MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH12.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	19-UNIMOD:21	0.07	54.0	1	1	1
PRT	sp|Q6IQ22|RAB12_HUMAN	Ras-related protein Rab-12 OS=Homo sapiens OX=9606 GN=RAB12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	null	10-UNIMOD:267,21-UNIMOD:21,30-UNIMOD:267	0.09	51.0	3	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188	0.04	51.0	7	1	0
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	358-UNIMOD:21,355-UNIMOD:188,356-UNIMOD:21,369-UNIMOD:188,373-UNIMOD:188,210-UNIMOD:188,211-UNIMOD:188,212-UNIMOD:21,228-UNIMOD:188	0.04	49.0	3	2	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,189-UNIMOD:188,193-UNIMOD:188,194-UNIMOD:188	0.24	49.0	4	3	2
PRT	sp|Q8N573-6|OXR1_HUMAN	Isoform 6 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null		0.06	48.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	48.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	48.0	3	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	242-UNIMOD:4,250-UNIMOD:21	0.03	47.0	1	1	1
PRT	sp|O14828-2|SCAM3_HUMAN	Isoform 2 of Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	50-UNIMOD:21	0.09	47.0	1	1	1
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	41-UNIMOD:21,27-UNIMOD:267,46-UNIMOD:267	0.03	47.0	2	1	0
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	249-UNIMOD:21	0.04	47.0	2	1	0
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	678-UNIMOD:21,652-UNIMOD:21	0.07	46.0	4	2	1
PRT	sp|Q9UK58-6|CCNL1_HUMAN	Isoform 4 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	335-UNIMOD:21,342-UNIMOD:21	0.07	46.0	1	1	1
PRT	sp|O75909|CCNK_HUMAN	Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	340-UNIMOD:21,342-UNIMOD:188,346-UNIMOD:188,354-UNIMOD:188	0.03	46.0	1	1	1
PRT	sp|O15498|YKT6_HUMAN	Synaptobrevin homolog YKT6 OS=Homo sapiens OX=9606 GN=YKT6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	174-UNIMOD:21	0.10	46.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	66-UNIMOD:21	0.06	46.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	575-UNIMOD:21,394-UNIMOD:21,566-UNIMOD:267,587-UNIMOD:267	0.06	46.0	4	2	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	526-UNIMOD:21,504-UNIMOD:267,525-UNIMOD:21,530-UNIMOD:267	0.05	46.0	3	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267,181-UNIMOD:21	0.04	46.0	3	1	0
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	23-UNIMOD:21,49-UNIMOD:188,50-UNIMOD:188	0.10	45.0	2	1	0
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	141-UNIMOD:188,157-UNIMOD:188	0.10	45.0	2	1	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	247-UNIMOD:21	0.10	45.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	27-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1265-UNIMOD:21	0.01	45.0	2	1	0
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	532-UNIMOD:21,534-UNIMOD:188,539-UNIMOD:188	0.02	44.0	7	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	102-UNIMOD:21	0.12	44.0	1	1	1
PRT	sp|Q13884-2|SNTB1_HUMAN	Isoform 2 of Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	87-UNIMOD:21,92-UNIMOD:267	0.06	44.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	50-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1277-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2668-UNIMOD:21,2510-UNIMOD:21,2513-UNIMOD:188,2522-UNIMOD:188	0.01	44.0	3	2	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	649-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2873-UNIMOD:21,2890-UNIMOD:267,2868-UNIMOD:21	0.01	44.0	2	1	0
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	229-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|O15164-2|TIF1A_HUMAN	Isoform Short of Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	626-UNIMOD:21,650-UNIMOD:267	0.03	44.0	1	1	1
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	381-UNIMOD:21,1372-UNIMOD:21	0.03	43.0	2	2	2
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	110-UNIMOD:21,151-UNIMOD:21,163-UNIMOD:267	0.11	43.0	2	2	2
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	210-UNIMOD:21	0.10	43.0	1	1	1
PRT	sp|Q96ST2-2|IWS1_HUMAN	Isoform 2 of Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	75-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	547-UNIMOD:21	0.03	43.0	2	1	0
PRT	sp|Q9UMZ2-4|SYNRG_HUMAN	Isoform 3 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	829-UNIMOD:188,841-UNIMOD:21,850-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|Q9Y4E1-3|WAC2C_HUMAN	Isoform 3 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	420-UNIMOD:188,423-UNIMOD:21,437-UNIMOD:188,439-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	207-UNIMOD:188,214-UNIMOD:21,224-UNIMOD:188	0.02	43.0	2	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.15	43.0	3	3	3
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	308-UNIMOD:21,317-UNIMOD:188,319-UNIMOD:188,128-UNIMOD:21	0.01	43.0	5	2	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	657-UNIMOD:21,659-UNIMOD:21,674-UNIMOD:188,675-UNIMOD:188,662-UNIMOD:21	0.02	43.0	3	1	0
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1012-UNIMOD:21,1026-UNIMOD:188	0.01	43.0	2	1	0
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	139-UNIMOD:267,140-UNIMOD:21,151-UNIMOD:4,160-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	385-UNIMOD:21,394-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	121-UNIMOD:21	0.02	43.0	2	1	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q9H694|BICC1_HUMAN	Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	836-UNIMOD:21,838-UNIMOD:188	0.02	43.0	1	1	1
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	430-UNIMOD:21,440-UNIMOD:4	0.05	42.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	187-UNIMOD:188,188-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	64-UNIMOD:188,79-UNIMOD:188	0.05	42.0	6	2	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	138-UNIMOD:21	0.13	42.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	315-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	129-UNIMOD:21	0.17	42.0	12	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	181-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	448-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	48-UNIMOD:188,49-UNIMOD:21,59-UNIMOD:188	0.04	42.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1826-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	326-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	307-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	1023-UNIMOD:21	0.01	42.0	1	1	0
