MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH19.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH19.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9ULI0-2|ATD2B_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	null	16-UNIMOD:21	0.02	49.0	1	1	1
PRT	sp|Q8TEP8-1|CE192_HUMAN	Isoform 1 of Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	1514-UNIMOD:21	0.01	45.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	63-UNIMOD:188,64-UNIMOD:188,79-UNIMOD:188	0.05	45.0	4	1	0
PRT	sp|Q86UP2-2|KTN1_HUMAN	Isoform 2 of Kinectin OS=Homo sapiens OX=9606 GN=KTN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	75-UNIMOD:21	0.02	45.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	204-UNIMOD:21	0.05	45.0	2	1	0
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	289-UNIMOD:267,300-UNIMOD:21,309-UNIMOD:267,301-UNIMOD:21	0.06	45.0	2	1	0
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	258-UNIMOD:188,260-UNIMOD:21,276-UNIMOD:188	0.06	44.0	1	1	1
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1010-UNIMOD:21,1016-UNIMOD:267	0.03	44.0	1	1	1
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	null	351-UNIMOD:28,352-UNIMOD:267,353-UNIMOD:21,376-UNIMOD:267	0.05	44.0	2	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	308-UNIMOD:21,298-UNIMOD:188,304-UNIMOD:188,312-UNIMOD:188	0.04	44.0	2	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	141-UNIMOD:21,161-UNIMOD:267,105-UNIMOD:21,106-UNIMOD:267,110-UNIMOD:21,124-UNIMOD:267	0.13	43.0	2	2	2
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	452-UNIMOD:267,455-UNIMOD:21,472-UNIMOD:267	0.04	43.0	1	1	1
PRT	sp|Q4KMP7-2|TB10B_HUMAN	Isoform 2 of TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	112-UNIMOD:21	0.15	43.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	207-UNIMOD:188,224-UNIMOD:188,230-UNIMOD:188	0.05	42.0	2	1	0
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.11	42.0	1	1	1
PRT	sp|P27987-2|IP3KB_HUMAN	Isoform 2 of Inositol-trisphosphate 3-kinase B OS=Homo sapiens OX=9606 GN=ITPKB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	84-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	363-UNIMOD:21	0.01	42.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	5841-UNIMOD:21	0.00	42.0	2	1	0
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	680-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	936-UNIMOD:21,948-UNIMOD:21,949-UNIMOD:4	0.02	41.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	22-UNIMOD:21,28-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	307-UNIMOD:21,297-UNIMOD:188,303-UNIMOD:188,309-UNIMOD:21,311-UNIMOD:188	0.04	41.0	4	1	0
PRT	sp|Q8NCD3-3|HJURP_HUMAN	Isoform 3 of Holliday junction recognition protein OS=Homo sapiens OX=9606 GN=HJURP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	470-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	47-UNIMOD:21,56-UNIMOD:267,58-UNIMOD:267	0.05	41.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,351-UNIMOD:21,353-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21,983-UNIMOD:21	0.03	41.0	4	4	4
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	41.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	null	836-UNIMOD:28,838-UNIMOD:21,843-UNIMOD:188,858-UNIMOD:188	0.02	41.0	2	1	0
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	772-UNIMOD:21	0.01	40.0	1	1	0
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	228-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	2	1	0
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	48-UNIMOD:21,69-UNIMOD:188	0.09	40.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	497-UNIMOD:188,502-UNIMOD:21,507-UNIMOD:4,517-UNIMOD:188,518-UNIMOD:188,514-UNIMOD:21,508-UNIMOD:21	0.05	40.0	5	2	1
PRT	sp|Q7Z2K8-2|GRIN1_HUMAN	Isoform 2 of G protein-regulated inducer of neurite outgrowth 1 OS=Homo sapiens OX=9606 GN=GPRIN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	75-UNIMOD:21,83-UNIMOD:4	0.02	40.0	1	1	1
PRT	sp|Q15758-3|AAAT_HUMAN	Isoform 3 of Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	311-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	1859-UNIMOD:21	0.01	40.0	2	1	0
