MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH13.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH13.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q6IQ22|RAB12_HUMAN	Ras-related protein Rab-12 OS=Homo sapiens OX=9606 GN=RAB12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	21-UNIMOD:21,10-UNIMOD:267,30-UNIMOD:267	0.09	54.0	2	1	0
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	484-UNIMOD:21,460-UNIMOD:188,492-UNIMOD:188,315-UNIMOD:21	0.08	50.0	4	2	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	50.0	null	157-UNIMOD:188,189-UNIMOD:188,193-UNIMOD:188,194-UNIMOD:188	0.14	50.0	5	3	2
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	1340-UNIMOD:21,1344-UNIMOD:21	0.02	49.0	15	1	0
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	559-UNIMOD:21,557-UNIMOD:267,580-UNIMOD:188,581-UNIMOD:188	0.04	49.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188	0.04	49.0	5	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	5841-UNIMOD:21,5739-UNIMOD:21,5731-UNIMOD:21,5725-UNIMOD:188,5740-UNIMOD:188,5744-UNIMOD:188,216-UNIMOD:21	0.01	47.0	6	3	1
PRT	sp|P0C1Z6-2|TFPT_HUMAN	Isoform 2 of TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	171-UNIMOD:21,162-UNIMOD:267,181-UNIMOD:267	0.09	47.0	2	1	0
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	129-UNIMOD:21,757-UNIMOD:21	0.05	46.0	2	2	2
PRT	sp|Q9Y679-3|AUP1_HUMAN	Isoform 2 of Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	288-UNIMOD:21	0.08	46.0	10	1	0
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	649-UNIMOD:21	0.03	46.0	1	1	0
PRT	sp|Q92610|ZN592_HUMAN	Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	691-UNIMOD:21,705-UNIMOD:267,686-UNIMOD:21	0.02	45.0	3	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	547-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	563-UNIMOD:21,569-UNIMOD:21,570-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|Q7Z6E9|RBBP6_HUMAN	E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1277-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	179-UNIMOD:188,184-UNIMOD:21,190-UNIMOD:188,198-UNIMOD:188,1031-UNIMOD:21	0.04	45.0	3	2	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	268-UNIMOD:188,294-UNIMOD:188	0.02	45.0	3	1	0
PRT	sp|O75494-6|SRS10_HUMAN	Isoform 6 of Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	157-UNIMOD:21,166-UNIMOD:4	0.14	45.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	352-UNIMOD:188,360-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:188	0.04	44.0	3	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	197-UNIMOD:267,214-UNIMOD:267	0.05	44.0	3	1	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	283-UNIMOD:21,285-UNIMOD:21	0.08	44.0	2	1	0
PRT	sp|Q8WY36|BBX_HUMAN	HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	241-UNIMOD:28,243-UNIMOD:21,242-UNIMOD:188,263-UNIMOD:188	0.03	44.0	2	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	167-UNIMOD:28,186-UNIMOD:21,174-UNIMOD:267,188-UNIMOD:267	0.04	44.0	3	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	1456-UNIMOD:21	0.01	44.0	2	1	0
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1257-UNIMOD:21,1358-UNIMOD:21	0.03	43.0	2	2	2
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1029-UNIMOD:21,1027-UNIMOD:188,1040-UNIMOD:188,1044-UNIMOD:188,662-UNIMOD:21	0.03	43.0	4	2	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	391-UNIMOD:21,396-UNIMOD:267,401-UNIMOD:267	0.02	43.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	612-UNIMOD:21,619-UNIMOD:21,950-UNIMOD:4,965-UNIMOD:21,526-UNIMOD:21	0.06	43.0	3	3	3
PRT	sp|Q9BZ29-3|DOCK9_HUMAN	Isoform 3 of Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1273-UNIMOD:21	0.01	43.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	1114-UNIMOD:21,1118-UNIMOD:188,1125-UNIMOD:188	0.01	43.0	1	1	1
PRT	sp|P40123-2|CAP2_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	235-UNIMOD:21,240-UNIMOD:188,250-UNIMOD:188	0.05	42.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	1	1	1
PRT	sp|O95684-2|FR1OP_HUMAN	Isoform 2 of FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	140-UNIMOD:188,156-UNIMOD:21,159-UNIMOD:188,160-UNIMOD:21,164-UNIMOD:188	0.07	42.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	102-UNIMOD:21	0.12	42.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	39-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	218-UNIMOD:21,225-UNIMOD:188,229-UNIMOD:267	0.06	42.0	3	1	0
PRT	sp|P30989|NTR1_HUMAN	Neurotensin receptor type 1 OS=Homo sapiens OX=9606 GN=NTSR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	403-UNIMOD:21,401-UNIMOD:21	0.04	42.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	79-UNIMOD:188,80-UNIMOD:188	0.05	42.0	4	2	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	721-UNIMOD:21,623-UNIMOD:4,626-UNIMOD:21,635-UNIMOD:21	0.04	42.0	2	2	2
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	2668-UNIMOD:21,2626-UNIMOD:21	0.02	42.0	3	2	1
PRT	sp|Q12767|TMM94_HUMAN	Transmembrane protein 94 OS=Homo sapiens OX=9606 GN=TMEM94 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	445-UNIMOD:21,456-UNIMOD:267	0.01	42.0	2	1	0
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	538-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.18	42.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	35-UNIMOD:188,44-UNIMOD:21,54-UNIMOD:267,50-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|P13591-1|NCAM1_HUMAN	Isoform 2 of Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	774-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1267-UNIMOD:21,1274-UNIMOD:267	0.02	41.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	8-UNIMOD:188,16-UNIMOD:21,27-UNIMOD:188,31-UNIMOD:188	0.03	41.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	567-UNIMOD:21,576-UNIMOD:267	0.03	41.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	255-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q96G74-4|OTUD5_HUMAN	Isoform 4 of OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	212-UNIMOD:4,230-UNIMOD:21	0.08	41.0	1	1	1
PRT	sp|Q4L235-3|ACSF4_HUMAN	Isoform 3 of Beta-alanine-activating enzyme OS=Homo sapiens OX=9606 GN=AASDH	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	647-UNIMOD:188,649-UNIMOD:21,664-UNIMOD:188	0.02	41.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	105-UNIMOD:21,109-UNIMOD:21,108-UNIMOD:21	0.02	41.0	3	1	0
PRT	sp|Q9UDY2-4|ZO2_HUMAN	Isoform C2 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	26-UNIMOD:21,34-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	452-UNIMOD:267,455-UNIMOD:21,472-UNIMOD:267	0.04	41.0	2	1	0
PRT	sp|Q8IY33-3|MILK2_HUMAN	Isoform 3 of MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	301-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	893-UNIMOD:21,983-UNIMOD:21	0.03	41.0	2	2	2
PRT	sp|O15231-9|ZN185_HUMAN	Isoform 9 of Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	104-UNIMOD:4,106-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	15-UNIMOD:21,17-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	802-UNIMOD:21,805-UNIMOD:21,816-UNIMOD:267	0.01	41.0	3	1	0
PRT	sp|Q8NDX1-2|PSD4_HUMAN	Isoform 2 of PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	990-UNIMOD:21,1004-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	39-UNIMOD:21,59-UNIMOD:188,60-UNIMOD:188	0.05	41.0	1	1	1
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	151-UNIMOD:21	0.10	41.0	1	1	1
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	876-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	56-UNIMOD:21,66-UNIMOD:188	0.06	41.0	2	1	0
PRT	sp|O95707|RPP29_HUMAN	Ribonuclease P protein subunit p29 OS=Homo sapiens OX=9606 GN=POP4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	10-UNIMOD:21	0.11	41.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	206-UNIMOD:188,214-UNIMOD:21,218-UNIMOD:188,219-UNIMOD:188	0.08	41.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	47-UNIMOD:21,51-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	869-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	342-UNIMOD:21,346-UNIMOD:4,362-UNIMOD:21,355-UNIMOD:188	0.09	41.0	5	2	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	482-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	652-UNIMOD:21	0.04	40.0	1	1	0
