MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH18.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	null	22-UNIMOD:21,27-UNIMOD:21,13-UNIMOD:267,14-UNIMOD:267,28-UNIMOD:21,38-UNIMOD:267	0.02	50.0	5	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	351-UNIMOD:28,352-UNIMOD:267,353-UNIMOD:21,376-UNIMOD:267	0.05	47.0	2	1	0
PRT	sp|Q8N2M8-3|CLASR_HUMAN	Isoform 2 of CLK4-associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	101-UNIMOD:21,109-UNIMOD:267	0.05	46.0	1	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	138-UNIMOD:21,161-UNIMOD:267	0.08	45.0	3	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	14-UNIMOD:267,15-UNIMOD:21,40-UNIMOD:267	0.05	45.0	1	1	1
PRT	sp|Q8N2M8|CLASR_HUMAN	CLK4-associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	101-UNIMOD:21	0.04	45.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	802-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|Q96TA1-2|NIBA2_HUMAN	Isoform 2 of Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	652-UNIMOD:21	0.04	44.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	308-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	2	2	2
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	178-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	452-UNIMOD:267,462-UNIMOD:21,472-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	49-UNIMOD:21	0.09	42.0	2	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	1010-UNIMOD:21,1016-UNIMOD:267	0.03	42.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	42.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	764-UNIMOD:267,772-UNIMOD:21,777-UNIMOD:267	0.01	41.0	4	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	41.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.03	41.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1464-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9P2D0-2|IBTK_HUMAN	Isoform 2 of Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1004-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|A6NKT7|RGPD3_HUMAN	RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RGPD3 PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1178-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	306-UNIMOD:21,307-UNIMOD:21,297-UNIMOD:188,303-UNIMOD:188,309-UNIMOD:21,311-UNIMOD:188	0.04	41.0	8	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	239-UNIMOD:267,242-UNIMOD:21,256-UNIMOD:267	0.07	41.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	2448-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	525-UNIMOD:21	0.05	41.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	167-UNIMOD:28,174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	41.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	308-UNIMOD:21,307-UNIMOD:21	0.04	41.0	3	1	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	878-UNIMOD:21,883-UNIMOD:267,895-UNIMOD:4,902-UNIMOD:188	0.01	41.0	2	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	366-UNIMOD:21	0.05	40.0	2	1	0
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	255-UNIMOD:267,262-UNIMOD:21,270-UNIMOD:267	0.04	40.0	2	1	0
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	179-UNIMOD:267,181-UNIMOD:21,188-UNIMOD:4,207-UNIMOD:267	0.10	40.0	2	1	0
PRT	sp|Q7Z309-4|F122B_HUMAN	Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	134-UNIMOD:21,138-UNIMOD:21	0.08	40.0	1	1	1
PRT	sp|Q9NQC3-5|RTN4_HUMAN	Isoform B2 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	181-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	265-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	635-UNIMOD:21,640-UNIMOD:267,652-UNIMOD:4,659-UNIMOD:188,686-UNIMOD:21	0.02	40.0	2	2	1
PRT	sp|Q15418-3|KS6A1_HUMAN	Isoform 3 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	271-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	251-UNIMOD:188,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:188	0.04	39.0	1	1	1
PRT	sp|Q96SN8-4|CK5P2_HUMAN	Isoform 4 of CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1806-UNIMOD:21,1807-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|O60504|VINEX_HUMAN	Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	606-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	185-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	155-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	192-UNIMOD:188,209-UNIMOD:188,215-UNIMOD:188	0.05	39.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	34-UNIMOD:21,37-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	575-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1157-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	618-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.15	39.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1757-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|O43318-4|M3K7_HUMAN	Isoform 1D of Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	412-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1278-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	123-UNIMOD:188,124-UNIMOD:21,138-UNIMOD:188	0.03	39.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1441-UNIMOD:21	0.01	39.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	1	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=8087	39.086	3	2830.1597	2830.1597	R	T	13	39