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	197-UNIMOD:21,185-UNIMOD:188,186-UNIMOD:188,199-UNIMOD:188	0.06	40.0	2	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	174-UNIMOD:267,186-UNIMOD:21,188-UNIMOD:267	0.04	40.0	1	1	1
PRT	sp|P12270-2|TPR_HUMAN	Isoform 2 of Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	379-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	21-UNIMOD:21,36-UNIMOD:4,22-UNIMOD:21	0.03	40.0	4	1	0
PRT	sp|Q9P227|RHG23_HUMAN	Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	842-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	212-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	366-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.07	39.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1604-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	1464-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	34-UNIMOD:21	0.10	39.0	1	1	1
PRT	sp|O95402|MED26_HUMAN	Mediator of RNA polymerase II transcription subunit 26 OS=Homo sapiens OX=9606 GN=MED26 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	337-UNIMOD:21,340-UNIMOD:4,328-UNIMOD:267,350-UNIMOD:267	0.04	39.0	2	1	0
PRT	sp|Q14739|LBR_HUMAN	Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	99-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	281-UNIMOD:21	0.09	39.0	1	1	1
PRT	sp|Q96F45-3|ZN503_HUMAN	Isoform 3 of Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	102-UNIMOD:21	0.10	39.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	526-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	542-UNIMOD:21,282-UNIMOD:21	0.05	39.0	3	2	1
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	853-UNIMOD:21	0.01	39.0	1	1	0
PRT	sp|O94874-3|UFL1_HUMAN	Isoform 3 of E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	458-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1278-UNIMOD:21,1280-UNIMOD:267	0.00	38.0	2	1	0
PRT	sp|Q13443|ADAM9_HUMAN	Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	761-UNIMOD:21,764-UNIMOD:267,772-UNIMOD:267	0.02	38.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.04	38.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.03	38.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1121-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	34-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|Q9H0E9-3|BRD8_HUMAN	Isoform 3 of Bromodomain-containing protein 8 OS=Homo sapiens OX=9606 GN=BRD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	124-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|O00458|IFRD1_HUMAN	Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	14-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	316-UNIMOD:267,329-UNIMOD:21,336-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	861-UNIMOD:267,873-UNIMOD:21,893-UNIMOD:267	0.04	38.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	213-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|Q8N5C8-2|TAB3_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	102-UNIMOD:21,115-UNIMOD:188	0.03	38.0	1	1	1
PRT	sp|Q15742|NAB2_HUMAN	NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	479-UNIMOD:21,481-UNIMOD:4	0.05	38.0	1	1	1
PRT	sp|Q7Z3J2|VP35L_HUMAN	VPS35 endosomal protein sorting factor-like OS=Homo sapiens OX=9606 GN=VPS35L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|Q8N0Y2-2|ZN444_HUMAN	Isoform 2 of Zinc finger protein 444 OS=Homo sapiens OX=9606 GN=ZNF444	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	234-UNIMOD:21	0.06	37.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	545-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	283-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q86UU1-3|PHLB1_HUMAN	Isoform 3 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	578-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	15-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q01196-6|RUNX1_HUMAN	Isoform AML-1FB of Runt-related transcription factor 1 OS=Homo sapiens OX=9606 GN=RUNX1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	21-UNIMOD:21	0.18	37.