MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH20.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	null	484-UNIMOD:21	0.05	55.0	1	1	1
PRT	sp|Q9BPX5|ARP5L_HUMAN	Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens OX=9606 GN=ARPC5L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	64-UNIMOD:21	0.13	45.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	70-UNIMOD:21,65-UNIMOD:21	0.31	45.0	2	1	0
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	260-UNIMOD:21,258-UNIMOD:188,276-UNIMOD:188	0.06	44.0	2	1	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	21-UNIMOD:21,18-UNIMOD:21	0.05	44.0	3	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	1010-UNIMOD:21,1016-UNIMOD:267	0.03	44.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	307-UNIMOD:21	0.04	43.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	351-UNIMOD:21,353-UNIMOD:188,355-UNIMOD:188	0.04	43.0	1	1	1
PRT	sp|Q15185-3|TEBP_HUMAN	Isoform 3 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	58-UNIMOD:4	0.14	42.0	2	1	0
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	327-UNIMOD:4,328-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	112-UNIMOD:4	0.03	42.0	1	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	575-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1162-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	23-UNIMOD:21	0.09	41.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	238-UNIMOD:21	0.04	41.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	366-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	50-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|Q7Z309-5|F122B_HUMAN	Isoform 5 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	66-UNIMOD:21	0.12	40.0	1	1	1
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	379-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q8N1P7|CRBG2_HUMAN	Beta/gamma crystallin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CRYBG2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	441-UNIMOD:21,154-UNIMOD:21	0.03	40.0	3	2	1
PRT	sp|Q7Z422|SZRD1_HUMAN	SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	39-UNIMOD:21	0.17	40.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	32-UNIMOD:21,58-UNIMOD:4,31-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.02	39.0	2	1	0
PRT	sp|Q12959-5|DLG1_HUMAN	Isoform 5 of Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	524-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q6PJT7-3|ZC3HE_HUMAN	Isoform 3 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	88-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	125-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P51397|DAP1_HUMAN	Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.25	38.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	772-UNIMOD:21,764-UNIMOD:267,777-UNIMOD:267	0.01	38.0	2	1	0
PRT	sp|Q9HCK8-2|CHD8_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1141-UNIMOD:21,1145-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1418-UNIMOD:21,1421-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1859-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	21-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	430-UNIMOD:21,443-UNIMOD:21	0.06	38.0	1	1	1
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	705-UNIMOD:21,712-UNIMOD:4,717-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q9UKE5|TNIK_HUMAN	TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	769-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9UPS6|SET1B_HUMAN	Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1659-UNIMOD:21,1663-UNIMOD:21	0.01	38.0	1	1	0
PRT	sp|Q7Z333|SETX_HUMAN	Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	2472-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O75427|LRCH4_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	281-UNIMOD:21,283-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1616-UNIMOD:21,1620-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	314-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9UK61-2|TASOR_HUMAN	Isoform 2 of Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	531-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8NEV8-2|EXPH5_HUMAN	Isoform 2 of Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1844-UNIMOD:21,1851-UNIMOD:4	0.01	37.0	1	1	1
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	256-UNIMOD:267,276-UNIMOD:21,282-UNIMOD:188	0.06	37.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	743-UNIMOD:21,758-UNIMOD:4	0.03	37.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	109-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	294-UNIMOD:267,295-UNIMOD:21,297-UNIMOD:21,302-UNIMOD:267	0.01	37.0	2	2	2