PRT	sp|Q99081-4|HTF4_HUMAN	Isoform 4 of Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	323-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	717-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	695-UNIMOD:21,699-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	121-UNIMOD:21	0.03	40.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	207-UNIMOD:188,214-UNIMOD:21,224-UNIMOD:188,105-UNIMOD:188,113-UNIMOD:21,119-UNIMOD:188,122-UNIMOD:188	0.03	40.0	2	2	2
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	215-UNIMOD:21,220-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	17-UNIMOD:21,15-UNIMOD:21	0.14	40.0	2	1	0
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	601-UNIMOD:21,610-UNIMOD:188,614-UNIMOD:188	0.02	40.0	1	1	1
PRT	sp|Q16537-2|2A5E_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	33-UNIMOD:21,34-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	242-UNIMOD:21,246-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	659-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	357-UNIMOD:21,328-UNIMOD:21,2706-UNIMOD:4,2708-UNIMOD:21	0.02	40.0	3	3	3
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	229-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	385-UNIMOD:21,394-UNIMOD:267	0.05	40.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	274-UNIMOD:188,279-UNIMOD:188,280-UNIMOD:267	0.07	40.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	1426-UNIMOD:267,1428-UNIMOD:21,1442-UNIMOD:4,1448-UNIMOD:267	0.00	40.0	2	1	0
PRT	sp|P17544-4|ATF7_HUMAN	Isoform 4 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	87-UNIMOD:188,88-UNIMOD:188,101-UNIMOD:21,105-UNIMOD:188	0.08	39.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	494-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9HAU0-5|PKHA5_HUMAN	Isoform 5 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	799-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	521-UNIMOD:21,512-UNIMOD:188,523-UNIMOD:188	0.02	39.0	2	1	0
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1547-UNIMOD:21,1544-UNIMOD:21,1556-UNIMOD:267	0.01	39.0	3	1	0
PRT	sp|O94762|RECQ5_HUMAN	ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	727-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	200-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	493-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	444-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	497-UNIMOD:188,502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21,517-UNIMOD:188,508-UNIMOD:21	0.05	39.0	3	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	83-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	114-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q5T6C5|AT7L2_HUMAN	Ataxin-7-like protein 2 OS=Homo sapiens OX=9606 GN=ATXN7L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	475-UNIMOD:21,482-UNIMOD:4,484-UNIMOD:267	0.04	39.0	1	1	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1148-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1081-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	92-UNIMOD:21	0.21	39.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	63-UNIMOD:21	0.11	39.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	156-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	19-UNIMOD:21	0.08	39.0	3	1	0
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	99-UNIMOD:21,102-UNIMOD:188,103-UNIMOD:21,110-UNIMOD:188	0.04	39.0	2	1	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1542-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P49790-3|NU153_HUMAN	Isoform 3 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	327-UNIMOD:267,334-UNIMOD:21,342-UNIMOD:267	0.01	39.0	3	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	820-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9NQS7-2|INCE_HUMAN	Isoform 2 of Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	306-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	80-UNIMOD:21,82-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|O14639-3|ABLM1_HUMAN	Isoform 3 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	51-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	113-UNIMOD:188	0.05	39.0	2	1	0
PRT	sp|Q9Y679|AUP1_HUMAN	Ancient ubiquitous protein 1 OS=Homo sapiens OX=9606 GN=AUP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	288-UNIMOD:21	0.07	39.0	1	1	0
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	145-UNIMOD:28,164-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	730-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	532-UNIMOD:21,534-UNIMOD:188,539-UNIMOD:188	0.02	38.0	1	1	1
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	267-UNIMOD:21	0.07	38.0	2	1	0
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	164-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1814-UNIMOD:4,1819-UNIMOD:21,1779-UNIMOD:21	0.02	38.0	2	2	2
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	221-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	111-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	304-UNIMOD:4,306-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9HC52|CBX8_HUMAN	Chromobox protein homolog 8 OS=Homo sapiens OX=9606 GN=CBX8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	190-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	104-UNIMOD:21,114-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1517-UNIMOD:188,1520-UNIMOD:188,1525-UNIMOD:21	0.01	38.0	2	1	0
PRT	sp|Q9HBD1|RC3H2_HUMAN	Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1119-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O15056-3|SYNJ2_HUMAN	Isoform 2A of Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1124-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	283-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9UNE0|EDAR_HUMAN	Tumor necrosis factor receptor superfamily member EDAR OS=Homo sapiens OX=9606 GN=EDAR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	274-UNIMOD:21,273-UNIMOD:21	0.06	38.0	2	1	0
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	134-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	66-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	143-UNIMOD:21,136-UNIMOD:267,147-UNIMOD:21,150-UNIMOD:267	0.06	38.0	2	1	0
PRT	sp|Q92622-3|RUBIC_HUMAN	Isoform 3 of Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	388-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	60-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1364-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	50-UNIMOD:21	0.09	38.0	2	1	0
PRT	sp|Q9HAZ1|CLK4_HUMAN	Dual specificity protein kinase CLK4 OS=Homo sapiens OX=9606 GN=CLK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	137-UNIMOD:267,138-UNIMOD:21,149-UNIMOD:4,156-UNIMOD:267,136-UNIMOD:21	0.05	38.0	2	1	0
PRT	sp|P10636|TAU_HUMAN	Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	721-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	455-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	2169-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9NV56|MRGBP_HUMAN	MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	195-UNIMOD:21	0.10	38.0	2	1	0
PRT	sp|Q9Y3Z3|SAMH1_HUMAN	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	15-UNIMOD:385,15-UNIMOD:4,18-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q8TF01|PNISR_HUMAN	Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	209-UNIMOD:28,210-UNIMOD:267,211-UNIMOD:21,218-UNIMOD:188,228-UNIMOD:188	0.03	38.0	2	1	0