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	83-UNIMOD:188,99-UNIMOD:4,106-UNIMOD:188	0.08	41.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	366-UNIMOD:21,383-UNIMOD:188	0.05	41.0	2	1	0
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1456-UNIMOD:267,1464-UNIMOD:21,1473-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	3539-UNIMOD:21	0.00	41.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	91-UNIMOD:21	0.21	41.0	1	1	1
PRT	sp|Q86UU1-3|PHLB1_HUMAN	Isoform 3 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	578-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	78-UNIMOD:21	0.16	41.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	356-UNIMOD:188,357-UNIMOD:21,372-UNIMOD:188	0.01	41.0	1	1	1
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	41-UNIMOD:21,59-UNIMOD:188,60-UNIMOD:188	0.05	41.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	398-UNIMOD:188	0.05	41.0	2	1	0
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1273-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.07	41.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	197-UNIMOD:28,206-UNIMOD:188,212-UNIMOD:188,215-UNIMOD:21,222-UNIMOD:188	0.01	41.0	1	1	1
PRT	sp|Q14BN4-6|SLMAP_HUMAN	Isoform 6 of Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	448-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P05412|JUN_HUMAN	Transcription factor AP-1 OS=Homo sapiens OX=9606 GN=JUN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	62-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	147-UNIMOD:21	0.13	40.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	16-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q8IYB7|DI3L2_HUMAN	DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	396-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q71RC2-2|LARP4_HUMAN	Isoform 2 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	484-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q6PJF5-2|RHDF2_HUMAN	Isoform 2 of Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	296-UNIMOD:21,299-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	285-UNIMOD:267,290-UNIMOD:21,300-UNIMOD:267	0.02	40.0	1	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21,508-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	83-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	82-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	458-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1701-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	21-UNIMOD:21,36-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q9BVG4|PBDC1_HUMAN	Protein PBDC1 OS=Homo sapiens OX=9606 GN=PBDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	197-UNIMOD:21	0.09	40.0	1	1	1
PRT	sp|Q9C0H5|RHG39_HUMAN	Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	286-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	805-UNIMOD:21,816-UNIMOD:267	0.01	40.0	2	1	0
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	1	1	1
PRT	sp|Q68DK2-5|ZFY26_HUMAN	Isoform 5 of Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1764-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	19-UNIMOD:21	0.12	40.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	494-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	362-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q9Y485|DMXL1_HUMAN	DmX-like protein 1 OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1904-UNIMOD:4,1908-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	15-UNIMOD:4,18-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.12	39.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	85-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	292-UNIMOD:267,304-UNIMOD:4,306-UNIMOD:21,308-UNIMOD:267	0.01	39.0	1	1	1
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1119-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	255-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	913-UNIMOD:188,925-UNIMOD:21,933-UNIMOD:188	0.02	39.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	767-UNIMOD:21,773-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	445-UNIMOD:21,452-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	196-UNIMOD:21,199-UNIMOD:21,221-UNIMOD:188,227-UNIMOD:21,235-UNIMOD:188,236-UNIMOD:188	0.07	39.0	2	2	2
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	450-UNIMOD:188,458-UNIMOD:4,463-UNIMOD:188	0.01	39.0	1	1	1
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	566-UNIMOD:21,577-UNIMOD:267	0.03	39.0	2	1	0
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P01106|MYC_HUMAN	Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	66-UNIMOD:267,70-UNIMOD:4,71-UNIMOD:21,83-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	19-UNIMOD:21,27-UNIMOD:4	0.02	39.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	18-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188,22-UNIMOD:188	0.10	39.0	3	1	0
PRT	sp|Q9ULU4-19|PKCB1_HUMAN	Isoform 19 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	517-UNIMOD:21,519-UNIMOD:188,532-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	345-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1000-UNIMOD:188,1003-UNIMOD:21,1013-UNIMOD:188,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:188	0.01	39.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,17-UNIMOD:188,18-UNIMOD:21,21-UNIMOD:188	0.09	39.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	181-UNIMOD:21,172-UNIMOD:188,187-UNIMOD:188,192-UNIMOD:267	0.12	39.0	5	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1685-UNIMOD:188,1690-UNIMOD:188,1701-UNIMOD:21,1703-UNIMOD:4,1705-UNIMOD:21,1719-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q6P3S6|FBX42_HUMAN	F-box only protein 42 OS=Homo sapiens OX=9606 GN=FBXO42 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	365-UNIMOD:21,371-UNIMOD:267,387-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1358-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O76021-2|RL1D1_HUMAN	Isoform 2 of Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	138-UNIMOD:21,153-UNIMOD:188,154-UNIMOD:188	0.07	38.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	152-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	544-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	308-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	74-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	623-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|Q5VWG9|TAF3_HUMAN	Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	755-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9NR81-2|ARHG3_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=ARHGEF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	49-UNIMOD:21,59-UNIMOD:4	0.04	38.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	19-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|Q5M775-4|CYTSB_HUMAN	Isoform 4 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	231-UNIMOD:21,234-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	55-UNIMOD:267,66-UNIMOD:21,69-UNIMOD:267	0.09	38.0	1	1	1