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1126-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	379-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	637-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q14686|NCOA6_HUMAN	Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	2018-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9UHB7|AFF4_HUMAN	AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	180-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	312-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	775-UNIMOD:267,780-UNIMOD:21,787-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	486-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	124-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q12959-5|DLG1_HUMAN	Isoform 5 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	115-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	420-UNIMOD:385,420-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|O75145|LIPA3_HUMAN	Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	728-UNIMOD:21,745-UNIMOD:267,753-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	644-UNIMOD:4,664-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|O96013-3|PAK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	114-UNIMOD:21,123-UNIMOD:4	0.08	36.0	1	1	1
PRT	sp|P48651-2|PTSS1_HUMAN	Isoform 2 of Phosphatidylserine synthase 1 OS=Homo sapiens OX=9606 GN=PTDSS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	293-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	341-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1418-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1257-UNIMOD:188,1267-UNIMOD:21,1275-UNIMOD:188,1279-UNIMOD:188	0.02	36.0	1	1	1
PRT	sp|Q8N9B5-2|JMY_HUMAN	Isoform 2 of Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	713-UNIMOD:21,721-UNIMOD:4	0.03	36.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	18-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q9NQC3-5|RTN4_HUMAN	Isoform B2 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	178-UNIMOD:267,179-UNIMOD:267,181-UNIMOD:21,201-UNIMOD:267	0.06	36.0	1	1	1
PRT	sp|Q8NEZ4-2|KMT2C_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1996-UNIMOD:21,2007-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	919-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	451-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	647-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	512-UNIMOD:21,535-UNIMOD:188	0.05	36.0	1	1	1
PRT	sp|Q7Z422|SZRD1_HUMAN	SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	37-UNIMOD:21	0.17	36.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LLGSKSPGPGPGPGAGAEPGATGGSSHFISSR	1	sp|Q9ULI0-2|ATD2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	6-UNIMOD:21	ms_run[2]:scan=13520	64.241	3	2969.4033	2969.4033	R	T	11	43
PSM	HGGNVSLDVLPVKGPQGSPLLSR	2	sp|Q8TEP8-1|CE192_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	18-UNIMOD:21	ms_run[2]:scan=20378	101.16	3	2406.2421	2406.2421	K	A	1497	1520
PSM	KKDASDDLDDLNFFNQK	3	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19265	94.866	2	2011.9487	2011.9487	R	K	63	80
PSM	KKDASDDLDDLNFFNQK	4	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19436	95.87	2	2011.9487	2011.9487	R	K	63	80
PSM	KKDASDDLDDLNFFNQK	5	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=19619	96.893	2	2011.9487	2011.9487	R	K	63	80
PSM	KKDASDDLDDLNFFNQK	6	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:188,2-UNIMOD:188,17-UNIMOD:188	ms_run[2]:scan=19371	95.528	2	2030.0091	2030.0091	R	K	63	80
PSM	KKEIQNGNLHESDSESVPR	7	sp|Q86UP2-2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21	ms_run[2]:scan=4811	22.108	2	2246.0329	2246.0329	K	D	64	83
PSM	KKTEFLDLDNSPLSPPSPR	8	sp|Q8NCF5|NF2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	17-UNIMOD:21	ms_run[2]:scan=19961	98.758	2	2220.0828	2220.0828	K	T	188	207
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	9	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	5-UNIMOD:267,16-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=16042	77.292	3	2795.2568	2795.2568	R	D	285	310