PRT	sp|P11166|GTR1_HUMAN	Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	469-UNIMOD:28	0.05	38.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	583-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	626-UNIMOD:21,634-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	592-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|P25440-4|BRD2_HUMAN	Isoform 4 of Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	178-UNIMOD:21,181-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|Q9UEE9-2|CFDP1_HUMAN	Isoform 2 of Craniofacial development protein 1 OS=Homo sapiens OX=9606 GN=CFDP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	135-UNIMOD:188,144-UNIMOD:21,146-UNIMOD:188,150-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|O75113|N4BP1_HUMAN	NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	297-UNIMOD:188,300-UNIMOD:21,314-UNIMOD:188	0.02	37.0	1	1	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	8-UNIMOD:188,9-UNIMOD:21,23-UNIMOD:188,24-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	129-UNIMOD:21	0.17	37.0	2	1	0
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	191-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	91-UNIMOD:21,94-UNIMOD:267,105-UNIMOD:267	0.10	37.0	1	1	1
PRT	sp|O94876-2|TMCC1_HUMAN	Isoform 2 of Transmembrane and coiled-coil domains protein 1 OS=Homo sapiens OX=9606 GN=TMCC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	203-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	208-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|O95819-4|M4K4_HUMAN	Isoform 4 of Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	623-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	178-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	120-UNIMOD:21,123-UNIMOD:188	0.08	37.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1275-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P85298-4|RHG08_HUMAN	Isoform 4 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	424-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	495-UNIMOD:21,500-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	526-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	677-UNIMOD:21	0.03	37.0	1	1	0
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	826-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1378-UNIMOD:21	0.02	37.0	1	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	298-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|O43365|HXA3_HUMAN	Homeobox protein Hox-A3 OS=Homo sapiens OX=9606 GN=HOXA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	173-UNIMOD:21,178-UNIMOD:21,179-UNIMOD:4,184-UNIMOD:21,190-UNIMOD:21,191-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P51826|AFF3_HUMAN	AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	668-UNIMOD:21,670-UNIMOD:21,676-UNIMOD:21,683-UNIMOD:21,691-UNIMOD:21	0.03	37.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RAGGGGGLGAGSPALSGGQGR	1	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	12-UNIMOD:21	ms_run[2]:scan=6578	30.771	2	1818.8486	1818.8486	R	R	10	31
PSM	RAGGGGGLGAGSPALSGGQGR	2	sp|Q6IQ22|RAB12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:267,12-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=6582	30.788	2	1838.8652	1838.8652	R	R	10	31
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	3	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	25-UNIMOD:21	ms_run[2]:scan=13686	64.493	3	3053.4455	3053.4455	R	A	460	493
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	4	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=13831	65.181	3	4344.6117	4344.6117	K	K	156	194
PSM	KLGAGEGGEASVSPEKTSTTSK	5	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	13-UNIMOD:21	ms_run[2]:scan=7328	34.188	2	2200.026	2200.0260	K	G	1328	1350
PSM	SPRPTSAPAITQGQVAEGGVLDASAKK	6	sp|P11171-7|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	5-UNIMOD:21	ms_run[2]:scan=14564	68.91	3	2715.3593	2715.3593	R	T	555	582
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	7	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22239	108.04295666666667	3	3112.591609	3111.608898	R	A	655	686
PSM	KLGAGEGGEASVSPEKTSTTSK	8	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	13-UNIMOD:21	ms_run[2]:scan=5338	25.224	2	2200.026	2200.0260	K	G	1328	1350
PSM	GHYEVTGSDDETGKLQGSGVSLASK	9	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	8-UNIMOD:21	ms_run[2]:scan=12728	59.675	2	2601.1596	2601.1596	K	K	5834	5859
PSM	RTPAPPEPGSPAPGEGPSGR	10	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=6719	31.419	2	1992.9055	1992.9055	R	K	162	182
PSM	HYEDGYPGGSDNYGSLSR	11	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	15-UNIMOD:21	ms_run[2]:scan=11222	51.962	2	2052.7851	2052.7851	R	V	115	133
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	12	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	13-UNIMOD:21	ms_run[2]:scan=21763	105.53	3	3011.4866	3011.4866	R	V	276	304
PSM	SPEKIEEVLSPEGSPSKSPSK	13	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:21	ms_run[2]:scan=12284	57.517	2	2291.0934	2291.0934	K	K	632	653
PSM	GKGGVTGSPEASISGSKGDLK	14	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:21	ms_run[2]:scan=7547	35.117	2	2010.9623	2010.9623	K	S	5724	5745
PSM	GKGGVTGSPEASISGSKGDLK	15	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	8-UNIMOD:21	ms_run[2]:scan=8288	38.347	2	2010.9623	2010.9623	K	S	5724	5745
PSM	HGLTSGSASPPPPALPLYPDPVR	16	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21	ms_run[2]:scan=21395	103.66	2	2405.1781	2405.1781	K	L	683	706
PSM	KASPEPPDSAEGALKLGEEQQR	17	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=13538	63.766	3	2416.1271	2416.1271	R	Q	545	567
PSM	KFSKEEPVSSGPEEAVGK	18	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=8697	40.392	2	1983.9191	1983.9191	R	S	561	579
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	19	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,25-UNIMOD:21,33-UNIMOD:188	ms_run[2]:scan=13836	65.213	3	3065.4858	3065.4858	R	A	460	493
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	20	sp|Q7Z6E9|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	24-UNIMOD:21	ms_run[2]:scan=10876	50.248	3	2868.339	2868.3390	R	S	1254	1282
PSM	NKPLEQSVEDLSKGPPSSVPK	21	sp|O95466|FMNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:188,7-UNIMOD:21,13-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=14551	68.859	2	2333.2014	2333.2014	K	S	178	199
PSM	NLKTEEEEEEEEEEEEDDEEEEGDDEGQK	22	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:188,29-UNIMOD:188	ms_run[2]:scan=11021	51.021	3	3510.3488	3510.3488	R	S	266	295
PSM	NLKTEEEEEEEEEEEEDDEEEEGDDEGQK	23	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=11022	51.024	3	3498.3085	3498.3085	R	S	266	295
PSM	SHSDNDRPNCSWNTQYSSAYYTSR	24	sp|O75494-6|SRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=13515	63.674	3	2975.1566	2975.1566	R	K	157	181
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	25	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22439	109.165355	3	3112.591609	3111.608898	R	A	655	686
PSM	KSEAGHASSPDSEVTSLCQK	26	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,9-UNIMOD:21,18-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=8452	39.174	2	2208.9761	2208.9761	K	E	352	372
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	27	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=20710	100.17	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	28	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:21	ms_run[2]:scan=21560	104.5	3	3011.4866	3011.4866	R	V	276	304
PSM	NKPLEQSVEDLSKGPPSSVPK	29	sp|O95466|FMNL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:21	ms_run[2]:scan=14525	68.718	2	2315.141	2315.1410	K	S	178	199
PSM	NLKTEEEEEEEEEEEEDDEEEEGDDEGQK	30	sp|Q9UKV3-5|ACINU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:188,29-UNIMOD:188	ms_run[2]:scan=10979	50.835	3	3510.3488	3510.3488	R	S	266	295
PSM	RAEDGSVIDYELIDQDAR	31	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=18604	89.79	2	2063.976	2063.9760	R	D	197	215
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	32	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:21	ms_run[2]:scan=9131	42.334	2	2455.0765	2455.0765	R	S	283	308
PSM	QKSPLFQFAEISSSTSHSDASTK	33	sp|Q8WY36|BBX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=22835	111.33853833333333	3	2545.1359	2545.1369	R	Q	241	264
PSM	QHEAPSNRPLNELLTPQGPSPR	34	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=18351	88.5235	3	2500.1864	2500.1855	R	T	167	189