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	206-UNIMOD:21,210-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	60-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1121-UNIMOD:21,1123-UNIMOD:21,1132-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	80-UNIMOD:21,82-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	151-UNIMOD:21,161-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q8IX07|FOG1_HUMAN	Zinc finger protein ZFPM1 OS=Homo sapiens OX=9606 GN=ZFPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	898-UNIMOD:267,909-UNIMOD:21,915-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	214-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	78-UNIMOD:21,80-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	1083-UNIMOD:28,1086-UNIMOD:21,1104-UNIMOD:188,1106-UNIMOD:188	0.01	38.0	1	1	1
PRT	sp|O14523|C2C2L_HUMAN	Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	654-UNIMOD:28,660-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	854-UNIMOD:267	0.01	38.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	288-UNIMOD:21	0.02	38.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	3-UNIMOD:21	ms_run[2]:scan=6748	31.836	3	2739.1634	2739.1634	R	A	17	51
PSM	RAGGGGGLGAGSPALSGGQGR	2	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:267,12-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=6304	29.801	2	1838.8652	1838.8652	R	R	10	31
PSM	RAGGGGGLGAGSPALSGGQGR	3	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	12-UNIMOD:21	ms_run[2]:scan=6269	29.609	2	1818.8486	1818.8486	R	R	10	31
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	4	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22603	109.51283666666667	3	3112.591378	3111.608898	R	A	655	686
PSM	KTGSYGALAEITASKEGQK	5	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	4-UNIMOD:21	ms_run[2]:scan=12576	59.83	2	2017.9722	2017.9722	R	E	355	374
PSM	RAGGGGGLGAGSPALSGGQGR	6	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	12-UNIMOD:21	ms_run[2]:scan=6499	30.628	2	1818.8486	1818.8486	R	R	10	31
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	7	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19860	95.54994	3	3442.3988	3442.4027	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	8	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22409	108.462535	3	3112.592166	3111.608898	R	A	655	686
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	9	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21599	104.216275	3	3112.593757	3111.608898	R	A	655	686
PSM	KIEESETIEDSSNQAAAR	10	sp|Q8N573-6|OXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=6418	30.302	2	1976.9287	1976.9287	K	E	122	140
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	11	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7611	35.62688833333333	3	3007.3296	3007.3290	K	S	145	174
PSM	HGGVCAPAAVATSPPGAIPK	12	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=12662	60.257	2	1936.923	1936.9230	R	E	238	258
PSM	KLSPTEPKNYGSYSTQASAAAATAELLK	13	sp|O14828-2|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=21467	103.57	3	2976.4481	2976.4481	R	K	48	76
PSM	RYWEEETVPTTAGASPGPPR	14	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	15-UNIMOD:21	ms_run[2]:scan=14344	68.508	2	2280.0212	2280.0212	R	N	27	47
PSM	TYSAPAINAIQVPKPFSGPVR	15	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:21	ms_run[2]:scan=24034	117.53	2	2292.1668	2292.1668	R	L	249	270
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	16	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=21736	104.920575	3	3112.593757	3111.608898	R	A	655	686
PSM	AAPEASSPPASPLQHLLPGK	17	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:21	ms_run[2]:scan=21469	103.58	2	2047.014	2047.0140	K	A	673	693
PSM	AKGLNPDGTPALSTLGGFSPASKPSSPR	18	sp|Q9UK58-6|CCNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	19-UNIMOD:21,26-UNIMOD:21	ms_run[2]:scan=19323	92.968	3	2869.3413	2869.3413	K	E	317	345
PSM	AVVVSPKEENKAAEPPPPK	19	sp|O75909|CCNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	5-UNIMOD:21,7-UNIMOD:188,11-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6412	30.28	2	2084.1053	2084.1053	R	I	336	355
PSM	GEKLDDLVSKSEVLGTQSK	20	sp|O15498|YKT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:21	ms_run[2]:scan=16217	77.865	2	2112.0351	2112.0351	R	A	164	183
PSM	RDSSESQLASTESDKPTTGR	21	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:21	ms_run[2]:scan=4699	21.852	2	2230.9703	2230.9703	R	V	64	84
PSM	RNALFPEVFSPTPDENSDQNSR	22	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	10-UNIMOD:21	ms_run[2]:scan=23140	112.43	3	2599.134	2599.1340	R	S	566	588
PSM	RYWEEETVPTTAGASPGPPR	23	sp|O15213|WDR46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:267,15-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=14320	68.388	2	2300.0378	2300.0378	R	N	27	47
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	24	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	24-UNIMOD:21	ms_run[2]:scan=7946	37.008	2	2664.2293	2664.2293	R	R	503	531
PSM	QHEAPSNRPLNELLTPQGPSPR	25	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=18169	87.45577833333333	3	2520.2022	2520.2020	R	T	167	189
PSM	HAPSPEPAVQGTGVAGVPEESGDAAAIPAKK	26	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:21	ms_run[2]:scan=13237	63.076	3	3017.4495	3017.4495	R	A	20	51
PSM	KPEDVLDDDDAGSAPLK	27	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=11204	52.323	2	1795.8878	1795.8878	R	S	141	158
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	28	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21	ms_run[2]:scan=7581	35.505	3	3046.23	3046.2300	K	D	234	260
PSM	REEGPPPPSPDGASSDAEPEPPSGR	29	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21	ms_run[2]:scan=8181	37.992	3	2594.0922	2594.0922	R	T	14	39