PSM	KHSPQHTTTLSLSTLATPK	10	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:188,3-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=12984	61.623	2	2139.1128	2139.1128	R	R	258	277
PSM	KKTEFLDLDNSPLSPPSPR	11	sp|Q8NCF5|NF2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=20133	99.759	2	2220.0828	2220.0828	K	T	188	207
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	12	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	22-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=21444	106.92	3	2628.3704	2628.3704	R	S	989	1017
PSM	QRSPLLNQPVPELSHASLIANQSPFR	13	sp|Q9NPI6|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:28,2-UNIMOD:267,3-UNIMOD:21,26-UNIMOD:267	ms_run[1]:scan=25500	129.05608	3	2981.5019	2981.5022	R	A	351	377
PSM	SGPKPFSAPKPQTSPSPK	14	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	14-UNIMOD:21	ms_run[1]:scan=6947	32.341121666666666	2	1917.941739	1916.939729	R	R	295	313
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	15	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	17-UNIMOD:21,37-UNIMOD:267	ms_run[2]:scan=21498	107.16	3	3623.8336	3623.8336	R	Q	125	162
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	16	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:267,12-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=22995	114.89	3	3082.5756	3082.5756	K	A	444	473
PSM	RASAGPAPGPVVTAEGLHPSLPSPTGNSTPLGSSK	17	sp|Q4KMP7-2|TB10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=19860	98.222	3	3373.6667	3373.6667	R	E	110	145
PSM	KGVNLPGAAVDLPAVSEKDIQDLK	18	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22987	114.85	3	2476.3537	2476.3537	K	F	207	231
PSM	RKPEDVLDDDDAGSAPLK	19	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=10699	50.142	2	1939.9487	1939.9487	R	S	140	158
PSM	RRLNSSSGSGSGSSGSSVSSPSWAGR	20	sp|P27987-2|IP3KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	5-UNIMOD:21	ms_run[2]:scan=8077	37.35	3	2576.1365	2576.1365	R	L	80	106
PSM	SHHAPMSPGSSGGGGQPLAR	21	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	7-UNIMOD:21	ms_run[2]:scan=5535	25.436	2	1966.8469	1966.8469	R	T	357	377
PSM	SKGHYEVTGSDDETGKLQGSGVSLASK	22	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:21	ms_run[2]:scan=11436	53.834	3	2816.2866	2816.2866	K	K	5832	5859
PSM	HLLTDLPLPPELPGGDLSPPDSPEPK	23	sp|Q9NYV4-3|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	18-UNIMOD:21	ms_run[2]:scan=27628	142.16	3	2810.3779	2810.3779	R	A	663	689
PSM	LRRPSPPEPWDEEDGASCSTFFGSEER	24	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=21578	107.61	3	3297.3112	3297.3112	R	T	932	959
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	25	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7679	35.602	3	2830.1597	2830.1597	R	T	13	39
PSM	SGPKPFSAPKPQTSPSPK	26	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	14-UNIMOD:21	ms_run[2]:scan=6742	31.288	2	1916.9397	1916.9397	R	R	294	312
PSM	SVSPSKTLSVPDKEVPGHGR	27	sp|Q8NCD3-3|HJURP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:21	ms_run[2]:scan=9756	45.47	2	2156.0627	2156.0627	K	N	470	490
PSM	VAAAAGSGPSPPGSPGHDRER	28	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=3059	13.772	2	2051.9174	2051.9174	R	Q	38	59
PSM	VKAQTPPGPSLSGSKSPCPQEK	29	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=7202	33.519	3	2439.0906	2439.0906	K	S	999	1021
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	30	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19397	95.67326666666666	3	3442.3992	3442.4027	K	L	104	135
PSM	QGSFTIEKPSPNIPIELIPHINK	31	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=27597	141.95533333333333	3	2634.3448	2634.3453	R	Q	836	859
PSM	GGGLRLPLLPPESPGPLR	32	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=25269	127.64	2	1905.0237	1905.0237	R	Q	760	778
PSM	GGSGSHNWGTVKDELTESPKYIQK	33	sp|Q8NC51-2|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	18-UNIMOD:21	ms_run[2]:scan=14564	69.595	3	2697.2436	2697.2436	R	Q	211	235
PSM	GHYTEGAELVDSVLDVVRK	34	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=26608	135.66	2	2086.0695	2086.0695	K	E	32	51
