MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH17.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH17.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	52.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.23	52.0	10	2	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	127-UNIMOD:21,161-UNIMOD:267,105-UNIMOD:21,110-UNIMOD:21	0.13	48.0	2	2	2
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	153-UNIMOD:21	0.11	47.0	1	1	1
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	161-UNIMOD:21,149-UNIMOD:188,164-UNIMOD:188	0.06	46.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	561-UNIMOD:188,564-UNIMOD:188,570-UNIMOD:21,578-UNIMOD:188	0.03	46.0	2	1	0
PRT	sp|Q8IXQ4-4|GPAM1_HUMAN	Isoform 4 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	78-UNIMOD:188,100-UNIMOD:188	0.14	46.0	5	1	0
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	452-UNIMOD:267,455-UNIMOD:21,472-UNIMOD:267,463-UNIMOD:21	0.04	46.0	2	1	0
PRT	sp|Q5HYK7|SH319_HUMAN	SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	268-UNIMOD:385,268-UNIMOD:4,275-UNIMOD:21	0.04	46.0	2	1	0
PRT	sp|P17600-2|SYN1_HUMAN	Isoform IB of Synapsin-1 OS=Homo sapiens OX=9606 GN=SYN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	427-UNIMOD:21,430-UNIMOD:267,446-UNIMOD:267	0.03	45.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	922-UNIMOD:21,929-UNIMOD:188	0.02	45.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1243-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|Q6F5E8-2|CARL2_HUMAN	Isoform 2 of Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1267-UNIMOD:267,1279-UNIMOD:21,1287-UNIMOD:4,1288-UNIMOD:267	0.02	45.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.01	44.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	2718-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	49-UNIMOD:21	0.09	44.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	297-UNIMOD:188,303-UNIMOD:188,307-UNIMOD:21,311-UNIMOD:188,306-UNIMOD:21	0.04	44.0	2	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	417-UNIMOD:21	0.06	43.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	410-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	498-UNIMOD:21,500-UNIMOD:21	0.02	43.0	2	1	0
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	312-UNIMOD:21,311-UNIMOD:21,315-UNIMOD:267	0.08	42.0	2	1	0
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	315-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	354-UNIMOD:21	0.07	42.0	1	1	1
PRT	sp|Q96KQ4|ASPP1_HUMAN	Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	710-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	292-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	54-UNIMOD:21	0.20	42.0	1	1	1
PRT	sp|Q2M2I8-2|AAK1_HUMAN	Isoform 2 of AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	637-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P29474|NOS3_HUMAN	Nitric oxide synthase, endothelial OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	634-UNIMOD:21	0.01	42.0	1	1	1
PRT	sp|P28749-2|RBL1_HUMAN	Isoform 2 of Retinoblastoma-like protein 1 OS=Homo sapiens OX=9606 GN=RBL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	762-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	662-UNIMOD:267,665-UNIMOD:21,685-UNIMOD:188	0.04	42.0	2	1	0
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	153-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	304-UNIMOD:21,307-UNIMOD:188,308-UNIMOD:188	0.08	41.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1690-UNIMOD:21,1696-UNIMOD:267	0.01	41.0	1	1	1
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	189-UNIMOD:21	0.09	41.0	1	1	1
PRT	sp|Q9UJF2|NGAP_HUMAN	Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	634-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	712-UNIMOD:21,716-UNIMOD:4	0.02	41.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	907-UNIMOD:21,820-UNIMOD:21	0.04	41.0	2	2	2
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	385-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.05	41.0	1	1	1
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	14-UNIMOD:21,21-UNIMOD:188	0.06	41.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	362-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	719-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	49-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	223-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	575-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q96PU5-4|NED4L_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	220-UNIMOD:4,221-UNIMOD:21,218-UNIMOD:267,241-UNIMOD:267	0.03	40.0	2	1	0