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	128-UNIMOD:4	0.03	37.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RKVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	26-UNIMOD:21	ms_run[2]:scan=12142	58.698	3	3209.5466	3209.5466	R	A	459	493
PSM	AFHAALRNSPVNTKNQAVK	2	sp|Q9BPX5|ARP5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21	ms_run[2]:scan=6565	30.763	2	2145.0844	2145.0844	R	E	56	75
PSM	NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLR	3	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	7-UNIMOD:21	ms_run[2]:scan=18772	94.13	4	3904.8666	3904.8666	R	N	64	100
PSM	KHSPQHTTTLSLSTLATPK	4	sp|P52799|EFNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	3-UNIMOD:21	ms_run[2]:scan=12673	61.306	2	2127.0725	2127.0725	R	R	258	277
PSM	RLGGLRPESPESLTSVSR	5	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:21	ms_run[2]:scan=13494	65.563	2	2020.0103	2020.0103	R	T	10	28
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	6	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	22-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=20974	107.03	3	2628.3704	2628.3704	R	S	989	1017
PSM	SGPKPFSAPKPQTSPSPK	7	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=6868	32.147	2	1916.9397	1916.9397	R	R	294	312
PSM	YGLIYHASLVGQTSPKHK	8	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21,16-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=12902	62.528	2	2090.0753	2090.0753	K	G	338	356
PSM	HLNEIDLFHCIDPNDSK	9	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	10-UNIMOD:4	ms_run[2]:scan=19609	99.053	2	2065.9527	2065.9527	K	H	49	66
PSM	KHSEEAEFTPPLKCSPK	10	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	14-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9031	42.446	2	2063.9387	2063.9387	R	R	314	331
PSM	WCDKSDEDDWSKPLPPSER	11	sp|O00571-2|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	2-UNIMOD:4	ms_run[2]:scan=12337	59.712	2	2346.0223	2346.0223	R	L	111	130
PSM	LIEGVHPGSLVEKLPDSPALAKK	12	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	17-UNIMOD:21	ms_run[1]:scan=17073	84.40254666666667	3	2477.329515	2477.329478	R	A	559	582
PSM	HSSETFSSTTTVTPVSPSFAHNPKR	13	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:21	ms_run[2]:scan=12269	59.328	3	2781.2759	2781.2759	R	H	1147	1172
PSM	NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLR	14	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	2-UNIMOD:21	ms_run[2]:scan=18946	95.148	4	3904.8666	3904.8666	R	N	64	100
PSM	RKPVLPALTINPTIAEGPSPTSEGASEANLVDLQK	15	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	19-UNIMOD:21	ms_run[2]:scan=23850	122.73	3	3692.9026	3692.9026	R	K	5	40
PSM	RSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYK	16	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=23193	119.06	3	3573.693	3573.6930	R	Q	228	263
PSM	FASDDEHDEHDENGATGPVKR	17	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=4351	20.384	3	2404.9557	2404.9557	K	A	364	385
PSM	KGLPLGSAVSSPVLFSPVGRR	18	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:21	ms_run[2]:scan=20480	104.18	3	2203.1878	2203.1878	R	S	35	56
PSM	RIDFTPVSPAPSPTRGFGK	19	sp|Q7Z309-5|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:21	ms_run[2]:scan=16071	79.041	2	2109.0408	2109.0408	K	M	55	74
PSM	RIHAESLLLDSPAVAK	20	sp|Q9H4L5-6|OSBL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	11-UNIMOD:21	ms_run[2]:scan=14795	72.178	2	1798.9342	1798.9342	R	S	369	385
PSM	RKDVPSPGGLSAPSSPR	21	sp|Q8N1P7|CRBG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:21	ms_run[2]:scan=7469	35.018	2	1786.8727	1786.8727	R	N	427	444
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	22	sp|Q7Z422|SZRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=19812	100.28823166666666	3	2715.436923	2715.436068	K	I	37	62
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	23	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22865	117.23581000000001	4	4104.0242	4103.0402	R	R	26	71
PSM	ARPFPDGLAEDIDKGEVSAR	24	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17330	85.792	3	2142.0705	2142.0705	K	Q	606	626
PSM	IHDLREQMMNSSISSGSGSLR	25	sp|Q12959-5|DLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	19-UNIMOD:21	ms_run[2]:scan=14477	70.637	3	2384.0614	2384.0614	K	T	506	527
PSM	KFNHDGEEEEEDDDYGSR	26	sp|Q6PJT7-3|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=3848	18.011	2	2169.8359	2169.8359	K	T	307	325
PSM	KGSKVGDFGDAINWPTPGEIAHK	27	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=20340	103.33	3	2503.1897	2503.1897	R	S	86	109
PSM	KLASQGDSISSQLGPIHPPPR	28	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=15207	74.345	3	2264.1314	2264.1314	K	T	122	143
PSM	TELLVPLPGPREPSPHPGVGLTSGSSR	29	sp|Q8N1P7|CRBG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:21	ms_run[2]:scan=20119	102.11	3	2816.4222	2816.4222	R	S	141	168