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	35	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	9-UNIMOD:21,30-UNIMOD:188	ms_run[2]:scan=26739	136.47	3	3096.5489	3096.5489	R	L	40	70
PSM	HIKEEPLSEEEPCTSTAIASPEKK	36	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:188,8-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=10643	49.882	2	2807.3434	2807.3434	K	K	495	519
PSM	HRSPSGAGEGASCSDGPR	37	sp|Q7Z2K8-2|GRIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=1140	6.2681	2	1863.7319	1863.7319	R	G	71	89
PSM	HYRGPAGDATVASEKESVM	38	sp|Q15758-3|AAAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:21	ms_run[2]:scan=9347	43.343	2	2083.9034	2083.9034	K	-	295	314
PSM	IHRASDPGLPAEEPKEK	39	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=5105	23.47	2	1952.9357	1952.9357	R	S	1855	1872
PSM	IKKSEAPAEVTHFSPK	40	sp|Q6PID6|TTC33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=6879	31.986	2	1847.9183	1847.9183	R	S	184	200
PSM	KEGGLGPLNIPLLADVTR	41	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=28218	146.03	2	1862.0625	1862.0625	R	R	92	110
PSM	QHEAPSNRPLNELLTPQGPSPR	42	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	8-UNIMOD:267,20-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=15595	74.777	3	2537.2291	2537.2291	R	T	167	189
PSM	RKGAILSEEELAAMSPTAAAVAK	43	sp|P12270-2|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=17531	85.035	3	2393.2026	2393.2026	K	I	365	388
PSM	RKTSDANETEDHLESLICK	44	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=15484	74.189	2	2325.0308	2325.0308	R	V	19	38
PSM	SGPKPFSAPKPQTSPSPK	45	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:188,10-UNIMOD:188,16-UNIMOD:21,18-UNIMOD:188	ms_run[2]:scan=6844	31.83	2	1935.0001	1935.0001	R	R	294	312
PSM	SGPKPFSAPKPQTSPSPK	46	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=6535	30.281	2	1916.9397	1916.9397	R	R	294	312
PSM	SHSRQASTDAGTAGALTPQHVR	47	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,4-UNIMOD:267,8-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=6794	31.585	3	2427.0597	2427.0597	K	A	103	125
PSM	VSHSSGPKADSSPKGSR	48	sp|Q9P227|RHG23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=631	4.8623	2	1762.7999	1762.7999	K	G	832	849
PSM	ANSPEKPPEAGAAHKPR	49	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=1373	6.9434	2	1835.868	1835.8680	K	A	210	227
PSM	ERQEAEEAKEALLQASR	50	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12456	59.043	2	1956.9865	1956.9865	K	D	392	409
PSM	FASDDEHDEHDENGATGPVKR	51	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=4084	18.835	2	2404.9557	2404.9557	K	A	364	385
PSM	HVAEVLEYTKDEQLESLFQR	52	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23329	116.75	3	2433.2176	2433.2176	R	T	114	134
PSM	IHRASDPGLPAEEPKEK	53	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=4902	22.459	2	1952.9357	1952.9357	R	S	1855	1872
PSM	KEKPELSEPSHLNGPSSDPEAAFLSR	54	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:21	ms_run[2]:scan=16484	79.539	3	2901.3546	2901.3546	K	D	1589	1615
PSM	KFPDRLAEDEGDSEPEAVGQSR	55	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:21	ms_run[2]:scan=11941	56.329	3	2511.0915	2511.0915	K	G	1452	1474
PSM	KGVNLPGAAVDLPAVSEKDIQDLK	56	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:188,18-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=22899	114.38	3	2494.4141	2494.4141	K	F	207	231
PSM	KHIKEEPLSEEEPCTSTAIASPEK	57	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21,14-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=10972	51.463	3	2869.2494	2869.2494	K	K	494	518
PSM	RKTDTVVESSVSGDHSGTLR	58	sp|Q9NXL2-1|ARH38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=6507	30.12	2	2210.0329	2210.0329	R	R	32	52
PSM	RKTSDANETEDHLESLICK	59	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=15667	75.199	2	2325.0308	2325.0308	R	V	19	38
PSM	RLELLPSAESPVCWLEQPESHQR	60	sp|O95402|MED26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=25872	131.23	3	2840.3317	2840.3317	R	L	328	351
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	61	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7924	36.696	3	2830.1597	2830.1597	R	T	13	39
PSM	RSASASHQADIKEAR	62	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=1244	6.5794	2	1705.7897	1705.7897	R	R	96	111