PRT	sp|Q13425|SNTB2_HUMAN	Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	391-UNIMOD:4,392-UNIMOD:267,393-UNIMOD:21,405-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	436-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	143-UNIMOD:21,147-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	266-UNIMOD:21,264-UNIMOD:267,278-UNIMOD:267	0.05	40.0	2	1	0
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	114-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	340-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	698-UNIMOD:21,703-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.11	40.0	1	1	1
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	471-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	12-UNIMOD:21	0.16	40.0	1	1	1
PRT	sp|Q9UHB6-5|LIMA1_HUMAN	Isoform 5 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	445-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	355-UNIMOD:21,376-UNIMOD:188	0.07	40.0	1	1	1
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	118-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	445-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	527-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	309-UNIMOD:188,317-UNIMOD:21,327-UNIMOD:188	0.04	39.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	614-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	315-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9BWF3-3|RBM4_HUMAN	Isoform 3 of RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	88-UNIMOD:21,89-UNIMOD:4	0.12	39.0	1	1	1
PRT	sp|Q8NEV8-2|EXPH5_HUMAN	Isoform 2 of Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1700-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	139-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q7Z309-4|F122B_HUMAN	Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	134-UNIMOD:21,138-UNIMOD:21	0.08	39.0	1	1	1
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	347-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	127-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	118-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	2048-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	643-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	306-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1400-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q7Z2K8|GRIN1_HUMAN	G protein-regulated inducer of neurite outgrowth 1 OS=Homo sapiens OX=9606 GN=GPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	895-UNIMOD:21	0.03	39.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	52.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20372	99.31459666666667	3	3442.3998	3442.4027	K	L	104	135
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	2	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	3-UNIMOD:21,37-UNIMOD:267	ms_run[2]:scan=21973	107.57	3	3623.8336	3623.8336	R	Q	125	162
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	3	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=21710	106.20686	3	3442.4025	3442.4027	K	L	104	135
PSM	RKPEDVLDDDDAGSAPLK	4	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	14-UNIMOD:21	ms_run[2]:scan=12056	54.634	2	2019.915	2019.9150	R	S	140	158
PSM	IHEKDPNSATATAPPSPLK	5	sp|Q92766-6|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	16-UNIMOD:21	ms_run[2]:scan=7211	32.504	2	2052.9881	2052.9881	K	R	146	165
PSM	KFSKEEPVSSGPEEAVGK	6	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:188,4-UNIMOD:188,10-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=8057	36.227	2	2001.9794	2001.9794	R	S	561	579
PSM	KNQDDDDDDDDGFFGPALPPGFK	7	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=23607	116.24	2	2524.0666	2524.0666	R	K	78	101
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	8	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=23386	115.06	3	3082.5756	3082.5756	K	A	444	473
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	9	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20582	100.36379833333332	3	3443.4022	3442.4022	K	L	104	135
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	10	sp|Q5HYK7|SH319_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=22272	109.12513500000001	3	3065.4205	3065.4200	K	L	268	296
PSM	DASPGRGSHGQTPSPGALPLGR	11	sp|P17600-2|SYN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21,6-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=11196	50.602	2	2214.0446	2214.0446	R	Q	425	447
PSM	IHGSGHVEEPASPLAAYQK	12	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=10308	46.534	2	2075.9773	2075.9773	K	S	911	930
PSM	RKVTGTEGSSSTLVDYTSTSSTGGSPVR	13	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	25-UNIMOD:21	ms_run[2]:scan=11083	50.082	3	2896.3451	2896.3451	R	K	1219	1247