PSM	SPSLSPSPPSPLEKTPLGER	30	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=18039	86.8	2	2155.0562	2155.0562	K	S	1256	1276
PSM	AQGEPVAGHESPKIPYEK	31	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9487	43.899	2	2027.9756	2027.9756	R	Q	522	540
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	32	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=19636	94.491	3	3393.3457	3393.3457	K	F	86	114
PSM	GAGAGHPGAGGAQPPDSPAGVR	33	sp|Q13884-2|SNTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=4979	22.902	2	1972.878	1972.8780	R	T	71	93
PSM	KGLPLGSAVSSPVLFSPVGR	34	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	16-UNIMOD:21	ms_run[2]:scan=23781	116.04	2	2047.0867	2047.0867	R	R	35	55
PSM	KPEDVLDDDDAGSAPLK	35	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=11208	52.338	2	1783.8476	1783.8476	R	S	141	158
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	36	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	24-UNIMOD:21	ms_run[2]:scan=10549	49.105	3	2868.339	2868.3390	R	S	1254	1282
PSM	NRPDYVSEEEEDDEDFETAVKK	37	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21	ms_run[2]:scan=16469	79.146	3	2723.1123	2723.1123	K	L	2662	2684
PSM	SPEKIEEVLSPEGSPSKSPSK	38	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	18-UNIMOD:21	ms_run[2]:scan=11761	55.758	2	2291.0934	2291.0934	K	K	632	653
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	39	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	14-UNIMOD:21,31-UNIMOD:267	ms_run[2]:scan=9789	45.616	3	2929.2351	2929.2351	R	S	2860	2891
PSM	TVFPGAVPVLPASPPPKDSLR	40	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=21907	105.85	2	2224.1657	2224.1657	K	S	217	238
PSM	TVQSPNSSVPSPGLAGPVTMTSVHPPIR	41	sp|O15164-2|TIF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21196	102.14	3	2902.4288	2902.4288	R	S	623	651
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	42	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7360	34.58870666666667	3	3007.3296	3007.3290	K	S	145	174
PSM	ASGKTSQVGAASAPAKESPR	43	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:21	ms_run[2]:scan=1608	8.1925	2	1978.9473	1978.9473	K	K	364	384
PSM	GPPASSPAPAPKFSPVTPK	44	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=12097	57.509	2	1911.9496	1911.9496	R	F	97	116
PSM	IVIGYQSHADTATKSGSTTK	45	sp|P06730|IF4E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	18-UNIMOD:21	ms_run[2]:scan=7156	33.669	2	2144.0151	2144.0151	K	N	193	213
PSM	KAAVLSDSEDEEKASAK	46	sp|Q96ST2-2|IWS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=3617	17.065	2	1856.8405	1856.8405	R	K	68	85
PSM	KASPEPPDSAEGALKLGEEQQR	47	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=13384	63.812	3	2416.1271	2416.1271	R	Q	545	567
PSM	KLSPFVLSAGSGSPSATSILQK	48	sp|Q9UMZ2-4|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,13-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=23369	113.68	3	2266.2013	2266.2013	R	K	829	851
PSM	KTGSYGALAEITASKEGQK	49	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,2-UNIMOD:21,15-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=12593	59.899	2	2036.0325	2036.0325	R	E	355	374
PSM	KVQSTADIFGDEEGDLFKEK	50	sp|Q9Y4E1-3|WAC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,4-UNIMOD:21,18-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=22363	108.24	3	2353.1225	2353.1225	R	A	420	440
PSM	NKPGPNIESGNEDDDASFK	51	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=9604	44.659	2	2124.904	2124.9040	K	I	206	225
PSM	RAEDGSVIDYELIDQDAR	52	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18337	88.221	2	2063.976	2063.9760	R	D	197	215
PSM	SGGSGHAVAEPASPEQELDQNKGK	53	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=8053	37.418	2	2472.0918	2472.0918	K	G	296	320
PSM	SQSESSDEVTELDLSHGKK	54	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=10333	48.115	2	2154.9318	2154.9318	R	D	657	676
PSM	TPSIQPSLLPHAAPFAK	55	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21619	104.32	2	1859.9642	1859.9642	R	S	1010	1027
PSM	TRSVEDDEEGHLICQSGDVLSAR	56	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:267,3-UNIMOD:21,14-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=16928	81.267	3	2672.1652	2672.1652	R	Y	138	161
PSM	VHAYFAPVTPPPSVGGSR	57	sp|Q96IG2-2|FXL20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=16233	77.935	2	1927.9221	1927.9221	K	Q	377	395
PSM	VTKNEEPSEEEIDAPKPK	58	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	8-UNIMOD:21	ms_run[2]:scan=6337	29.937	2	2118.9722	2118.9722	K	K	114	132
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	59	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	11-UNIMOD:21	ms_run[1]:scan=22566	109.31906333333333	3	3096.563888	3095.580500	R	A	655	686
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	60	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=15884	76.18942	3	3072.3905	3072.3933	R	T	553	583
PSM	NGIGPGSHSEFAASIGSPK	61	sp|Q9H694|BICC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:21,19-UNIMOD:188	ms_run[1]:scan=13476	64.25591166666668	2	1898.869897	1897.866686	R	R	820	839
PSM	AQGEPVAGHESPKIPYEK	62	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9690	45.103	2	2027.9756	2027.9756	R	Q	522	540
PSM	AQGEPVAGHESPKIPYEK	63	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=9279	42.742	2	2015.9354	2015.9354	R	Q	522	540
PSM	AQGEPVAGHESPKIPYEK	64	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=9624	44.76	2	2015.9354	2015.9354	R	Q	522	540
PSM	EKVAASPKSPTAALNESLVECPK	65	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=14779	70.508	3	2505.2186	2505.2186	R	C	420	443
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	66	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:21	ms_run[2]:scan=21750	104.99	3	3095.5805	3095.5805	R	A	642	673
PSM	IINEPTAAAIAYGLDKK	67	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=19280	92.758	2	1799.0232	1799.0232	R	V	172	189
PSM	KDASDDLDDLNFFNQK	68	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=22722	110.13	2	1895.894	1895.8940	K	K	64	80
PSM	KDASDDLDDLNFFNQK	69	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22494	108.95	2	1883.8537	1883.8537	K	K	64	80
PSM	KDDPVTNLNNAFEVAEK	70	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18945	91.161	2	1902.9323	1902.9323	R	Y	217	234
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	71	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	19-UNIMOD:21	ms_run[2]:scan=20251	97.464	3	3656.5163	3656.5163	K	E	120	152