PSM	QRSPLLNQPVPELSHASLIANQSPFR	2	sp|Q9NPI6|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:28,2-UNIMOD:267,3-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=25171	129.27311666666668	3	2981.5009	2981.5022	R	A	351	377
PSM	QRSPLLNQPVPELSHASLIANQSPFR	3	sp|Q9NPI6|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=25169	129.26183	3	2961.4844	2961.4857	R	A	351	377
PSM	AHLDHIPDYTPPLLTTISPEQESDER	4	sp|Q8N2M8-3|CLASR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	18-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=22116	112.22	3	3063.4102	3063.4102	R	K	84	110
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	5	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:21,37-UNIMOD:267	ms_run[2]:scan=21201	107.37	3	3623.8336	3623.8336	R	Q	125	162
PSM	PAERSSPGQTPEEGAQALAEFAALHGPALR	6	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:267,5-UNIMOD:21,30-UNIMOD:267	ms_run[2]:scan=26363	136.51	3	3157.5097	3157.5097	R	A	11	41
PSM	AHLDHIPDYTPPLLTTISPEQESDER	7	sp|Q8N2M8|CLASR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	18-UNIMOD:21	ms_run[1]:scan=22104	112.150375	3	3053.401044	3053.401927	R	K	84	110
PSM	APVHFVEPLSPTGVAGHR	8	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=15763	77.381	2	1949.9513	1949.9513	K	K	793	811
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	9	sp|Q96TA1-2|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	11-UNIMOD:21	ms_run[2]:scan=20651	104.21	3	3095.5805	3095.5805	R	A	642	673
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	10	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=21000	106.24	3	3613.8254	3613.8254	R	Q	125	162
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	11	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:267,2-UNIMOD:267,10-UNIMOD:21,16-UNIMOD:21,26-UNIMOD:267	ms_run[2]:scan=8036	38.819	3	2860.1845	2860.1845	R	T	13	39
PSM	FYGDEEKDKGLQTSQDAR	12	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=7293	35.175	2	2085.9603	2085.9603	K	F	56	74
PSM	GPALTPIRDEEWGGHSPR	13	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	16-UNIMOD:21	ms_run[2]:scan=13293	64.582	2	2053.9371	2053.9371	R	S	293	311
PSM	KKDASDDLDDLNFFNQK	14	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=19071	94.997	2	2011.9487	2011.9487	R	K	63	80
PSM	LDNARQSAERNSNLVGAAHEELQQSR	15	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=12407	60.169	3	2972.385	2972.3850	K	I	172	198
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	16	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	9-UNIMOD:267,19-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=22655	115.03	3	3082.5756	3082.5756	K	A	444	473
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	17	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=7672	37.05	3	2830.1597	2830.1597	R	T	13	39
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	18	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7882	38.062	3	2830.1597	2830.1597	R	T	13	39
PSM	RRLSPPSSSAASSYSFSDLNSTR	19	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21	ms_run[2]:scan=15143	74.117	3	2552.1657	2552.1657	R	G	46	69
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	20	sp|Q9HCM7|FBSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	22-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21236	107.54	3	2628.3704	2628.3704	R	S	989	1017
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	21	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19145	95.399985	3	3442.3987	3442.4027	K	L	104	135
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	22	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=21178	107.24	3	3613.8254	3613.8254	R	Q	125	162
PSM	GGGLRLPLLPPESPGPLR	23	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=25101	128.83	2	1925.0403	1925.0403	R	Q	760	778
PSM	GGGLRLPLLPPESPGPLR	24	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=25242	129.7	2	1905.0237	1905.0237	R	Q	760	778
