IQ23-3|PKHA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=18933	86.3	2	2215.9597	2215.9597	R	S	108	128
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	48	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=8188	36.706	3	3046.23	3046.2300	K	D	234	260
PSM	STLESEKPGSPEAAETSPPSNIIDHCEK	49	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	7-UNIMOD:188,10-UNIMOD:21,26-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=14272	64.596	3	3101.3939	3101.3939	K	L	361	389
PSM	TVTPASSAKTSPAKQQAPPVR	50	sp|Q16555-2|DPYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:21	ms_run[2]:scan=4846	21.975	2	2201.1205	2201.1205	K	N	476	497
PSM	YGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	51	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	19-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=10797	48.108	3	3492.3992	3492.3992	R	I	828	862
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	52	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=23609	109.24011000000002	3	3112.592029	3111.608898	R	A	655	686
PSM	GPPASSPAPAPKFSPVTPK	53	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=13115	59.171	2	1911.9496	1911.9496	R	F	97	116
PSM	GPPASSPAPAPKFSPVTPK	54	sp|Q15942-2|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21	ms_run[2]:scan=13347	60.248	2	1911.9496	1911.9496	R	F	97	116
PSM	KDDPVTNLNNAFEVAEK	55	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=20130	92.003	2	1902.9323	1902.9323	R	Y	217	234
PSM	KGSSSSVCSVASSSDISLGSTKTER	56	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=12525	56.36	3	2596.1688	2596.1688	R	R	1382	1407
PSM	KSAEIDSDDTGGSAAQK	57	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=1541	7.9432	2	1690.8048	1690.8048	K	Q	813	830
PSM	KTSDANETEDHLESLICK	58	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,2-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:188	ms_run[2]:scan=18959	86.414	2	2180.97	2180.9700	R	V	20	38
PSM	NHSVNEEEQEEQGEGSEDEWEQVGPR	59	sp|Q14694|UBP10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=14441	65.432	3	3106.2061	3106.2061	K	N	561	587
PSM	NKPGPNIESGNEDDDASFK	60	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10320	45.777	2	2124.904	2124.9040	K	I	206	225
PSM	SDKSPDLAPTPAPQSTPR	61	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=8578	38.436	2	1943.899	1943.8990	R	N	289	307
PSM	SGGSGHAVAEPASPEQELDQNKGK	62	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=8858	39.564	2	2472.0918	2472.0918	K	G	296	320
PSM	SLTLLPHGTPNSASPCSQR	63	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=15244	69.043	2	2101.9616	2101.9616	R	H	188	207
PSM	SLTLLPHGTPNSASPCSQR	64	sp|Q9BXB5|OSB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:21,16-UNIMOD:4,19-UNIMOD:267	ms_run[2]:scan=15260	69.109	2	2111.9699	2111.9699	R	H	188	207
PSM	SPHQLLSPSSFSPSATPSQK	65	sp|Q14181|DPOA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=16128	73.183	2	2168.0246	2168.0246	R	Y	141	161
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	66	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=11598	51.693	3	2696.2583	2696.2583	R	R	207	233
PSM	TDSVKTPESEGNPLLEQLEKK	67	sp|Q8WYK2|JDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=20803	95.092	3	2421.1676	2421.1676	R	-	143	164
PSM	TPSIQPSLLPHAAPFAK	68	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=22470	103.29	2	1853.9441	1853.9441	R	S	1010	1027
PSM	VTKNEEPSEEEIDAPKPK	69	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=6879	31.001	2	2118.9722	2118.9722	K	K	114	132
PSM	VVSPTKEQVSDTEDKQR	70	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=3763	16.626	2	2024.9416	2024.9416	R	M	451	468
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	71	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20948	95.795215	3	3442.4013	3442.4027	K	L	104	135
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	72	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	16-UNIMOD:21	ms_run[1]:scan=5874	26.335393333333336	3	3024.356397	3024.356099	K	S	145	174
PSM	FIHQQPQSSSPVYGSSAK	73	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	10-UNIMOD:21	ms_run[1]:scan=8523	38.215065	2	2027.899049	2026.914971	R	T	76	94
PSM	VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVR	74	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=17207	78.30803833333333	3	3346.580205	3346.582048	R	A	361	397