PSM	KVEEEGSPGDPDHEASTQGR	72	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=2081	9.907	2	2203.9019	2203.9019	R	T	309	329
PSM	LLKEGEEPTVYSDEEEPKDESAR	73	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:21	ms_run[2]:scan=29783	154.52	3	2729.1957	2729.1957	K	K	118	141
PSM	NHLSPQQGGATPQVPSPCCR	74	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4,20-UNIMOD:267	ms_run[2]:scan=9686	45.079	2	2279.9805	2279.9805	K	F	166	186
PSM	NRPDYVSEEEEDDEDFETAVKK	75	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=16259	78.084	3	2723.1123	2723.1123	K	L	2662	2684
PSM	RVSEVEEEKEPVPQPLPSDDTR	76	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=11565	54.612	3	2615.2116	2615.2116	R	V	446	468
PSM	SDDSKSSSPELVTHLK	77	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:188,6-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=8794	40.576	2	1820.8596	1820.8596	K	W	44	60
PSM	SKTPVQAAAVSIVEKPVTR	78	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=14931	71.247	2	2060.1031	2060.1031	R	K	1824	1843
PSM	SPPSTGSTYGSSQKEESAASGGAAYTKR	79	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=7916	36.896	3	2841.2454	2841.2454	K	Y	320	348
PSM	SQSESSDEVTELDLSHGKK	80	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,18-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=10320	48.056	2	2166.9721	2166.9721	R	D	657	676
PSM	SSLGQSASETEEDTVSVSKKEK	81	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=10225	47.615	2	2405.0847	2405.0847	R	N	302	324
PSM	TYSAPAINAIQVPKPFSGPVR	82	sp|Q9H4L5-6|OSBL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:21	ms_run[2]:scan=23865	116.52	2	2292.1668	2292.1668	R	L	249	270
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	83	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22249	107.61951499999999	4	3112.593683	3111.608898	R	A	655	686
PSM	TPSIQPSLLPHAAPFAK	84	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21	ms_run[1]:scan=21595	104.19906999999999	2	1853.944298	1853.944086	R	S	1021	1038
PSM	AKPEGALQNNDGLYDPDCDESGLFK	85	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,18-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=19512	93.886	3	2764.2689	2764.2689	R	A	82	107
PSM	FASDDEHDEHDENGATGPVK	86	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=4873	22.525	2	2248.8546	2248.8546	K	R	364	384
PSM	FPDRLAEDEGDSEPEAVGQSR	87	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:267,12-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=13293	63.365	3	2403.0131	2403.0131	K	G	1453	1474
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	88	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=21942	106.01	3	3095.5805	3095.5805	R	A	642	673
PSM	GSKSPAKVSDGGSSSTDFK	89	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=2871	13.116	2	1920.8466	1920.8466	K	M	3536	3555
PSM	HAPSPEPAVQGTGVAGVPEESGDAAAIPAKK	90	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21,30-UNIMOD:188,31-UNIMOD:188	ms_run[2]:scan=13248	63.122	3	3029.4898	3029.4898	R	A	20	51
PSM	KDASDDLDDLNFFNQK	91	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=22504	109	2	1895.894	1895.8940	K	K	64	80
PSM	KDASDDLDDLNFFNQK	92	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=22687	109.95	2	1883.8537	1883.8537	K	K	64	80
PSM	KLEKEEEEGISQESSEEEQ	93	sp|P17096-2|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=5513	25.7	2	2315.953	2315.9530	K	-	78	97
PSM	KNSITEISDNEDDLLEYHR	94	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=18514	89.058	3	2370.0377	2370.0377	R	R	576	595
PSM	LLKEGEEPTVYSDEEEPKDESAR	95	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=29603	153.5	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	96	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21	ms_run[2]:scan=30719	159.72	3	2729.1957	2729.1957	K	K	118	141
PSM	NKPGPNIESGNEDDDASFK	97	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=9596	44.619	2	2112.8637	2112.8637	K	I	206	225
PSM	RAPSTSPSFEGTQETYTVAHEENVR	98	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=13948	66.578	3	2872.2665	2872.2665	R	F	75	100
PSM	RDSSESQLASTESDKPTTGR	99	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=4675	21.749	3	2230.9703	2230.9703	R	V	64	84
PSM	SAKSEESLTSLHAVDGDSK	100	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:188,4-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10554	49.135	2	2051.9451	2051.9451	R	L	354	373
PSM	SHYADVDPENQNFLLESNLGKK	101	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=18590	89.427	3	2597.1799	2597.1799	K	K	39	61
PSM	SLLEGQEDHYNNLSASK	102	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11135	51.929	2	1903.8912	1903.8912	R	V	382	399
PSM	SLLEGQEDHYNNLSASK	103	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:188	ms_run[2]:scan=11142	51.964	2	1909.9113	1909.9113	R	V	382	399
PSM	SNSLDKHQQSSTLGNSVVR	104	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=7247	34.125	2	2135.9961	2135.9961	K	C	1273	1292
PSM	SPSLSPSPPSPLEKTPLGER	105	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=18252	87.832	2	2155.0562	2155.0562	K	S	1256	1276
PSM	VDKGVVPLAGTNGETTTQGLDGLSER	106	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17562	84.483	3	2613.3246	2613.3246	K	C	109	135
PSM	SGGSGHAVAEPASPEQELDQNKGK	107	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21,22-UNIMOD:188,24-UNIMOD:188	ms_run[1]:scan=8252	38.297956666666664	3	2484.131112	2484.132084	K	G	296	320
PSM	QQQLEEEAAKPPEPEKPVSPPPIESK	108	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,10-UNIMOD:188,16-UNIMOD:188,19-UNIMOD:21,26-UNIMOD:188	ms_run[1]:scan=16500	79.29189166666666	3	2962.4702	2962.4706	K	H	197	223
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	109	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22464	108.77803	4	3112.593683	3111.608898	R	A	655	686
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	110	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	24-UNIMOD:21	ms_run[1]:scan=8619	39.94232	3	2665.213854	2664.229323	R	R	503	531
PSM	AKESDFSDTLSPSKEK	111	sp|Q14BN4-6|SLMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=7528	35.247	2	1847.819	1847.8190	R	S	438	454
PSM	AKNSDLLTSPDVGLLK	112	sp|P05412|JUN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21	ms_run[2]:scan=20577	99.065	2	1749.8914	1749.8914	R	L	55	71
PSM	AQGEPVAGHESPKIPYEK	113	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9283	42.757	2	2027.9756	2027.9756	R	Q	522	540
PSM	DHANYEEDENGDITPIKAK	114	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=8708	40.261	3	2237.9478	2237.9478	R	K	134	153