PSM	RNSVERPAEPVAGAATPSLVEQQK	35	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	3-UNIMOD:21	ms_run[1]:scan=30743	162.41509	3	2613.290288	2613.291195	R	M	1454	1478
PSM	GHTASESDEQQWPEEKR	36	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21	ms_run[2]:scan=5721	26.873	2	2092.8487	2092.8487	R	L	1253	1270
PSM	KLGAGEGGEASVSPEKTSTTSK	37	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21	ms_run[2]:scan=5806	27.204	2	2200.026	2200.0260	K	G	1328	1350
PSM	KPSVSEEVQATPNKAGPK	38	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=5575	26.272	2	1945.951	1945.9510	R	L	1027	1045
PSM	KPSVSEEVQATPNKAGPK	39	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:188,3-UNIMOD:21,14-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5365	25.35	2	1964.0114	1964.0114	R	L	1027	1045
PSM	KSEAGHASSPDSEVTSLCQK	40	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8373	38.774	2	2196.9358	2196.9358	K	E	352	372
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	41	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=20930	101.27	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	42	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	13-UNIMOD:21	ms_run[2]:scan=21952	106.54	3	3011.4866	3011.4866	R	V	276	304
PSM	PVSVAGSPLSPGPVRAPLSR	43	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21,15-UNIMOD:267,20-UNIMOD:267	ms_run[2]:scan=17736	85.498	2	2043.0781	2043.0781	R	S	382	402
PSM	RRSASPPPATSSSSSSR	44	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=807	5.4094	2	1876.783	1876.7830	R	R	610	627
PSM	RTPAPPEPGSPAPGEGPSGR	45	sp|P0C1Z6-2|TFPT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,10-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=6751	31.545	2	2012.922	2012.9220	R	K	162	182
PSM	SKADSCSQAAGTKGAEETSWSGEER	46	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=6518	30.493	3	2708.1021	2708.1021	K	A	945	970
PSM	SNSLDKHQQSSTLGNSVVR	47	sp|Q9BZ29-3|DOCK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:21	ms_run[2]:scan=7375	34.376	2	2135.9961	2135.9961	K	C	1273	1292
PSM	SPLEHSSPEKEAPSPEK	48	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	6-UNIMOD:21,10-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=5155	24.444	2	1939.8967	1939.8967	R	T	1109	1126
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	49	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=14042	66.223	3	4344.6117	4344.6117	K	K	156	194
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	50	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	11-UNIMOD:21	ms_run[1]:scan=22415	109.03829499999999	3	3097.566125	3095.580500	R	A	655	686
PSM	QKSPLFQFAEISSSTSHSDASTK	51	sp|Q8WY36|BBX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:28,2-UNIMOD:188,3-UNIMOD:21,23-UNIMOD:188	ms_run[1]:scan=22852	111.42649833333334	3	2557.1775	2557.1771	R	Q	241	264
PSM	AQGGQTQSPTKSHTPSPTSPK	52	sp|P40123-2|CAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21,11-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=1629	8.1333	2	2213.0516	2213.0516	R	S	230	251
PSM	DGRGALQNIIPASTGAAK	53	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15153	71.997	2	1738.9326	1738.9326	R	A	156	174
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	54	sp|O95684-2|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:188,18-UNIMOD:21,21-UNIMOD:188,22-UNIMOD:21,26-UNIMOD:188	ms_run[2]:scan=12096	56.505	3	2810.2911	2810.2911	K	T	139	165
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	55	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	17-UNIMOD:21	ms_run[2]:scan=19674	95.042	3	3393.3457	3393.3457	K	F	86	114
PSM	GKGGVTGSPEASISGSKGDLK	56	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:188,16-UNIMOD:21,17-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7570	35.208	2	2029.0227	2029.0227	K	S	5724	5745
PSM	GRASPGGVSTSSSDGKAEK	57	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=1147	6.436	2	1856.8265	1856.8265	R	S	31	50
PSM	IYHLPDAESDEDEDFKEQTR	58	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=15271	72.603	2	2516.0381	2516.0381	K	L	210	230
PSM	KADSVSSNHTLSSNATR	59	sp|P30989|NTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=2316	10.399	2	1853.8269	1853.8269	R	E	398	415
PSM	KDASDDLDDLNFFNQK	60	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22451	109.22	2	1883.8537	1883.8537	K	K	64	80
PSM	KPSVSEEVQATPNKAGPK	61	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=5346	25.257	2	1945.951	1945.9510	R	L	1027	1045
PSM	LKSPSQKQDGGTAPVASASPK	62	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=2532	11.091	2	2133.0467	2133.0467	K	L	719	740
PSM	NRPDYVSEEEEDDEDFETAVKK	63	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=16546	79.37	3	2723.1123	2723.1123	K	L	2662	2684
PSM	RAEDGSVIDYELIDQDAR	64	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=18464	89.094	2	2083.9925	2083.9925	R	D	197	215
PSM	RNSVERPAEPVAGAATPSLVEQQK	65	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=11834	55.103	3	2613.2912	2613.2912	R	M	1454	1478
PSM	VEPPHSSHEDLTDGLSTR	66	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=11150	51.606	2	2065.8981	2065.8981	K	S	439	457
PSM	VRQLSGQSTSSDTTYKGGASEK	67	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=3754	18.022	3	2366.0751	2366.0751	R	A	534	556
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	68	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17062	82.082	3	2884.3475	2884.3475	K	-	135	164
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	69	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	2-UNIMOD:188,34-UNIMOD:188,38-UNIMOD:188	ms_run[1]:scan=13615	64.115535	4	4363.671496	4362.672086	K	K	156	194
PSM	KGLPLGSAVSSPVLFSPVGR	70	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:188,10-UNIMOD:21,20-UNIMOD:267	ms_run[1]:scan=24050	118.61478999999999	2	2064.116961	2063.115126	R	R	35	55
PSM	AAFSKDESKEPIVEVR	71	sp|P13591-1|NCAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=11402	52.826	2	1883.903	1883.9030	K	T	767	783
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	72	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	26-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=20204	97.619	3	3427.6114	3427.6114	R	E	1242	1275
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	73	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:188,10-UNIMOD:21,21-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=4058	19.495	3	2558.2512	2558.2512	R	E	7	32
PSM	HGGPGPGGPEPELSPITEGSEAR	74	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=14329	67.701	3	2307.0169	2307.0169	R	A	554	577
PSM	HGLTSGSASPPPPALPLYPDPVR	75	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=21362	103.5	2	2415.1863	2415.1863	K	L	683	706
PSM	IEDVGSDEEDDSGKDKK	76	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=2059	9.4854	2	1944.7837	1944.7837	K	K	250	267
PSM	KASATCSSATAAASSGLEEWTSRSPR	77	sp|Q96G74-4|OTUD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=16024	76.575	3	2748.2174	2748.2174	R	Q	207	233
PSM	KASPEPPDSAEGALKLGEEQQR	78	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=13328	62.714	3	2416.1271	2416.1271	R	Q	545	567
PSM	KGLPLGSAVSSPVLFSPVGR	79	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=23661	116.17	2	2047.0867	2047.0867	R	R	35	55
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	80	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=23797	117	3	2896.3631	2896.3631	K	A	2621	2646
PSM	KLGAGEGGEASVSPEKTSTTSK	81	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=6786	31.714	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	82	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=6957	32.498	3	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	83	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=7632	35.489	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	84	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=30720	162.29	3	2200.026	2200.0260	K	G	1328	1350
PSM	KLSDINQEEASGTSLHQK	85	sp|Q4L235-3|ACSF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,3-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=8753	40.634	3	2075.9927	2075.9927	R	A	647	665