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	63	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=15337	73.439	3	3044.4006	3044.4006	K	H	346	374
PSM	SRSHTSEGAHLDITPNSGAAGNSAGPK	64	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21	ms_run[2]:scan=7534	34.938	3	2698.2096	2698.2096	R	S	281	308
PSM	TGHILHPEYLQPLPSTPVSPIELDAK	65	sp|Q96F45-3|ZN503_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:21	ms_run[2]:scan=22523	112.41	3	2931.4783	2931.4783	R	K	84	110
PSM	VRGGAPDPSPGATATPGAPAQPSSPDARR	66	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	24-UNIMOD:21	ms_run[2]:scan=7063	32.865	3	2820.3304	2820.3304	R	N	503	532
PSM	KPALFPEPAKTAPPASPEAR	67	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21	ms_run[1]:scan=11386	53.509525	3	2155.089623	2154.087456	R	K	527	547
PSM	QRSPLLNQPVPELSHASLIANQSPFR	68	sp|Q9NPI6|DCP1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=25505	129.086705	3	2961.4853	2961.4857	R	A	351	377
PSM	GGGLRLPLLPPESPGPLR	69	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	13-UNIMOD:21	ms_run[1]:scan=25435	128.64923833333333	2	1906.026226	1905.023734	R	Q	841	859
PSM	GRKDDDSDDESQSSHTGK	70	sp|O94874-3|UFL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=545	4.6	3	2042.7814	2042.7814	K	K	452	470
PSM	HGSFHEDEDPIGSPR	71	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=7860	36.419	2	1768.7082	1768.7082	R	L	1266	1281
PSM	HIKEEPLSEEEPCTSTAIASPEKK	72	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=9971	46.476	3	2789.2831	2789.2831	K	K	495	519
PSM	HVSPVTPPREVPIYANR	73	sp|Q13443|ADAM9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,9-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=13933	66.25	2	2031.0206	2031.0206	R	F	756	773
PSM	KLGGSLADSYLDEGFLLDKK	74	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=22915	114.46	3	2168.1365	2168.1365	K	I	157	177
PSM	KLPVDSVFNKFEDEDSDDVPR	75	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20487	101.79	2	2450.1601	2450.1601	K	K	688	709
PSM	KSLLSHEFQDETDTEEETLYSSKH	76	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=15851	76.281	3	2932.2652	2932.2652	K	-	1110	1134
PSM	LHDFLAHSSEESEETSSPPR	77	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	17-UNIMOD:21	ms_run[2]:scan=10683	50.07	3	2333.9801	2333.9801	K	L	18	38
PSM	LTLYDIAHTPGVAADLSHIETK	78	sp|P40926-2|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=25120	126.75	3	2364.2325	2364.2325	R	A	53	75
PSM	MLGQKATPPPSPLLSELLKK	79	sp|Q9H0E9-3|BRD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=24125	121.11	3	2227.2051	2227.2051	K	G	118	138
PSM	NTPHRGSSAGGGGSGAAAATAATAGGQHR	80	sp|O00458|IFRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=2700	12.309	3	2612.159	2612.1590	R	N	8	37
PSM	RAHLTVGQAAAGGSGNLLTER	81	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,14-UNIMOD:21,21-UNIMOD:267	ms_run[2]:scan=12718	60.349	3	2178.081	2178.0810	R	S	316	337
PSM	RNDHDDDEDEEVISK	82	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=2861	12.897	2	1814.7555	1814.7555	K	T	341	356
PSM	RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR	83	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,13-UNIMOD:21,33-UNIMOD:267	ms_run[2]:scan=15953	76.841	4	3374.6636	3374.6636	R	-	861	894
PSM	SHHAPMSPGSSGGGGQPLAR	84	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=5489	25.236	3	1966.8469	1966.8469	R	T	357	377
PSM	SRSPLDKDTYPPSASVVGASVGGHR	85	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21	ms_run[2]:scan=12434	58.944	3	2619.2442	2619.2442	R	H	213	238
PSM	TLVHSSSDGHIDPQHAAGK	86	sp|Q8N5C8-2|TAB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=4919	22.528	2	2041.9314	2041.9314	R	Q	97	116
PSM	VGRLSPCVPAKPPLAEFEEGLLDR	87	sp|Q15742|NAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=26936	137.72	3	2729.3612	2729.3612	R	C	475	499
PSM	DRDDNSVVGSDFEPWTNKR	88	sp|Q7Z3J2|VP35L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16423	79.263	3	2236.0145	2236.0145	R	G	103	122
PSM	DTHPGSPGSPGPALRPLPAR	89	sp|Q8N0Y2-2|ZN444_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=10660	49.948	2	2059	2059.0000	R	E	226	246