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	115	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=3980	18.545	2	2540.1908	2540.1908	R	E	7	32
PSM	DKNTPSPFIETFTEDDEASR	116	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=20412	98.231	3	2298.0288	2298.0288	K	A	210	230
PSM	DLDDALSCKPLADGNFK	117	sp|Q8IYB7|DI3L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4	ms_run[2]:scan=18620	89.568	2	1877.8829	1877.8829	R	V	389	406
PSM	DLIEDSSVQKDGLNQTTIPVSPPSTTKPSR	118	sp|Q71RC2-2|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	21-UNIMOD:21	ms_run[2]:scan=18395	88.514	3	3289.6079	3289.6079	K	E	464	494
PSM	GIPHSASPVSPDGVQIPLKEYGR	119	sp|Q6PJF5-2|RHDF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=19086	91.854	3	2563.1873	2563.1873	R	A	290	313
PSM	GWLRDPSASPGDAGEQAIR	120	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:267,9-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=15637	74.918	2	2081.9435	2081.9435	K	Q	282	301
PSM	HIKEEPLSEEEPCTSTAIASPEK	121	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=12464	59.296	2	2741.1544	2741.1544	K	K	495	518
PSM	IDASKNEEDEGHSNSSPR	122	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=969	5.9134	2	2050.8229	2050.8229	K	H	68	86
PSM	IINEPTAAAIAYGLDKK	123	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19266	92.699	2	1786.9829	1786.9829	R	V	172	189
PSM	KAQAVSEEEEEEEGKSSSPK	124	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21	ms_run[2]:scan=3569	16.861	2	2256.9635	2256.9635	R	K	77	97
PSM	KDDDSDDESQSSHTGK	125	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=544	4.4458	2	1829.6589	1829.6589	R	K	454	470
PSM	KEESDEEETASKAER	126	sp|Q9BY89|K1671_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=1676	8.4804	2	1816.7364	1816.7364	R	T	1698	1713
PSM	KTSDANETEDHLESLICK	127	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=17832	85.802	2	2168.9297	2168.9297	R	V	20	38
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	128	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=16429	78.951	3	2686.2416	2686.2416	K	E	139	164
PSM	LLKEGEEPTVYSDEEEPKDESAR	129	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=10451	48.659	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	130	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=31624	165.24	3	2729.1957	2729.1957	K	K	118	141
PSM	NGGEKGADSGEEKEEGINR	131	sp|Q9BVG4|PBDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=1802	8.9487	2	2054.8542	2054.8542	K	E	189	208
PSM	RAELPGSSSPLLAQPR	132	sp|Q9C0H5|RHG39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=13492	64.335	2	1757.8825	1757.8825	K	K	278	294
PSM	RALSSDSILSPAPDAR	133	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=13410	63.929	2	1734.8302	1734.8302	R	A	391	407
PSM	RNALFPEVFSPTPDENSDQNSR	134	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=22954	111.42	3	2599.134	2599.1340	R	S	566	588
PSM	SAPTAPTPPPPPPPATPR	135	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=9920	46.236	2	1837.9003	1837.9003	R	K	799	817
PSM	SHYADVDPENQNFLLESNLGKK	136	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,21-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=18595	89.448	3	2609.2202	2609.2202	K	K	39	61
PSM	SIQEIQELDKDDESLR	137	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=16091	77.28	2	1916.9327	1916.9327	K	K	34	50
PSM	SPSAEFSPAAPPGISSIHSPSLR	138	sp|Q68DK2-5|ZFY26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=20701	99.709	3	2371.1209	2371.1209	R	E	1762	1785
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	139	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=9797	45.65	3	2919.2268	2919.2268	R	S	2860	2891
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	140	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13852	66.131	3	4344.6117	4344.6117	K	K	156	194
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	141	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:267,23-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=7911	36.877	3	2684.2459	2684.2459	R	R	503	531
PSM	SGGSGHAVAEPASPEQELDQNKGK	142	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21	ms_run[1]:scan=8007	37.264383333333335	3	2473.094065	2472.091826	K	G	296	320
PSM	QHEAPSNRPLNELLTPQGPSPR	143	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=18096	87.07011999999999	3	2500.1854	2500.1855	R	T	167	189
PSM	ARQYTSPEEIDAQLQAEKQK	144	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21	ms_run[1]:scan=13290	63.350116666666665	3	2413.144486	2412.132234	R	A	14	34
PSM	AGLESGAEPGDGDSDTTKKK	145	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=2396	11.176	2	2041.8841	2041.8841	K	K	481	501
PSM	AKTQTPPVSPAPQPTEERLPSSPVYEDAASFK	146	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=19057	91.714	3	3504.6814	3504.6814	R	A	360	392
PSM	ASSFLDTSKDCSPSSPLKLDAR	147	sp|Q9Y485|DMXL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=16938	81.31	2	2461.1196	2461.1196	R	E	1894	1916
PSM	CDDSPRTPSNTPSAEADWSPGLELHPDYK	148	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=19546	94.056	3	3321.3922	3321.3922	R	T	15	44
PSM	DASDDLDDLNFFNQKK	149	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23248	113.02	2	1883.8537	1883.8537	K	K	65	81
PSM	DKKSPLIESTANMDNNQSQK	150	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,3-UNIMOD:188,4-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=7645	35.777	3	2345.1068	2345.1068	R	T	209	229
PSM	EAFSLFDKDGDGTITTK	151	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18497	88.97	2	1843.884	1843.8840	K	E	15	32
PSM	FIHQQPQSSSPVYGSSAK	152	sp|P49023-2|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=7277	34.255	2	2026.915	2026.9150	R	T	76	94
PSM	GSRPPLILQSQSLPCSSPR	153	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:267,15-UNIMOD:4,17-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=16604	79.729	2	2179.0724	2179.0724	K	D	290	309
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	154	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=19273	92.726	3	2771.2175	2771.2175	R	N	1116	1140
PSM	IEDVGSDEEDDSGKDKK	155	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=2033	9.7672	2	1944.7837	1944.7837	K	K	250	267
PSM	KASPEPPDSAEGALKLGEEQQR	156	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=13587	64.83	3	2416.1271	2416.1271	R	Q	545	567
PSM	KGGEFDEFVNDDTDDDLPISK	157	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,13-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=21580	104.12	3	2447.0456	2447.0456	K	K	913	934