PSM	KLSVPTSDEEDEVPAPKPR	86	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12391	58.086	2	2252.9967	2252.9967	K	G	103	122
PSM	KVQVAALQASPPLDQDDR	87	sp|Q9UDY2-4|ZO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12885	60.39	2	1950.0171	1950.0171	R	A	98	116
PSM	LHDFLAHSSEESEETSSPPR	88	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=12571	58.934	3	2413.9465	2413.9465	K	L	18	38
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	89	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=21353	103.46	3	3011.4866	3011.4866	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	90	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=23575	115.65	3	3082.5756	3082.5756	K	A	444	473
PSM	NRPDYVSEEEEDDEDFETAVKK	91	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=16344	78.339	3	2723.1123	2723.1123	K	L	2662	2684
PSM	PGRPLSPANVPALPGETVTSPVR	92	sp|Q8IY33-3|MILK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=20197	97.583	3	2391.2312	2391.2312	K	L	296	319
PSM	RAEDGSVIDYELIDQDAR	93	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18402	88.763	2	2063.976	2063.9760	R	D	197	215
PSM	RDSLGAYASQDANEQGQDLGKR	94	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=11357	52.621	3	2458.0874	2458.0874	K	D	891	913
PSM	RESCGSSVLTDFEGKDVATK	95	sp|O15231-9|ZN185_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=16098	77.018	3	2264.9984	2264.9984	R	V	101	121
PSM	RRGDSESEEDEQDSEEVR	96	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2309	10.378	2	2310.8275	2310.8275	R	L	11	29
PSM	SAPTAPTPPPPPPPATPR	97	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:21	ms_run[2]:scan=10238	47.499	2	1827.892	1827.8921	R	K	799	817
PSM	SHSSPSLHQDEAPTTAK	98	sp|Q8NDX1-2|PSD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=2729	11.908	2	1871.8051	1871.8051	K	V	988	1005
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	99	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=9113	42.248	3	2455.0765	2455.0765	R	S	283	308
PSM	SHYADVDPENQNFLLESNLGKK	100	sp|Q96QD8|S38A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21,21-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=18704	90.273	3	2609.2202	2609.2202	K	K	39	61
PSM	SKSYNTPLLNPVQEHEAEGAAAGGTSIR	101	sp|P85299-2|PRR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=17442	83.99	3	2976.3978	2976.3978	R	R	151	179
PSM	SLSEEKEDHSDGLAGLK	102	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10500	48.679	2	1893.8357	1893.8357	R	G	874	891
PSM	SPLLAGGSPPQPVVPAHK	103	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=14614	69.158	2	1830.9393	1830.9393	R	D	49	67
PSM	SVIYHALSQKEANDSDVQPSGAQR	104	sp|O95707|RPP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21	ms_run[2]:scan=11601	53.759	3	2679.229	2679.2290	K	A	3	27
PSM	TPSPKEEDEEPESPPEKK	105	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:188,13-UNIMOD:21,17-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=2451	10.848	2	2149.9802	2149.9802	K	T	202	220
PSM	VAAAAGSGPSPPGSPGHDRER	106	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3573	17.103	2	2131.8838	2131.8838	R	Q	38	59
PSM	VASEAPLEHKPQVEASSPR	107	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=7187	33.517	2	2111.0048	2111.0048	K	L	853	872
PSM	WPFSGKTSPPCSPANLSR	108	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18955	91.502	2	2067.9238	2067.9238	R	H	336	354
PSM	QHEAPSNRPLNELLTPQGPSPR	109	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=18299	88.23011833333334	3	2520.2044	2520.2020	R	T	167	189
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	110	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:21	ms_run[1]:scan=22940	111.92131166666667	4	4535.108526	4535.111625	R	Q	475	520
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	111	sp|Q96TA1-2|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=21932	106.43	3	3095.5805	3095.5805	R	A	642	673
PSM	GPKPEPPGSGSPAPPR	112	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=4056	19.49	2	1606.7505	1606.7505	R	R	652	668
PSM	GRTSSTNEDEDLNPEQKIER	113	sp|Q99081-4|HTF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=9556	44.154	2	2397.0445	2397.0445	R	E	319	339
PSM	HGGPGPGGPEPELSPITEGSEAR	114	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=14370	67.902	3	2317.0251	2317.0251	R	A	554	577
PSM	IYHLPDAESDEDEDFKEQTR	115	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=15081	71.588	2	2516.0381	2516.0381	K	L	210	230
PSM	KDSNELSDSAGEEDSADLKR	116	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=7382	34.407	3	2244.9383	2244.9383	K	A	709	729
PSM	KFSKEEPVSSGPEEAVGK	117	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=9604	44.35	2	2063.8854	2063.8854	R	S	561	579
PSM	KKIPDPDSDDVSEVDAR	118	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9521	43.997	2	2044.8392	2044.8392	K	H	688	705
PSM	KLGAGEGGEASVSPEKTSTTSK	119	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=4195	20.09	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	120	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=4811	22.991	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	121	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=4858	23.209	3	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	122	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=6529	30.542	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	123	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=7037	32.866	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLSVPTSDEEDEVPAPKPR	124	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12609	59.14	2	2252.9967	2252.9967	K	G	103	122
PSM	LREDENAEPVGTTYQK	125	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=6016	28.115	2	1848.8854	1848.8854	R	T	150	166
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	126	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=22141	107.55	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	127	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=22521	109.59	3	3011.4866	3011.4866	R	V	276	304
PSM	NEEPSEEEIDAPKPKK	128	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=5408	25.552	2	1918.8561	1918.8561	K	M	117	133
PSM	NKPGPNIESGNEDDDASFK	129	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	2-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=9721	44.912	2	2124.904	2124.9040	K	I	206	225
PSM	RPAEATSSPTSPERPR	130	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=1785	8.6044	2	1897.8085	1897.8085	R	H	210	226
PSM	RSASPDDDLGSSNWEAADLGNEERK	131	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=15771	75.257	3	2798.1781	2798.1781	K	Q	14	39
PSM	SAPTAPTPPPPPPPATPR	132	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	7-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=10157	47.092	2	1837.9003	1837.9003	R	K	799	817
PSM	SHSSPSLHQDEAPTTAK	133	sp|Q8NDX1-2|PSD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=2701	11.822	2	1877.8252	1877.8252	K	V	988	1005
PSM	SPSPAHLPDDPKVAEK	134	sp|Q92615|LAR4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=8543	39.615	2	1778.8643	1778.8643	R	Q	599	615
PSM	SQSSSQFRSQGKPIELTPLPLLK	135	sp|Q16537-2|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=24933	124.31	3	2700.3289	2700.3289	R	D	30	53
PSM	SRTHSTSSSLGSGESPFSR	136	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=10459	48.517	2	2125.8467	2125.8467	R	S	238	257
PSM	SSGREKPDSDDDLDIASLVTAK	137	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=20458	98.889	3	2398.0901	2398.0901	K	L	651	673
PSM	TPVQYSQQQNSPQKHK	138	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=1762	8.5381	2	1976.9106	1976.9106	K	N	347	363
PSM	TVFPGAVPVLPASPPPKDSLR	139	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=21937	106.45	2	2224.1657	2224.1657	K	S	217	238
PSM	VHAYFAPVTPPPSVGGSR	140	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=16276	77.972	2	1917.9138	1917.9138	K	Q	377	395
PSM	NVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR	141	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	44-UNIMOD:188,49-UNIMOD:188,50-UNIMOD:267	ms_run[1]:scan=11520	53.39486166666667	6	5940.1172	5938.1102	K	K	231	281