PSM	DKDDQEWESPSPPKPTVFISGVIAR	30	sp|P51397|DAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=22551	115.53	3	2797.3923	2797.3923	K	G	41	66
PSM	GGGLRLPLLPPESPGPLR	31	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	13-UNIMOD:21	ms_run[2]:scan=24745	128.06	2	1905.0237	1905.0237	R	Q	760	778
PSM	HFSTLKDDDLVEFSDLESEDDERPR	32	sp|Q9HCK8-2|CHD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=20938	106.85	3	3153.2853	3153.2853	R	S	1128	1153
PSM	HSASPVVFTSARSSPKEELHPAAPSQLAPSFSSSSSSSSGPR	33	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=17266	85.452	4	4397.9955	4397.9955	R	S	1409	1451
PSM	IHRASDPGLPAEEPKEK	34	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21	ms_run[2]:scan=5342	24.749	2	1952.9357	1952.9357	R	S	1855	1872
PSM	KHPGGGESDASPEAGSGGGGVALKK	35	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:21	ms_run[2]:scan=3842	17.989	3	2329.07	2329.0700	K	E	14	39
PSM	RHSSDINHLVTQGRESPEGSYTDDANQEVR	36	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=12272	59.342	4	3556.5006	3556.5006	R	G	428	458
PSM	RLGGLRPESPESLTSVSR	37	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=13305	64.564	2	2020.0103	2020.0103	R	T	10	28
PSM	RSASPHDVDLCLVSPCEFEHR	38	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=18176	90.678	3	2590.1094	2590.1094	R	K	702	723
PSM	VRANSKSEGSPVLPHEPAK	39	sp|Q9UKE5|TNIK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21	ms_run[2]:scan=4931	22.971	3	2082.0259	2082.0259	R	V	760	779
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	40	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=23051	118.24302333333334	4	4104.025621	4103.041199	R	R	26	71
PSM	HEDLVPPAGSPELSPPQPLFRPR	41	sp|Q9UPS6|SET1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=21620	110.54604833333335	3	2695.256992	2695.256069	R	S	1650	1673
PSM	SLTHPPTIAPEGSRPQGGLPSSKLDSGFAK	42	sp|Q7Z333|SETX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21	ms_run[1]:scan=16313	80.34037166666667	3	3111.533068	3111.539030	R	T	2472	2502
PSM	ARPFPDGLAEDIDKGEVSAR	43	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17144	84.768	3	2142.0705	2142.0705	K	Q	606	626
PSM	GGGLRLPLLPPESPGPLR	44	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:267,13-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=24626	127.33	2	1925.0403	1925.0403	R	Q	760	778
PSM	GSALGDLAPSRPPSFSPCPAEDLFPGHR	45	sp|O75427|LRCH4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	16-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=24206	124.81	3	3014.3746	3014.3746	R	Y	266	294
PSM	HEDLVPPAGSPELSPPQPLFRPR	46	sp|Q9UPS6-2|SET1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=21425	109.52	3	2695.2561	2695.2561	R	S	1607	1630
PSM	HLNEIDLFHCIDPNDSK	47	sp|Q15185-3|TEBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:4	ms_run[2]:scan=19614	99.088	2	2065.9527	2065.9527	K	H	49	66
PSM	KHSPQHTTTLSLSTLATPK	48	sp|P52799|EFNB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:188,3-UNIMOD:21,19-UNIMOD:188	ms_run[2]:scan=12761	61.799	2	2139.1128	2139.1128	R	R	258	277
PSM	LFPSPGLPTRTSPVRGSK	49	sp|Q8IY17-5|PLPL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=13420	65.154	2	1976.0245	1976.0245	R	R	303	321
PSM	LIPITGGNARSPEDQLGKHGEK	50	sp|Q9UK61-2|TASOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:21	ms_run[2]:scan=10782	51.3	2	2396.1849	2396.1849	K	Q	521	543
PSM	RFRSFSELPSCDGNESWAYR	51	sp|Q8NEV8-2|EXPH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18349	91.682	3	2543.0689	2543.0689	R	S	1841	1861
PSM	RLGGLRPESPESLTSVSR	52	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:21	ms_run[2]:scan=13687	66.572	2	2020.0103	2020.0103	R	T	10	28
PSM	RNHYLDLAGIENYTSQFGPGSPSVAQK	53	sp|Q969G9|NKD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,21-UNIMOD:21,27-UNIMOD:188	ms_run[2]:scan=23204	119.12	3	3044.4364	3040.4483	R	S	256	283
PSM	RSSFRLQTEAQEDDWYDCHR	54	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=15331	75	3	2678.0969	2678.0969	R	E	741	761
PSM	SHSRQASTDAGTAGALTPQHVR	55	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=6038	28.338	3	2327.0768	2327.0768	K	A	103	125
PSM	TELLVPLPGPREPSPHPGVGLTSGSSR	56	sp|Q8N1P7|CRBG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:21	ms_run[2]:scan=19940	101.09	3	2816.4222	2816.4222	R	S	141	168
PSM	THTTALAGRSPSPASGR	57	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	9-UNIMOD:267,10-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=2739	12.648	2	1845.8039	1845.8039	K	R	286	303
PSM	THTTALAGRSPSPASGRR	58	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2081	9.5046	2	1981.8885	1981.8885	K	G	286	304
PSM	WCDKSDEDDWSKPLPPSER	59	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	2-UNIMOD:4	ms_run[1]:scan=12460	60.350101666666674	3	2347.025451	2346.022276	R	L	127	146