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	158	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=16773	80.603	3	2742.2819	2742.2819	K	K	761	786
PSM	KPSGSPDLWKLSPDQR	159	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=15531	74.423	2	1969.87	1969.8700	R	K	441	457
PSM	KQAREESEESEAEPVQR	160	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=2495	11.724	2	2160.8726	2160.8726	R	T	190	207
PSM	LKDEDDEDDCFILEK	161	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,10-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=14228	67.94	2	1894.8545	1894.8545	K	A	449	464
PSM	LLKEGEEPTVYSDEEEPKDESAR	162	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=10667	49.675	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	163	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=11930	56.657	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	164	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=29963	155.54	3	2729.1957	2729.1957	K	K	118	141
PSM	NSSTETDQQPHSPDSSSSVHSIR	165	sp|Q92613|JADE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=4105	19.156	2	2562.062	2562.0620	R	N	555	578
PSM	RPASPSSPEHLPATPAESPAQR	166	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9751	45.434	2	2442.073	2442.0730	K	F	231	253
PSM	RSGLCSPSYVAVTPFSLR	167	sp|P01106|MYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,5-UNIMOD:4,6-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=23218	112.85	2	2096.0029	2096.0029	R	G	66	84
PSM	RVQPQWSPPAGTQPCR	168	sp|P49589-2|SYCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11001	51.23	2	1943.8826	1943.8826	R	L	13	29
PSM	SETAPAAPAAPAPAEKTPVKK	169	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=5440	25.289	2	2111.0664	2111.0664	M	K	2	23
PSM	TDLEKDIISDTSGDFR	170	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=20786	100.12	2	1810.8585	1810.8585	K	K	171	187
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	171	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=18262	87.882	3	2536.2574	2536.2574	K	T	508	533
PSM	TGQAGSLSGSPKPFSPQLSAPITTK	172	sp|Q9ULU4-19|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,12-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=18286	87.982	3	2548.2977	2548.2977	K	T	508	533
PSM	THTDSSEKELEPEAAEEALENGPK	173	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=17210	82.618	3	2690.1596	2690.1596	K	E	340	364
PSM	VKAQTPPGPSLSGSKSPCPQEK	174	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,5-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6927	32.663	3	2457.151	2457.1510	K	S	999	1021
PSM	RNALFPEVFSPTPDENSDQNSR	175	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:267,10-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=22837	110.77825333333334	3	2619.150002	2619.150563	R	S	566	588
PSM	SETAPAETATPAPVEKSPAK	176	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188	ms_run[1]:scan=8590	39.82716666666667	2	2115.0161	2115.0170	M	K	2	22
PSM	LLKEGEEPTVYSDEEEPKDESAR	177	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=29267	151.453225	3	2730.199469	2729.195682	K	K	170	193
PSM	LLKEGEEPTVYSDEEEPKDESAR	178	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:188,12-UNIMOD:21,18-UNIMOD:188,23-UNIMOD:267	ms_run[1]:scan=30220	156.94820666666666	3	2752.251625	2751.244209	K	K	170	193
PSM	KSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQR	179	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:188,6-UNIMOD:188,17-UNIMOD:21,19-UNIMOD:4,21-UNIMOD:21,35-UNIMOD:267	ms_run[1]:scan=16200	77.78820666666667	3	3745.652639	3742.650109	R	G	1685	1720
PSM	APLSPSLNSRPSPISATPPALVPETR	180	sp|Q6P3S6|FBX42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,10-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=21446	103.45	3	2754.422	2754.4220	R	E	362	388
PSM	AQGEPVAGHESPKIPYEK	181	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=9456	43.746	2	2015.9354	2015.9354	R	Q	522	540
PSM	AQGEPVAGHESPKIPYEK	182	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,13-UNIMOD:188	ms_run[2]:scan=9379	43.276	2	2021.9555	2021.9555	R	Q	522	540
PSM	AQQRAESPESSAIESTQSTPQKGR	183	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=6065	28.693	3	2652.2141	2652.2141	R	G	1352	1376
PSM	ATNESEDEIPQLVPIGKK	184	sp|O76021-2|RL1D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=19058	91.717	2	2059.0277	2059.0277	K	T	137	155
PSM	ATPTKAPAPVVLGSPVVLGPPVGQAR	185	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:21	ms_run[2]:scan=22824	110.72	3	2558.3986	2558.3986	R	V	151	177
PSM	AVVSPPKFVFGSESVK	186	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=21867	105.64	2	1768.9203	1768.9203	K	S	2507	2523
PSM	DASDDLDDLNFFNQKK	187	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23059	112.01	2	1883.8537	1883.8537	K	K	65	81
PSM	DDKHGSYEDAVHSGALND	188	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=8460	39.279	2	2008.78	2008.7800	K	-	539	557
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	189	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=3957	18.464	3	2540.1908	2540.1908	R	E	7	32
PSM	EVAEGGLPRAESPSPAPPPGLR	190	sp|Q9BUA3|SPNDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=13909	66.412	3	2263.0998	2263.0998	R	G	297	319
PSM	FASDDEHDEHDENGATGPVK	191	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,20-UNIMOD:188	ms_run[2]:scan=4881	22.551	2	2254.8747	2254.8747	K	R	364	384
PSM	GADFLVTEVENGGSLGSKK	192	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20552	98.925	2	1906.9636	1906.9636	K	G	174	193
PSM	GKGSLGSQGAKDEPEEELQK	193	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=7427	34.839	2	2165.9842	2165.9842	K	G	1366	1386
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	194	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=21748	104.98	4	3095.5805	3095.5805	R	A	642	673
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	195	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=15225	72.823	3	2649.1708	2649.1708	K	S	61	87
PSM	HGSGPNIILTGDSSPGFSK	196	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=16119	77.411	2	1949.8884	1949.8884	R	E	611	630
PSM	HIKEEPLSEEEPCTSTAIASPEK	197	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4,14-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=12670	60.306	2	2741.1544	2741.1544	K	K	495	518
PSM	HTGPNSPDTANDGFVR	198	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7291	34.311	2	1773.7347	1773.7347	K	L	99	115
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	199	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=19490	93.783	3	2771.2175	2771.2175	R	N	1116	1140