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	142	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	11-UNIMOD:21	ms_run[1]:scan=22236	108.02893166666667	3	3096.563686	3095.580500	R	A	655	686
PSM	RVSTDLPEGQDVYTAACNSVIHR	143	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,17-UNIMOD:4,23-UNIMOD:267	ms_run[1]:scan=19750	95.39170166666668	3	2689.232425	2687.227768	R	C	1426	1449
PSM	RSASPDDDLGSSNWEAADLGNEERK	144	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	2-UNIMOD:21	ms_run[1]:scan=15974	76.328515	3	2799.177264	2798.178075	K	Q	14	39
PSM	AADEDEKKAAAGPLDMSLPSTPDIK	145	sp|P17544-4|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:188,8-UNIMOD:188,21-UNIMOD:21,25-UNIMOD:188	ms_run[2]:scan=19507	94.221	3	2667.2849	2667.2849	K	I	81	106
PSM	AGLESGAEPGDGDSDTTKKK	146	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=2452	10.85	2	2041.8841	2041.8841	K	K	481	501
PSM	AKSPTPESSTIASYVTLRK	147	sp|Q9HAU0-5|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=16822	80.767	3	2115.0613	2115.0613	R	T	797	816
PSM	AQNEFKDEAQSLSHSPK	148	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=9569	44.205	2	1994.8735	1994.8735	R	R	507	524
PSM	DASDDLDDLNFFNQKK	149	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=22978	112.15	2	1883.8537	1883.8537	K	K	65	81
PSM	FHALSSPQSPFPSTPTSR	150	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=15222	72.347	2	2022.9201	2022.9201	K	R	1539	1557
PSM	GEVPGGSAHYGGPSPEKK	151	sp|O94762|RECQ5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=4865	23.225	2	1832.8094	1832.8094	R	A	714	732
PSM	GGNFGFGDSRGGGGNFGPGPGSNFR	152	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=19363	93.513	3	2451.0142	2451.0142	R	G	192	217
PSM	GHYEVTGSDDETGKLQGSGVSLASK	153	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=13195	62.003	3	2601.1596	2601.1596	K	K	5834	5859
PSM	GLAEVQQDGEAEEGATSDGEKKR	154	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=8158	37.741	2	2483.0813	2483.0813	K	E	477	500
PSM	GLKEGMNPSYDEYADSDEDQHDAYLER	155	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=15376	73.209	3	3226.271	3226.2710	R	M	429	456
PSM	HCAPSPDRSPELSSSR	156	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3988	19.133	2	1941.7442	1941.7442	R	D	622	638
PSM	HIKEEPLSEEEPCTSTAIASPEK	157	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=12416	58.19	3	2753.1947	2753.1947	K	K	495	518
PSM	IDASKNEEDEGHSNSSPR	158	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=1027	6.0756	2	2050.8229	2050.8229	K	H	68	86
PSM	IHIDPEIQDGSPTTSR	159	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=11913	55.519	2	1844.8306	1844.8306	R	R	102	118
PSM	IPPAAEPPAHLVNSPLSAPLSPSSTGTCPR	160	sp|Q5T6C5|AT7L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	21-UNIMOD:21,28-UNIMOD:4,30-UNIMOD:267	ms_run[2]:scan=20466	98.931	3	3110.5136	3110.5136	K	L	455	485
PSM	KAGLASPEEEDAVGKEPLK	161	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=11208	51.905	3	2046.9875	2046.9875	K	A	1143	1162
PSM	KETTSGTSTEPVKNSSPAPPQPAPGK	162	sp|Q9NYV4-3|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=3786	18.181	3	2672.2695	2672.2695	R	V	1067	1093
PSM	KGLPLGSAVSSPVLFSPVGR	163	sp|Q8WUM0|NU133_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=24055	118.64	2	2047.0867	2047.0867	R	R	35	55
PSM	KLEKEEEEGISQESSEEEQ	164	sp|P17096-2|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21	ms_run[2]:scan=5801	27.184	2	2315.953	2315.9530	K	-	78	97
PSM	KLGAGEGGEASVSPEKTSTTSK	165	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=6301	29.46	2	2200.026	2200.0260	K	G	1328	1350
PSM	KLGAGEGGEASVSPEKTSTTSK	166	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=29986	157.73	3	2200.026	2200.0260	K	G	1328	1350
PSM	KLSVPTSDEEDEVPAPKPR	167	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12324	57.715	3	2252.9967	2252.9967	K	G	103	122
PSM	KSLDSDESEDEEDDYQQKR	168	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=4863	23.22	2	2394.9337	2394.9337	K	K	56	75
PSM	KSSTVATLQGTPDHGDPR	169	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=6033	28.192	2	1945.8895	1945.8895	R	T	154	172
PSM	KVEEEGSPGDPDHEASTQGR	170	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=2044	9.4389	2	2203.9019	2203.9019	R	T	309	329
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	171	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	32-UNIMOD:188,36-UNIMOD:188	ms_run[2]:scan=13460	63.366	3	4129.4886	4129.4886	K	K	158	194
PSM	LGAGGGSPEKSPSAQELKEQGNR	172	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=7237	33.737	2	2376.1071	2376.1071	R	L	13	36
PSM	LGAGGGSPEKSPSAQELKEQGNR	173	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=7480	34.804	2	2376.1071	2376.1071	R	L	13	36
PSM	NHLLQFALESPAKSPASSSSK	174	sp|Q9NS91|RAD18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,13-UNIMOD:188,14-UNIMOD:21,21-UNIMOD:188	ms_run[2]:scan=18733	90.408	3	2370.1061	2370.1061	R	N	90	111
PSM	RASQGLLSSIENSESDSSEAKEEGSR	175	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=16452	78.872	3	2832.2411	2832.2411	R	K	1540	1566
PSM	RIPSIVSSPLNSPLDR	176	sp|P49790-3|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:267,8-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=21053	101.92	2	1849.9566	1849.9566	K	S	327	343
PSM	RSSSPAELDLKDDLQQTQGK	177	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=14125	66.658	2	2295.0744	2295.0744	R	C	818	838
PSM	RVSTDLPEGQDVYTAACNSVIHR	178	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=19721	95.269	3	2667.2112	2667.2112	R	C	1426	1449
PSM	SAPTAPTPPPPPPPATPR	179	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=9751	45.04	2	1837.9003	1837.9003	R	K	799	817
PSM	SGEAKEAASSSSGTQPAPPAPASPWDSKK	180	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=10596	49.066	3	2905.3131	2905.3131	R	H	526	555
PSM	SPLLAGGSPPQPVVPAHK	181	sp|Q8NFH5-2|NUP35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=14667	69.402	2	1836.9595	1836.9595	R	D	49	67
PSM	TDSQSVRHSPIAPSSPSPQVLAQK	182	sp|Q9NQS7-2|INCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=11067	51.213	3	2596.2646	2596.2646	R	Y	298	322
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGKR	183	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=15835	75.578	3	3081.3482	3081.3482	R	L	67	94
PSM	TSSESIYSRPGSSIPGSPGHTIYAK	184	sp|O14639-3|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=13995	66.012	2	2658.2327	2658.2327	R	V	35	60
PSM	VAPEEHPVLLTEAPLNPK	185	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:188	ms_run[2]:scan=16852	80.916	2	1959.0773	1959.0773	R	A	96	114
PSM	VHAYFAPVTPPPSVGGSR	186	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=16153	77.306	2	1927.9221	1927.9221	K	Q	377	395
PSM	VTKNEEPSEEEIDAPKPK	187	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=6516	30.487	2	2118.9722	2118.9722	K	K	114	132
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	188	sp|Q9Y679|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	13-UNIMOD:21	ms_run[1]:scan=20284	98.01674833333333	3	3012.489316	3011.486600	R	V	276	304
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	189	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7594	35.31445166666666	3	3007.3294	3007.3290	K	S	145	174
PSM	VQAYEEPSVASSPNGKESDLRR	190	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=10170	47.163243333333334	2	2499.126929	2498.143862	R	S	719	741
PSM	AQGEPVAGHESPKIPYEK	191	sp|O94979-7|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21,13-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9553	44.14	2	2027.9756	2027.9756	R	Q	522	540
PSM	AQNEFKDEAQSLSHSPK	192	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:188,15-UNIMOD:21,17-UNIMOD:188	ms_run[2]:scan=9586	44.283	2	2006.9138	2006.9138	R	R	507	524
PSM	AQPSDNAPAKGNKSPSPPDGSPAATPEIR	193	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=9046	41.945	3	2936.3665	2936.3665	K	V	252	281
PSM	ATPTKAPAPVVLGSPVVLGPPVGQAR	194	sp|Q6ZN55|ZN574_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=21092	102.1	3	2558.3986	2558.3986	R	V	151	177