PSM	HIIENAKQDVDDEYGVSQALAR	25	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15437	75.637	3	2470.2088	2470.2088	R	G	705	727
PSM	HIKEEPLSEEEPCTSTAIASPEK	26	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12065	58.487	3	2661.1881	2661.1881	K	K	495	518
PSM	HIYYITGETKDQVANSAFVER	27	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15265	74.77	3	2440.2023	2440.2023	K	L	490	511
PSM	KFPDRLAEDEGDSEPEAVGQSR	28	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=11702	56.604	2	2511.0915	2511.0915	K	G	1452	1474
PSM	KRSDSSGGYNLSDIIQSPSSTGLLK	29	sp|Q9P2D0-2|IBTK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	17-UNIMOD:21	ms_run[2]:scan=22371	113.53	3	2689.296	2689.2960	R	S	988	1013
PSM	LLLDIPLQTPHKLVDTGR	30	sp|A6NKT7|RGPD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	9-UNIMOD:21	ms_run[2]:scan=23307	118.69	2	2108.1395	2108.1395	R	A	1170	1188
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	31	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=8314	40.161	3	2830.1597	2830.1597	R	T	13	39
PSM	SGPKPFSAPKPQTSPSPK	32	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=30117	159.74	2	1916.9397	1916.9397	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	33	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=30653	163.2	2	1916.9397	1916.9397	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	34	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:188,10-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=7007	33.671	2	1935.0001	1935.0001	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	35	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7412	35.77	2	1996.9061	1996.9061	R	R	294	312
PSM	SRTHSTSSSLGSGESPFSR	36	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:267,5-UNIMOD:21,19-UNIMOD:267	ms_run[2]:scan=8678	41.729	2	2065.8969	2065.8969	R	S	238	257
PSM	TRTDSYSAGQSVEILDGVELGEPAHKK	37	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=18546	92.053	3	2966.4023	2966.4023	R	T	2444	2471
PSM	VRGGAPDPSPGATATPGAPAQPSSPDARR	38	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	23-UNIMOD:21	ms_run[2]:scan=7178	34.558	3	2820.3304	2820.3304	R	N	503	532
PSM	AHLDHIPDYTPPLLTTISPEQESDER	39	sp|Q8N2M8|CLASR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	18-UNIMOD:21	ms_run[1]:scan=21914	111.14506999999999	3	3053.401044	3053.401927	R	K	84	110
PSM	QHEAPSNRPLNELLTPQGPSPR	40	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[1]:scan=17554	86.84788	3	2520.2019	2520.2020	R	T	167	189
PSM	SGPKPFSAPKPQTSPSPK	41	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:21	ms_run[1]:scan=6736	32.22819333333334	2	1916.940175	1916.939729	R	R	295	313
PSM	SGPKPFSAPKPQTSPSPK	42	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:21	ms_run[1]:scan=6559	31.217078333333333	2	1916.940175	1916.939729	R	R	295	313
PSM	SVEDVRPHHTDANNQSACFEAPDQK	43	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:21,6-UNIMOD:267,18-UNIMOD:4,25-UNIMOD:188	ms_run[1]:scan=8741	42.047515000000004	3	2948.234791	2947.252712	R	T	878	903
PSM	FASDDEHDEHDENGATGPVKR	44	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=3988	18.626	2	2404.9557	2404.9557	K	A	364	385
PSM	FASDDEHDEHDENGATGPVKR	45	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=4184	19.642	2	2404.9557	2404.9557	K	A	364	385
PSM	GGGLRLPLLPPESPGPLR	46	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=25075	128.68	2	1905.0237	1905.0237	R	Q	760	778
PSM	GHLSRPEAQSLSPYTTSANR	47	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:267,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=10016	48.133	3	2271.0548	2271.0548	R	A	251	271
PSM	GHLSRPEAQSLSPYTTSANR	48	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:267,12-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=10088	48.497	2	2271.0548	2271.0548	R	A	251	271
PSM	LKEFLEDYDDDRDDPK	49	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12739	61.851	2	2011.9011	2011.9011	R	Y	496	512
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	50	sp|P85299-2|PRR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:267,3-UNIMOD:21,10-UNIMOD:4,29-UNIMOD:267	ms_run[2]:scan=15207	74.491	3	3245.381	3245.3811	R	S	179	208
PSM	RIDFTPVSPAPSPTRGFGK	51	sp|Q7Z309-4|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=17059	84.125	2	2189.0072	2189.0072	K	M	127	146
PSM	RRGSSGSVDETLFALPAASEPVIR	52	sp|Q9NQC3-5|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=22944	116.59	2	2594.2854	2594.2854	K	S	178	202
PSM	RRLSPPSSSAASSYSFSDLNSTR	53	sp|P50402|EMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:21	ms_run[2]:scan=14961	73.108	3	2552.1657	2552.1657	R	G	46	69