PSM	SRGWGQQDGPGPPSPGQSPSPCR	14	sp|Q6F5E8-2|CARL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	2-UNIMOD:267,14-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=10798	48.811	3	2491.0603	2491.0603	R	T	1266	1289
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	15	sp|Q5HYK7|SH319_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=22471	110.14390333333334	3	3065.4205	3065.4200	K	L	268	296
PSM	ERIPEAPAGPPSDFGLFLSDDDPK	16	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=24994	124.24	3	2569.2336	2569.2336	R	K	34	58
PSM	IHEKDPNSATATAPPSPLK	17	sp|Q92766-6|RREB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:188,16-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=7244	32.663	2	2065.0284	2065.0284	K	R	146	165
PSM	RQVSASELHTSGILGPETLR	18	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=17411	83.141	2	2230.1107	2230.1107	R	D	2715	2735
PSM	RRLSPPSSSAASSYSFSDLNSTR	19	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:21	ms_run[2]:scan=15655	73.731	3	2552.1657	2552.1657	R	G	46	69
PSM	SGPKPFSAPKPQTSPSPK	20	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:188,10-UNIMOD:188,14-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6988	31.448	2	1935.0001	1935.0001	R	R	294	312
PSM	SHSRQASTDAGTAGALTPQHVR	21	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=7032	31.637	3	2407.0431	2407.0431	K	A	103	125
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	22	sp|O60784-3|TOM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	10-UNIMOD:21	ms_run[2]:scan=15444	72.639	3	2574.2228	2574.2228	K	K	408	434
PSM	KKASLVALPEQTASEEETPPPLLTK	23	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=19742	95.803	3	2756.4249	2756.4249	R	E	397	422
PSM	KNQDDDDDDDDGFFGPALPPGFK	24	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=23411	115.2	2	2524.0666	2524.0666	R	K	78	101
PSM	KNQDDDDDDDDGFFGPALPPGFK	25	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=23789	117.27	2	2524.0666	2524.0666	R	K	78	101
PSM	YRQRSPSPAPAPAPAAAAGPPTR	26	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6943	31.262	3	2446.1308	2446.1308	R	K	494	517
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	27	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20920	102.06792166666666	3	3442.3996	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	28	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20174	98.239625	3	3442.4014	3442.4027	K	L	104	135
PSM	AQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	29	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	30-UNIMOD:21	ms_run[2]:scan=15170	71.137	3	3092.4101	3092.4101	R	V	283	316
PSM	GRASSHSSQTQGGGSVTK	30	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:21	ms_run[2]:scan=656	5.0439	2	1810.7959	1810.7959	R	K	301	319
PSM	IGEEQSAEDAEDGPPELLFIHGGHTAK	31	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:21	ms_run[2]:scan=21306	104.08	3	2926.3022	2926.3022	K	I	349	376
PSM	KRSSITEPEGPGGPNIQK	32	sp|Q96KQ4|ASPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=7129	32.088	2	1973.9572	1973.9572	K	L	707	725
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	33	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	8-UNIMOD:21	ms_run[2]:scan=17258	82.334	3	2775.2402	2775.2402	R	D	285	310
PSM	NKTEDLEATSEHFKTTSQK	34	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:21	ms_run[2]:scan=5766	25.819	2	2273.0213	2273.0213	R	V	46	65
PSM	RILSDVTHSAVFGVPASK	35	sp|Q2M2I8-2|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=21206	103.53	2	1962.9928	1962.9928	R	S	634	652
PSM	RKESSNTDSAGALGTLR	36	sp|P29474|NOS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=7997	35.946	2	1841.8633	1841.8633	K	F	630	647
PSM	SGPKPFSAPKPQTSPSPK	37	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	13-UNIMOD:21	ms_run[2]:scan=6970	31.375	2	1916.9397	1916.9397	R	R	294	312
PSM	VKSPVSLTAHSLIGASPK	38	sp|P28749-2|RBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=16088	75.786	2	1870.9918	1870.9918	K	Q	747	765
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	39	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19771	95.98175166666667	3	3442.4005	3442.4027	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	40	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:267,11-UNIMOD:21,31-UNIMOD:188	ms_run[1]:scan=22081	108.141525	3	3112.596726	3111.608898	R	A	655	686
PSM	GSGKRPAAAAAAGSASPR	41	sp|Q96S55-2|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=1207	6.569	2	1661.7999	1661.7999	K	S	138	156
PSM	HIKEEPLSEEEPCTSTAIASPEKK	42	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11417	51.668	3	2869.2494	2869.2494	K	K	495	519