PSM	IKVEPVALAPSPVIPR	200	sp|Q5VWG9|TAF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=19904	95.762	2	1764.9903	1764.9903	K	L	745	761
PSM	KQSTQDEDAVSLCSLDISEPSNKR	201	sp|Q9NR81-2|ARHG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=17061	81.888	3	2786.243	2786.2430	R	V	47	71
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	202	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	32-UNIMOD:188,36-UNIMOD:188,37-UNIMOD:188	ms_run[2]:scan=11838	56.138	3	4263.6037	4263.6037	K	S	158	195
PSM	LGAGGGSPEKSPSAQELKEQGNR	203	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=7179	33.784	3	2376.1071	2376.1071	R	L	13	36
PSM	LLKEGEEPTVYSDEEEPKDESAR	204	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=24432	119.9	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	205	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=27055	136.97	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	206	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=30147	156.54	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	207	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=30331	157.56	3	2729.1957	2729.1957	K	K	118	141
PSM	NIHGNALRTSGSSSSDVTK	208	sp|Q5M775-4|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=4784	22.164	2	2089.8831	2089.8831	K	A	222	241
PSM	NSSTETDQQPHSPDSSSSVHSIR	209	sp|Q92613|JADE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=4101	19.139	2	2572.0702	2572.0703	R	N	555	578
PSM	RIDFTPVSPAPSPTR	210	sp|Q7Z309-5|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,12-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=13900	66.375	2	1739.8511	1739.8511	K	G	55	70
PSM	RKTSSDDESEEDEDDLLQR	211	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10338	48.135	2	2425.916	2425.9160	K	T	202	221
PSM	SAPTAPTPPPPPPPATPR	212	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=9926	46.266	2	1827.892	1827.8921	R	K	799	817
PSM	SETAPAAPAAPAPAEKTPVKK	213	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:188,17-UNIMOD:21,20-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=5389	24.979	2	2129.1268	2129.1268	M	K	2	23
PSM	SGGSGHAVAEPASPEQELDQNKGK	214	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,22-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=8082	37.539	2	2484.1321	2484.1321	K	G	296	320
PSM	SKGPSAAGEQEPDKESGASVDEVAR	215	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=6800	32.089	3	2580.1341	2580.1341	K	Q	45	70
PSM	SLLSHEFQDETDTEEETLYSSKH	216	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,13-UNIMOD:21,22-UNIMOD:188	ms_run[2]:scan=19322	92.966	3	2890.1567	2890.1567	K	-	1111	1134
PSM	SLYYYIQQDTKGDYQK	217	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17450	83.829	2	2011.9527	2011.9527	K	A	332	348
PSM	SQSESSDEVTELDLSHGKK	218	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=9809	45.7	2	2154.9318	2154.9318	R	D	657	676
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGKR	219	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=15519	74.361	3	3081.3482	3081.3482	R	L	67	94
PSM	TKSDESGEEKNGDEDCQR	220	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=707	5.0311	2	2162.8059	2162.8060	K	G	146	164
PSM	TPADRGPSPAPAPAASPQPGSR	221	sp|Q8IX07|FOG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:267,16-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=4801	22.233	3	2184.0228	2184.0228	R	G	894	916
PSM	TPSIQPSLLPHAAPFAK	222	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=21227	102.3	2	1859.9642	1859.9642	R	S	1010	1027
PSM	TPSPKEEDEEPESPPEKK	223	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=2524	11.861	2	2131.9198	2131.9198	K	T	202	220
PSM	VADAKGDSESEEDEDLEVPVPSRFNR	224	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=17872	86.003	3	3049.2591	3049.2591	R	R	71	97
PSM	VKAQTPPGPSLSGSKSPCPQEK	225	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,5-UNIMOD:21,15-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=7163	33.708	2	2457.151	2457.1510	K	S	999	1021
PSM	VSRSSFSSDPDEKAQDSK	226	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=3719	17.526	2	2048.8688	2048.8688	R	A	124	142
PSM	VTKNEEPSEEEIDAPKPK	227	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=6122	28.922	2	2118.9722	2118.9722	K	K	114	132
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	228	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	32-UNIMOD:188,36-UNIMOD:188,37-UNIMOD:188	ms_run[1]:scan=28252	144.8865416666667	4	4263.598334	4263.603672	K	S	158	195
PSM	QDGSQEAPEAPLSSELEPFHPKPK	229	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,4-UNIMOD:21,22-UNIMOD:188,24-UNIMOD:188	ms_run[1]:scan=21000	101.16945166666667	2	2692.2428	2692.2455	R	I	1083	1107
PSM	QKEAGLSQSHDDLSNATATPSVRK	230	sp|O14523|C2C2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=10207	47.51897833333333	3	2602.2025	2602.2019	R	K	654	678
PSM	LLKEGEEPTVYSDEEEPKDESAR	231	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:21	ms_run[1]:scan=26420	132.70155333333335	3	2729.196312	2729.195682	K	K	170	193
PSM	LLKEGEEPTVYSDEEEPKDESAR	232	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:21	ms_run[1]:scan=28777	148.297135	3	2731.202331	2729.195682	K	K	170	193
PSM	QHEAPSNRPLNELLTPQGPSPR	233	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,8-UNIMOD:267,15-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=16392	78.748345	3	2520.2020	2520.2020	R	T	167	189
PSM	HSTSGTDEGEDGDEPDDGSNDVVDLLPR	234	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	28-UNIMOD:267	ms_run[1]:scan=19791	95.21349000000001	3	2938.227850	2937.225946	K	T	827	855
PSM	SETAPAAPAAPAPAEKTPVKK	235	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	17-UNIMOD:21	ms_run[1]:scan=5617	26.364128333333333	2	2112.0692	2111.0662	M	K	2	23
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	236	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	16-UNIMOD:21	ms_run[1]:scan=5874	27.75857166666667	3	3025.343438	3024.356099	K	S	145	174
PSM	GWLRDPSASPGDAGEQAIR	237	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=15378	73.60002	2	2062.925156	2061.926933	K	Q	282	301
PSM	SLKESEQESEEEILAQKK	238	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:188,9-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[1]:scan=9317	42.921475	2	2203.082689	2202.080277	K	E	219	237
PSM	LLKEGEEPTVYSDEEEPKDESAR	239	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:21	ms_run[1]:scan=26575	133.74958333333333	3	2730.199325	2729.195682	K	K	170	193