PSM	SGPKPFSAPKPQTSPSPK	54	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=6181	29.197	2	1916.9397	1916.9397	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	55	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=6393	30.206	2	1916.9397	1916.9397	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	56	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=6927	33.238	2	1916.9397	1916.9397	R	R	294	312
PSM	SHTSSNYDSYKKSPGSTSR	57	sp|Q9NYV4-3|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=1592	8.2572	2	2167.9172	2167.9172	R	R	253	272
PSM	SVEDVRPHHTDANNQSACFEAPDQK	58	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21,6-UNIMOD:267,18-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=8132	39.296	3	2947.2527	2943.2646	R	T	635	660
PSM	TPKDSPGIPPSAGAHQLFR	59	sp|Q15418-3|KS6A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=12890	62.57	2	2054.9939	2054.9939	R	G	267	286
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	60	sp|Q9HCM7|FBSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	22-UNIMOD:21	ms_run[2]:scan=21043	106.46	3	2618.3622	2618.3622	R	S	989	1017
PSM	SVEDVRPHHTDANNQSACFEAPDQK	61	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21,6-UNIMOD:267,18-UNIMOD:4,25-UNIMOD:188	ms_run[1]:scan=8502	40.975575	3	2948.235268	2947.252712	R	T	878	903
PSM	SGPKPFSAPKPQTSPSPK	62	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21	ms_run[1]:scan=7071	34.00217833333333	2	1917.925430	1916.939729	R	R	295	313
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	63	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:188,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=23680	120.71	4	3925.6891	3925.6891	R	I	250	282
PSM	GGGLRLPLLPPESPGPLR	64	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=24931	127.82	2	1925.0403	1925.0403	R	Q	760	778
PSM	GNLELRPGGAHPGTCSPSRPGS	65	sp|Q96SN8-4|CK5P2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=8177	39.492	2	2283.0216	2283.0216	R	-	1793	1815
PSM	GPSHPLDLGTSSPNTSQIHWTPYR	66	sp|O60504|VINEX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=19019	94.71	3	2727.2442	2727.2442	R	A	595	619
PSM	GVTIPYRPKPSSSPVIFAGGQDR	67	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=16506	81.207	2	2508.2526	2508.2526	K	Y	173	196
PSM	KFSGFSAKPNNSGEAPSSPTPK	68	sp|P49916-4|DNLI3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	18-UNIMOD:21	ms_run[2]:scan=7918	38.231	2	2314.0631	2314.0631	R	R	138	160
PSM	KGVNLPGAAVDLPAVSEKDIQDLK	69	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,18-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=22517	114.31	3	2494.4141	2494.4141	K	F	192	216
PSM	KIFDIDEAEEGVKDLK	70	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19362	96.576	2	1847.9517	1847.9517	K	I	87	103
PSM	LHDFLAHSSEESEETSSPPR	71	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21,20-UNIMOD:267	ms_run[2]:scan=10808	52.295	3	2343.9884	2343.9884	K	L	18	38
PSM	LIEGVHPGSLVEKLPDSPALAK	72	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	17-UNIMOD:21	ms_run[2]:scan=19083	95.056	3	2349.2345	2349.2345	R	K	559	581
PSM	LIRPEYAWIVQPVSGAVYDRPGASPK	73	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:21	ms_run[2]:scan=23845	121.58	3	2948.495	2948.4950	R	R	1134	1160
PSM	LKSEDELRPEVDEHTQK	74	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=7064	33.971	2	2131.9787	2131.9787	R	T	616	633
PSM	RAAEDDEDDDVDTKK	75	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1001	6.3091	2	1720.7388	1720.7388	K	Q	89	104
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	76	sp|P85299-2|PRR5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=15244	74.673	3	3225.3645	3225.3645	R	S	179	208
PSM	RPEVDSPGETPSWAPQPKSPK	77	sp|Q9BY89|K1671_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:21	ms_run[2]:scan=11224	54.426	3	2369.1053	2369.1053	K	S	1739	1760
PSM	RRSIQDLTVTGTEPGQVSSR	78	sp|O43318-4|M3K7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=10853	52.543	3	2266.1067	2266.1067	R	S	410	430
PSM	RSSLPLDHGSPAQENPESEKSSPAVSR	79	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=9072	43.577	3	2941.3567	2941.3567	R	S	1276	1303
PSM	SGPKPFSAPKPQTSPSPK	80	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=30476	162.18	2	1916.9397	1916.9397	R	R	294	312
PSM	SVSHGSNHTQKPDEQR	81	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=642	5.0609	2	1885.8068	1885.8068	R	S	681	697
PSM	VQTLSNQPLLKSPAPPLLHVAALGQK	82	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:188,12-UNIMOD:21,26-UNIMOD:188	ms_run[2]:scan=23073	117.42	3	2811.5815	2811.5815	K	Q	113	139
PSM	WAHAAREDSLPEESSAPDFANLK	83	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=17349	85.726	3	2620.1595	2620.1595	K	H	1433	1456