PSM	HQEVQDQDPVFQGSDSSGYQSDHKK	43	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21,24-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=8300	37.39	3	2937.2605	2937.2605	K	K	284	309
PSM	HSTPSNSSNPSGPPSPNSPHR	44	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	15-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=1652	7.9383	3	2229.9428	2229.9428	K	S	1676	1697
PSM	KNQDDDDDDDDGFFGPALPPGFK	45	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=23464	115.47	2	2536.1069	2536.1069	R	K	78	101
PSM	KNQDDDDDDDDGFFGPALPPGFK	46	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:188,23-UNIMOD:188	ms_run[2]:scan=23650	116.48	2	2536.1069	2536.1069	R	K	78	101
PSM	KSPSGPVKSPPLSPVGTTPVK	47	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=11424	51.698	2	2139.1341	2139.1341	R	L	181	202
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	48	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13505	62.752	3	4117.4483	4117.4483	K	K	158	194
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	49	sp|Q0JRZ9-3|FCHO2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:267,20-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=23586	116.12	3	3082.5756	3082.5756	K	A	444	473
PSM	RFTEHNSSPNVSGSLSSGLQK	50	sp|Q9UJF2|NGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	7-UNIMOD:21	ms_run[2]:scan=11297	51.134	3	2311.0594	2311.0594	R	I	628	649
PSM	RGAGAELKDTQSPSTCSEGLLGWSQK	51	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	12-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=17072	81.353	3	2842.2957	2842.2957	R	D	701	727
PSM	RGSSPGSLEIPKDLPDILNK	52	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=23914	118	2	2215.125	2215.1250	R	Q	905	925
PSM	RTASAPNLAETEKETAEHLDLAGASSR	53	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21	ms_run[2]:scan=19870	96.52	3	2904.3615	2904.3615	K	P	384	411
PSM	TDLEKDIISDTSGDFRK	54	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=18046	86.48	2	1938.9535	1938.9535	K	L	153	170
PSM	THDHQLESSLSPVEVFAK	55	sp|Q9H410-4|DSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=18532	89.105	2	2102.9674	2102.9674	K	T	4	22
PSM	TKFASDDEHDEHDENGATGPVK	56	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=4424	19.66	2	2477.9973	2477.9973	K	R	362	384
PSM	YRQRSPSPAPAPAPAAAAGPPTR	57	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6984	31.431	2	2446.1308	2446.1308	R	K	494	517
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	58	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=21939	107.393245	3	3442.4021	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	59	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=21380	104.47469666666667	3	3444.4052	3442.4022	K	L	104	135
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	60	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	11-UNIMOD:21	ms_run[1]:scan=21731	106.30684	3	3095.575470	3095.580500	R	A	655	686
PSM	AQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	61	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	29-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=15188	71.234	3	3102.4184	3102.4184	R	V	283	316
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	62	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=10010	45.176	3	2671.2239	2671.2239	K	Q	710	737
PSM	KAPLNIPGTPVLEDFPQNDDEKER	63	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=21479	104.99	3	2801.3273	2801.3273	R	L	41	65
PSM	KLSSWDQAETPGHTPSLR	64	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=12244	55.82	2	2088.963	2088.9630	K	W	214	232
PSM	LIEGVHPGSLVEKLPDSPALAK	65	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=19619	95.116	3	2349.2345	2349.2345	R	K	559	581
PSM	LRSCSVTDAVAEQGHLPPPSAPAGR	66	sp|Q96PU5-4|NED4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=15041	70.385	3	2652.2479	2652.2479	R	A	217	242
PSM	LVHSGSGCRSPSLGSDLTFATR	67	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:4,9-UNIMOD:267,10-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=15648	73.693	2	2404.1109	2404.1109	R	T	384	406
PSM	NVAEALGHSPKDPGGGGGPVR	68	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21	ms_run[2]:scan=9039	40.672	2	2050.9586	2050.9586	K	A	428	449
PSM	RIDFIPVSPAPSPTRGIGK	69	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=20241	98.581	2	2167.0592	2167.0592	K	Q	136	155
PSM	RLSTSPDVIQGHQPR	70	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=8480	38.198	2	1769.8574	1769.8574	R	D	264	279
PSM	RLSTSPDVIQGHQPR	71	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=8486	38.219	2	1789.8739	1789.8739	R	D	264	279
PSM	RRDSLDSSTEASGSDVVLGGR	72	sp|Q9Y2I9|TBC30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=11092	50.109	3	2243.0179	2243.0179	R	S	111	132