PSM	GLAGPPASPGKAQPPKPER	90	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=7178	33.42	2	1933.9775	1933.9775	K	V	538	557
PSM	HGSFHEDEDPIGSPR	91	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21	ms_run[2]:scan=7890	36.555	2	1758.6999	1758.6999	R	L	1266	1281
PSM	HIKEEPLSEEEPCTSTAIASPEKK	92	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=10791	50.639	2	2789.2831	2789.2831	K	K	495	519
PSM	KKSGVSSDNEDDDDEEDGNYLHPSLFASK	93	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=16015	77.164	3	3277.3572	3277.3572	K	K	277	306
PSM	KNSITEISDNEDDLLEYHRR	94	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=16299	78.627	2	2526.1388	2526.1388	R	Q	576	596
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	95	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:21	ms_run[2]:scan=15990	77.04	3	2775.2402	2775.2402	R	D	285	310
PSM	PAERSSPGQTPEEGAQALAEFAALHGPALR	96	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=26463	134.79	3	3137.4931	3137.4931	R	A	11	41
PSM	RFTPPSTALSPGKMSEALPLGAPDAGAALAGK	97	sp|Q01196-6|RUNX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=24571	123.59	3	3158.5835	3158.5835	R	L	12	44
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTKVDAAEGR	98	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	15-UNIMOD:21	ms_run[2]:scan=16841	81.415	4	4077.9505	4077.9505	R	R	1112	1153
PSM	RIHAESLLLDSPAVAK	99	sp|Q9H4L5-6|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=15030	71.958	2	1798.9342	1798.9342	R	S	369	385
PSM	RLSESLHVVDENKNESK	100	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=8518	39.292	2	2062.9685	2062.9685	R	L	633	650
PSM	RNSRTEEPTVASESVENGHR	101	sp|Q14686|NCOA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=4547	20.908	3	2334.035	2334.0350	R	K	2016	2036
PSM	SGPKPFSAPKPQTSPSPK	102	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=7560	35.058	2	1996.9061	1996.9061	R	R	294	312
PSM	SKGHYEVTGSDDETGKLQGSGVSLASK	103	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=11456	53.928	2	2816.2866	2816.2866	K	K	5832	5859
PSM	SRSSSPGKPQAVSSLNSSHSR	104	sp|Q9UHB7|AFF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21	ms_run[2]:scan=2768	12.511	3	2235.0393	2235.0393	K	S	176	197
PSM	THTTALAGRSPSPASGR	105	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2712	12.343	2	1825.7873	1825.7873	K	R	286	303
PSM	TKDLGHNDKSSTPGLK	106	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=1610	7.7516	2	1776.8407	1776.8407	K	S	301	317
PSM	TNILQYASTRPPTLSPIPHIPR	107	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:267,15-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=23948	120.13	3	2571.3477	2571.3477	K	S	766	788
PSM	VERPPSPFSMAPQASLPPVPPR	108	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=21772	108.56	3	2436.2025	2436.2025	K	L	478	500
PSM	VQTLSNQPLLKSPAPPLLHVAALGQK	109	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=23522	117.82	3	2799.5412	2799.5412	K	Q	113	139
PSM	YRYQDEDTPPQEHISPQITNEVIGPELVHVSEK	110	sp|Q12959-5|DLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:21	ms_run[2]:scan=21923	109.3	4	3926.8364	3926.8364	K	N	108	141
PSM	QGSFTIEKPSPNIPIELIPHINK	111	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:28,3-UNIMOD:21,8-UNIMOD:188,23-UNIMOD:188	ms_run[1]:scan=27714	142.70890500000002	3	2646.3853	2646.3856	R	Q	836	859
PSM	RKTSDANETEDHLESLICK	112	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=15832	76.17435333333333	3	2325.031285	2325.030806	R	V	19	38
PSM	CLELFTELAEDKENYKK	113	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=29261	152.77599166666667	2	2112.0073	2112.0080	K	F	420	437
PSM	RKTSDANETEDHLESLICK	114	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=16051	77.33436	2	2325.015081	2325.030806	R	V	19	38
PSM	MTQALALQAGSLEDGGPPRGSEGTPDSLHK	115	sp|O75145|LIPA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	2-UNIMOD:21,19-UNIMOD:267,27-UNIMOD:21	ms_run[1]:scan=15168	72.63494666666666	4	3190.405207	3189.407844	R	A	727	757
PSM	CLLADLPLPPELPGGDDLSKSPEEKK	116	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=26748	136.52	3	2897.4133	2897.4133	R	T	644	670