PSM	DASDDLDDLNFFNQKK	195	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23153	113.16	2	1883.8537	1883.8537	K	K	65	81
PSM	EKTATCHSSSSPPIDAASAEPYGFR	196	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=14080	66.447	3	2745.1742	2745.1742	K	A	1809	1834
PSM	FYETKEESYSPSKDR	197	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=6721	31.431	2	1944.8143	1944.8143	K	N	212	227
PSM	GQSTGKGPPQSPVFEGVYNNSR	198	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=13742	64.771	3	2385.0751	2385.0751	R	M	101	123
PSM	GRDVESVQTPSKAVGASFPLYEPAK	199	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=18747	90.462	3	2712.316	2712.3160	K	M	320	345
PSM	GSDHSASLEPGELAELVR	200	sp|Q9NR45|SIAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21462	104.02	2	1865.9119	1865.9119	K	S	247	265
PSM	GSRPPLILQSQSLPCSSPR	201	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=16542	79.353	2	2159.0558	2159.0558	K	D	290	309
PSM	GTSRVDDKPSSPGDSSK	202	sp|Q9HC52|CBX8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=894	5.6688	2	1798.7735	1798.7735	R	K	181	198
PSM	HGLTSGSASPPPPALPLYPDPVR	203	sp|Q92610|ZN592_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,23-UNIMOD:267	ms_run[2]:scan=21676	105.09	3	2415.1863	2415.1863	K	L	683	706
PSM	HIKEEPLSEEEPCTSTAIASPEK	204	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:188	ms_run[2]:scan=12477	58.498	2	2753.1947	2753.1947	K	K	495	518
PSM	HTGPNSPDTANDGFVR	205	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=7462	34.732	2	1773.7347	1773.7347	K	L	99	115
PSM	KADSVSSNHTLSSNATR	206	sp|P30989|NTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=2307	10.373	2	1853.8269	1853.8269	R	E	398	415
PSM	KPIKYLEESDEDDLF	207	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,4-UNIMOD:188,9-UNIMOD:21	ms_run[2]:scan=21489	104.15	2	1931.8844	1931.8844	K	-	1517	1532
PSM	KQSLGEDHVILEEQK	208	sp|Q9HBD1|RC3H2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=10506	48.704	2	1831.8717	1831.8717	K	T	1117	1132
PSM	KSASDASISSGTHGQYSILQTAR	209	sp|O15056-3|SYNJ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=12854	60.25	3	2444.1333	2444.1333	K	L	1121	1144
PSM	KSEAGHASSPDSEVTSLCQK	210	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:188,9-UNIMOD:21,18-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=8334	38.595	3	2208.9761	2208.9761	K	E	352	372
PSM	KSGVSSDNEDDDDEEDGNYLHPSLFASK	211	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21	ms_run[2]:scan=17829	85.977	3	3149.2623	3149.2623	K	K	278	306
PSM	KVEEEGSPGDPDHEASTQGR	212	sp|Q9NZT2-2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=2032	9.4043	3	2203.9019	2203.9019	R	T	309	329
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	213	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=19634	94.838	3	2948.4532	2948.4532	R	R	129	157
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	214	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=22703	110.59	3	3011.4866	3011.4866	R	V	276	304
PSM	LRPQSAQSSFPPSPGPSPDVQLATLAQR	215	sp|Q9Y679-3|AUP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=22880	111.6	3	3011.4866	3011.4866	R	V	276	304
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	216	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=23472	115.03	3	3062.559	3062.5590	K	A	444	473
PSM	LTATPAKPTKSENDASSENEQLLSR	217	sp|Q9UNE0|EDAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=9793	45.233	2	2766.3073	2766.3073	K	S	258	283
PSM	RASEEEENKASEEYIQR	218	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6794	31.752	2	2146.9168	2146.9168	R	L	132	149
PSM	RDSSESQLASTESDKPTTGR	219	sp|Q96B23-2|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=4966	23.623	3	2230.9703	2230.9703	R	V	64	84
PSM	RIDFIPVSPAPSPTR	220	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=18782	90.622	2	1731.8709	1731.8709	K	G	136	151
PSM	RIPSIVSSPLNSPLDR	221	sp|P49790-3|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,8-UNIMOD:21,16-UNIMOD:267	ms_run[2]:scan=20852	100.89	2	1849.9566	1849.9566	K	S	327	343
PSM	RSSFSEGQTLTVTSGAKK	222	sp|Q92622-3|RUBIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=8852	41.114	2	1962.9412	1962.9412	R	S	386	404
PSM	SFGTRPLSSGFSPEEAQQQDEEFEKK	223	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=17992	86.849	3	3037.3342	3037.3342	R	I	976	1002
PSM	SKGPSAAGEQEPDKESGASVDEVAR	224	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=6939	32.432	3	2580.1341	2580.1341	K	Q	45	70
PSM	SPSGSQRPSVSDDTEHLVNGR	225	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=9688	44.768	2	2304.0132	2304.0132	R	M	1356	1377
PSM	SQRYSGAYGASVSDEELKR	226	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=10778	49.854	3	2181.9692	2181.9692	K	R	46	65
PSM	SQRYSGAYGASVSDEELKR	227	sp|Q9NX63|MIC19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=10829	50.017	2	2181.9692	2181.9692	K	R	46	65
PSM	SRSIEDDEEGHLICQSGDVLR	228	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:267,3-UNIMOD:21,14-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=16713	80.187	3	2514.0961	2514.0961	R	A	136	157
PSM	TDHGAEIVYKSPVVSGDTSPR	229	sp|P10636|TAU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	19-UNIMOD:21	ms_run[2]:scan=11715	54.453	3	2294.058	2294.0580	K	H	703	724
PSM	TGSDHTNPTSPLLVKPSDLLEENK	230	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=21188	102.59	3	2671.2742	2671.2742	R	I	446	470
PSM	TSSKESSPIPSPTSDRK	231	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	11-UNIMOD:21	ms_run[2]:scan=4286	20.501	2	1882.8674	1882.8674	R	A	2159	2176
PSM	TVFPGAVPVLPASPPPKDSLR	232	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=21745	105.44	2	2224.1657	2224.1657	K	S	217	238
PSM	TVIRLPSGSGAASPTGSAVDIR	233	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=17388	83.708	2	2191.0998	2191.0998	K	A	204	226
PSM	VAPEEHPVLLTEAPLNPK	234	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:188	ms_run[2]:scan=16651	79.884	2	1959.0773	1959.0773	R	A	96	114
PSM	VTDKVLTANSNPSSPSAAKR	235	sp|Q9NV56|MRGBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=5593	26.35	3	2122.042	2122.0420	R	R	182	202
PSM	VTDKVLTANSNPSSPSAAKR	236	sp|Q9NV56|MRGBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21	ms_run[2]:scan=5609	26.407	2	2122.042	2122.0420	R	R	182	202
PSM	WPFSGKTSPPCSPANLSR	237	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18754	90.493	2	2067.9238	2067.9238	R	H	336	354
PSM	CDDSPRTPSNTPSAEADWSPGLELHPDYK	238	sp|Q9Y3Z3|SAMH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=21502	104.21233333333333	3	3304.3620	3304.3651	R	T	15	44
PSM	QRSPIALPVKQEPPQIDAVK	239	sp|Q8TF01|PNISR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,2-UNIMOD:267,3-UNIMOD:21,10-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=18545	89.51174166666667	3	2298.2431	2298.2410	R	R	209	229
PSM	QRSPIALPVKQEPPQIDAVK	240	sp|Q8TF01|PNISR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,2-UNIMOD:267,3-UNIMOD:21,10-UNIMOD:188,20-UNIMOD:188	ms_run[1]:scan=18556	89.56233166666667	3	2298.2431	2298.2410	R	R	209	229
PSM	IYHLPDAESDEDEDFKEQTR	241	sp|Q15019|SEPT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:21,16-UNIMOD:188,20-UNIMOD:267	ms_run[1]:scan=15522	73.98366333333333	3	2532.066183	2532.066457	K	L	210	230
PSM	QGGASQSDKTPEELFHPLGADSQV	242	sp|P11166|GTR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28	ms_run[1]:scan=22607	110.0502	2	2480.1453	2480.1450	R	-	469	493
PSM	AQESGQGSTAGPLRPPPPGAGGPATPSK	243	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	25-UNIMOD:21	ms_run[2]:scan=9096	42.153	3	2649.2548	2649.2548	K	A	559	587
PSM	AQPSDNAPAKGNKSPSPPDGSPAATPEIR	244	sp|O00499-9|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=8813	40.915	3	2936.3665	2936.3665	K	V	252	281
PSM	AQQRAESPESSAIESTQSTPQKGR	245	sp|Q9NTI5|PDS5B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=6151	28.718	3	2652.2141	2652.2141	R	G	1352	1376
PSM	ATKIPCESPPLEVVDTTASTKR	246	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=15335	72.985	3	2479.203	2479.2030	K	H	2701	2723
PSM	DASDDLDDLNFFNQKK	247	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=22985	112.19	2	1895.894	1895.8940	K	K	65	81