PSM	RYSDHAGPAIPSVVAYPK	73	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=15711	74.009	2	2006.9615	2006.9615	R	R	338	356
PSM	SASYPCAAPRPGAPETTALHGGFQR	74	sp|Q7Z3C6-2|ATG9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=13971	65.161	3	2678.2061	2678.2061	R	R	698	723
PSM	SIQEIQELDKDDESLRK	75	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=13733	63.889	2	2045.0277	2045.0277	K	Y	34	51
PSM	SLHPWYGITPTSSPKTK	76	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=14728	68.707	2	1978.9554	1978.9554	K	K	459	476
PSM	SLSTSGESLYHVLGLDKNATSDDIKK	77	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=23958	118.24	3	2857.3746	2857.3746	R	S	8	34
PSM	SRPFTVAASFQSTSVKSPK	78	sp|Q9UHB6-5|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=13545	62.955	2	2104.0354	2104.0354	R	T	429	448
PSM	VRHFSQSEETGNEVFGALNEEQPLPR	79	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=20928	102.11	3	3049.3931	3049.3931	R	S	816	842
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	80	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21,27-UNIMOD:188	ms_run[1]:scan=21263	103.83628666666667	3	2959.341162	2958.337992	K	I	350	377
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	81	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=14120	65.848	3	2956.4332	2956.4332	K	L	117	144
PSM	HLEHAPSPSDVSNAPEVK	82	sp|Q9Y4C1|KDM3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=9592	43.056	2	1992.8942	1992.8942	K	A	439	457
PSM	KFSKEEPVSSGPEEAVGK	83	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21	ms_run[2]:scan=8067	36.281	2	1983.9191	1983.9191	R	S	561	579
PSM	KPGDGEVSPSTEDAPFQHSPLGK	84	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=14332	66.834	2	2459.1006	2459.1006	K	A	520	543
PSM	KPQGVDPASFHFLDTPIAK	85	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,9-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=22469	110.14	3	2159.0855	2159.0855	R	V	309	328
PSM	KRSSITEPEGPNGPNIQK	86	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=7124	32.063	2	2030.9786	2030.9786	K	L	611	629
PSM	KVLSPTAAKPSPFEGK	87	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=10117	45.671	2	1735.891	1735.8910	K	T	310	326
PSM	LHVGNISPTCTNKELR	88	sp|Q9BWF3-3|RBM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11460	51.857	2	1917.9132	1917.9132	K	A	80	96
PSM	LRSCSVTDAVAEQGHLPPPSAPAGR	89	sp|Q96PU5-4|NED4L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,4-UNIMOD:4,5-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=15279	71.756	3	2672.2645	2672.2645	R	A	217	242
PSM	NVSESPSKHENSKDVTAAQNLVR	90	sp|Q8NEV8-2|EXPH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=9269	41.687	3	2589.2184	2589.2184	K	E	1698	1721
PSM	RGLLYDSDEEDEERPAR	91	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=10979	49.566	2	2128.9063	2128.9063	R	K	133	150
PSM	RIDFTPVSPAPSPTRGFGK	92	sp|Q7Z309-4|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=17498	83.616	2	2189.0072	2189.0072	K	M	127	146
PSM	RKGSQITQQSTNQSR	93	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=1063	6.1752	2	1797.8483	1797.8483	R	N	344	359
PSM	RSSPAAFINPPIGTVTPALKLTK	94	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=23316	114.68	3	2458.3349	2458.3349	K	T	125	148
PSM	RSYDVPPPPMEPDHPFYSNISK	95	sp|Q8N0Y7|PGAM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:21	ms_run[2]:scan=18493	88.897	3	2652.172	2652.1720	R	D	117	139
PSM	SHVSSEPYEPISPPQVPVVHEK	96	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=17334	82.715	2	2521.189	2521.1890	R	Q	2037	2059
PSM	SRPFTVAASFQSTSVKSPK	97	sp|Q9UHB6-5|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=13415	62.267	3	2104.0354	2104.0354	R	T	429	448
PSM	TASRPAPLVQQLSPSLLPNSKSPR	98	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	22-UNIMOD:21	ms_run[2]:scan=18975	91.341	3	2623.3847	2623.3847	K	E	622	646
PSM	THDHQLESSLSPVEVFAK	99	sp|Q9H410-4|DSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=18566	89.279	2	2108.9875	2108.9875	K	T	4	22
PSM	TSGSGFHREGNTTEDDFPSSPGNGNK	100	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	20-UNIMOD:21	ms_run[2]:scan=8312	37.439	3	2774.1206	2774.1206	R	S	287	313
PSM	VLSPLRSPPLIGSESAYESFLSADDKASGR	101	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	7-UNIMOD:21	ms_run[2]:scan=27004	136.66	3	3228.5704	3228.5704	K	G	1394	1424
PSM	VRPGSALAAAVAPPEPAEPVRDVSWDEK	102	sp|Q7Z2K8|GRIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=21887	107.11	3	2993.4648	2993.4648	R	G	891	919
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	103	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=21151	103.2683	3	3442.4004	3442.4027	K	L	104	135