PSM	GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPR	117	sp|O96013-3|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	13-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=19921	98.556	3	3454.6857	3454.6857	R	S	102	138
PSM	GHYTEGAELVDSVLDVVRK	118	sp|Q13509-2|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=26713	136.3	3	2086.0695	2086.0695	K	E	32	51
PSM	GSEDSPPKHAGNNESHSSR	119	sp|P48651-2|PTSS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:21	ms_run[2]:scan=713	5.0824	2	2071.8345	2071.8345	K	R	292	311
PSM	HASAPSHVQPSDSEKNR	120	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=1192	6.4344	2	1925.8381	1925.8381	R	T	339	356
PSM	HIKEEPLSEEEPCTSTAIASPEKK	121	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10586	49.641	2	2789.2831	2789.2831	K	K	495	519
PSM	IKKSEAPAEVTHFSPK	122	sp|Q6PID6|TTC33_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:188,3-UNIMOD:188,14-UNIMOD:21,16-UNIMOD:188	ms_run[2]:scan=6814	31.686	2	1865.9787	1865.9787	R	S	184	200
PSM	KGEVASDLVSPANQELHVEKPLPR	123	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=15844	76.243	3	2692.3585	2692.3585	R	S	1409	1433
PSM	KIERLDTDDLDEIEK	124	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13919	66.189	2	1830.9211	1830.9211	K	I	353	368
PSM	KIPNPDFFEDLEPFR	125	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27636	142.21	2	1862.9203	1862.9203	R	M	293	308
PSM	KPSPSESPEPWKPFPAVSPEPR	126	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=17980	87.646	2	2525.1992	2525.1992	R	R	280	302
PSM	NQKPSQVNGAPGSPTEPAGQKQHQK	127	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:188,13-UNIMOD:21,21-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=1661	7.9605	3	2710.3322	2710.3322	K	A	1255	1280
PSM	RKGAASPVLQEDHCDSLPSVLQVEEK	128	sp|Q8N9B5-2|JMY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17503	84.873	3	2971.4111	2971.4111	R	T	708	734
PSM	RLELLPSAESPVCWLEQPESHQR	129	sp|O95402|MED26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,10-UNIMOD:21,13-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=25873	131.24	3	2860.3482	2860.3482	R	L	328	351
PSM	RLGGLRPESPESLTSVSR	130	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=13743	65.313	2	2020.0103	2020.0103	R	T	10	28
PSM	RRGSSGSVDETLFALPAASEPVIR	131	sp|Q9NQC3-5|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,2-UNIMOD:267,4-UNIMOD:21,24-UNIMOD:267	ms_run[2]:scan=23028	115.08	3	2624.3102	2624.3102	K	S	178	202
PSM	SDNSDIRPSGSPPPPTLPASPSNHVSSLPPFIAPPGR	132	sp|Q8NEZ4-2|KMT2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=22776	113.73	4	3904.8186	3904.8186	K	V	1988	2025
PSM	SRSSPSTDHYKQEASVELR	133	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21	ms_run[2]:scan=8120	37.501	2	2256.0172	2256.0172	R	R	919	938
PSM	TGSDHTNPTSPLLVKPSDLLEENKINSSVK	134	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21	ms_run[2]:scan=20786	103.57	4	3299.6286	3299.6286	R	F	446	476
PSM	VAAAAGSGPSPPGSPGHDRER	135	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21,19-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=3084	13.865	2	2071.934	2071.9340	R	Q	38	59
PSM	VKPETPPRQSHSGSISPYPK	136	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=6080	28.034	2	2271.1049	2271.1049	K	V	979	999
PSM	VPAAFPTKVPVPGPGSGGNGPEREGPEEPGLAK	137	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:21	ms_run[2]:scan=17867	87.022	3	3274.6024	3274.6024	R	Q	632	665
PSM	KPSPSESPEPWKPFPAVSPEPR	138	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=17916	87.27453	3	2525.200287	2525.199192	R	R	280	302
PSM	AIGSSPLGSGEGLLGLSPGPNGHSHLLK	139	sp|Q8IY67|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21,28-UNIMOD:188	ms_run[1]:scan=23649	118.52097333333334	3	2738.372529	2737.389574	K	V	508	536
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	140	sp|Q7Z422|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=20279	100.588775	3	2716.437518	2715.436068	K	I	37	62
PSM	SGPKPFSAPKPQTSPSPK	141	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:188,10-UNIMOD:188,14-UNIMOD:21,18-UNIMOD:188	ms_run[1]:scan=6619	30.698276666666665	2	1934.998434	1935.000116	R	R	295	313