PSM	FHALSSPQSPFPSTPTSR	248	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=16363	78.431	2	2022.9201	2022.9201	K	R	1539	1557
PSM	FHALSSPQSPFPSTPTSR	249	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=15215	72.308	2	2032.9283	2032.9283	K	R	1539	1557
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	250	sp|P49848-4|TAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=14834	70.314	3	2762.2735	2762.2735	K	Q	609	638
PSM	HGSGADSDYENTQSGDPLLGLEGKR	251	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=16880	81.068	3	2682.1559	2682.1559	R	F	590	615
PSM	HIKEEPLSEEEPCTSTAIASPEK	252	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,14-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=12496	58.571	2	2741.1544	2741.1544	K	K	495	518
PSM	HKAAAYDISEDEED	253	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=8241	38.14	2	1671.6301	1671.6301	R	-	354	368
PSM	HKAAAYDISEDEED	254	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=8447	39.154	2	1671.6301	1671.6301	R	-	354	368
PSM	HKAAAYDISEDEED	255	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	2-UNIMOD:188,9-UNIMOD:21	ms_run[2]:scan=8248	38.179	2	1677.6503	1677.6503	R	-	354	368
PSM	KADTTTPTPTAILAPGSPASPPGSLEPK	256	sp|P25440-4|BRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=20109	97.165	3	2861.3501	2861.3501	R	A	162	190
PSM	KGEETEETSSSKLLVK	257	sp|Q9UEE9-2|CFDP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,10-UNIMOD:21,12-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=7218	33.648	2	1861.942	1861.9420	K	A	135	151
PSM	KLGAGEGGEASVSPEKTSTTSK	258	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=6229	29.085	3	2200.026	2200.0260	K	G	1328	1350
PSM	KPIKYLEESDEDDLF	259	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,4-UNIMOD:188,9-UNIMOD:21	ms_run[2]:scan=21692	105.17	2	1931.8844	1931.8844	K	-	1517	1532
PSM	KQFSLENVQEGEILHDAK	260	sp|O75113|N4BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,4-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=18511	89.343	3	2176.0604	2176.0604	K	T	297	315
PSM	KQSFDDNDSEELEDKDSK	261	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,9-UNIMOD:21,15-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=6340	29.657	2	2225.9347	2225.9347	K	S	105	123
PSM	KSPGVAAAVAEDGGLKK	262	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,2-UNIMOD:21,16-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=9880	45.675	3	1694.9102	1694.9102	R	C	8	25
PSM	LGAGGGSPEKSPSAQELKEQGNR	263	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=6585	30.804	2	2376.1071	2376.1071	R	L	13	36
PSM	LLKEGEEPTVYSDEEEPKDESAR	264	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=10886	50.298	3	2729.1957	2729.1957	K	K	118	141
PSM	LLKEGEEPTVYSDEEEPKDESAR	265	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=10959	50.704	2	2729.1957	2729.1957	K	K	118	141
PSM	LQALAEEPSQPHTRSPAK	266	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=7062	32.974	2	2038.9837	2038.9837	K	N	177	195
PSM	LQQGAGLESPQGQPEPGAASPQRQQDLHLESPQR	267	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	20-UNIMOD:21,23-UNIMOD:267,34-UNIMOD:267	ms_run[2]:scan=13727	64.693	3	3733.7713	3733.7713	R	Q	72	106
PSM	LTATPAKPTKSENDASSENEQLLSR	268	sp|Q9UNE0|EDAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21	ms_run[2]:scan=9712	44.869	3	2766.3073	2766.3073	K	S	258	283
PSM	NHLLQFALESPAKSPASSSSK	269	sp|Q9NS91|RAD18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=18697	90.233	3	2358.0658	2358.0658	R	N	90	111
PSM	NKFGSADNIPNLKDSLEEGQVDDAGK	270	sp|O94876-2|TMCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=19420	93.806	3	2840.2866	2840.2866	R	A	199	225
PSM	RDSAYGSFSTSSSTPDHTLSK	271	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=10581	49.003	3	2309.9801	2309.9801	K	A	206	227
PSM	RIDFIPVSPAPSPTR	272	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,8-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=20493	99.07	2	1831.8538	1831.8538	K	G	136	151
PSM	RIPSIVSSPLNSPLDR	273	sp|P49790-3|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=20868	100.97	2	1829.9401	1829.9401	K	S	327	343
PSM	RPASPSSPEHLPATPAESPAQR	274	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9890	45.726	3	2442.073	2442.0730	K	F	231	253
PSM	SPRPTSAPAITQGQVAEGGVLDASAKK	275	sp|P11171-7|41_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:267,5-UNIMOD:21,26-UNIMOD:188,27-UNIMOD:188	ms_run[2]:scan=14652	69.341	3	2737.4078	2733.4197	R	T	555	582
PSM	SQSSHSYDDSTLPLIDRNQK	276	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21	ms_run[2]:scan=12904	60.482	3	2370.0489	2370.0489	R	S	752	772
PSM	SRSIEDDEEGHLICQSGDVLR	277	sp|Q9HAZ1|CLK4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=16704	80.138	3	2494.0795	2494.0795	R	A	136	157
PSM	SSSKSEGSPSQRLENAVK	278	sp|O95819-4|M4K4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=9332	43.242	2	1969.9106	1969.9106	R	K	623	641
PSM	SSSPGKPQAVSSLNSSHSR	279	sp|Q9UHB7|AFF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21	ms_run[2]:scan=3838	18.443	2	1991.9062	1991.9062	R	S	178	197
PSM	TAHNSEADLEESFNEHELEPSSPK	280	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	21-UNIMOD:21,24-UNIMOD:188	ms_run[2]:scan=16675	80.008	3	2782.1703	2782.1703	K	S	100	124
PSM	TGSGSPFAGNSPAREGEQDAASLKDVFK	281	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=22405	108.98	3	2902.3134	2902.3134	K	G	1265	1293
PSM	TQATGLTKPTLPPSPLMAAR	282	sp|P85298-4|RHG08_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=18354	88.533	3	2130.0908	2130.0908	R	R	411	431
PSM	VAPERDGKSPTVPCLQEEAGEPLGGK	283	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=14739	69.817	3	2800.3103	2800.3103	K	G	487	513
PSM	VEPPHSSHEDLTDGLSTR	284	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=11158	51.648	2	2055.8899	2055.8899	K	S	439	457
PSM	VQSLEGEKLSPKSDISPLTPR	285	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=16527	79.271	2	2360.1989	2360.1989	K	E	1770	1791
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	286	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	24-UNIMOD:21	ms_run[2]:scan=8170	37.798	3	2664.2293	2664.2293	R	R	503	531
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	287	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	32-UNIMOD:188,36-UNIMOD:188,37-UNIMOD:188	ms_run[1]:scan=28141	146.42543666666666	4	4265.604793	4263.603672	K	S	158	195
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	288	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22240	108.04642833333334	4	3112.592030	3111.608898	R	A	655	686
PSM	EAAAQEAGADTPGKGEPPAPKSPPK	289	sp|O95466|FMNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	22-UNIMOD:21	ms_run[1]:scan=6251	29.214540000000003	3	2481.161890	2480.158449	K	A	1010	1035
PSM	SPEKIEEVLSPEGSPSKSPSK	290	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=12088	56.458371666666665	3	2292.096308	2291.093389	K	K	664	685
PSM	SAPTAPTPPPPPPPATPR	291	sp|Q14202|ZMYM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:21	ms_run[1]:scan=9840	45.454188333333335	2	1828.895547	1827.892051	R	K	811	829
PSM	QHEAPSNRPLNELLTPQGPSPR	292	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=16415	78.67007833333334	3	2520.2023	2520.2020	R	T	167	189
PSM	KLGAGEGGEASVSPEKTSTTSK	293	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=4581	21.975395000000002	2	2201.036271	2200.026038	K	G	1366	1388
PSM	LSSQISAGEEKWNSVSPASAGKR	294	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21	ms_run[1]:scan=15083	71.5999	3	2469.154455	2468.169682	K	K	293	316
PSM	ATPTKAPAPVVLGSPVVLGPPVGQAR	295	sp|Q6ZN55|ZN574_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=21388	103.62752166666667	3	2559.388981	2558.398560	R	V	151	177
PSM	TSSSSSGESCAGDKSPPGQASSK	296	sp|O43365|HXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=6515	30.484898333333334	2	2599.793626	2597.770989	K	R	170	193
PSM	IVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSK	297	sp|P51826|AFF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:21,34-UNIMOD:21	ms_run[1]:scan=26389	134.38565833333334	4	4267.612338	4264.611684	R	A	658	693