MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH21.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH21.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9GZV5|WWTR1_HUMAN	WW domain-containing transcription regulator protein 1 OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	89-UNIMOD:21,114-UNIMOD:267	0.07	47.0	2	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	183-UNIMOD:21,186-UNIMOD:267	0.03	46.0	4	1	0
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	44-UNIMOD:267,51-UNIMOD:21,61-UNIMOD:267	0.03	44.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	240-UNIMOD:21,238-UNIMOD:21	0.06	43.0	2	1	0
PRT	sp|Q8IZ73-2|RUSD2_HUMAN	Isoform 2 of RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	68-UNIMOD:21	0.06	42.0	1	1	1
PRT	sp|Q86SQ0-2|PHLB2_HUMAN	Isoform 2 of Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	508-UNIMOD:4,513-UNIMOD:21,522-UNIMOD:4	0.02	42.0	1	1	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	183-UNIMOD:21,186-UNIMOD:267	0.02	42.0	2	1	0
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	772-UNIMOD:21	0.01	41.0	2	1	0
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1616-UNIMOD:21,1620-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q8N5S9|KKCC1_HUMAN	Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	100-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1401-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	1862-UNIMOD:21	0.00	41.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	366-UNIMOD:21	0.06	41.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	437-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	40.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	31-UNIMOD:21,58-UNIMOD:4,32-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	35-UNIMOD:21	0.05	39.0	1	1	1
PRT	sp|O75190-4|DNJB6_HUMAN	Isoform D of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	226-UNIMOD:4,228-UNIMOD:21,236-UNIMOD:267,238-UNIMOD:267	0.06	39.0	2	1	0
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	123-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	863-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q6DN90-2|IQEC1_HUMAN	Isoform 2 of IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	295-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q9H4M7-2|PKHA4_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	229-UNIMOD:21,241-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	202-UNIMOD:21	0.12	38.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	251-UNIMOD:188,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	161-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	189-UNIMOD:188,193-UNIMOD:188,194-UNIMOD:188	0.15	38.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	428-UNIMOD:267,430-UNIMOD:21,441-UNIMOD:267	0.03	38.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	18-UNIMOD:21	0.05	38.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SHSSPASLQLGTGAGAAGSPAQQHAHLR	1	sp|Q9GZV5|WWTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=10170	49.662	3	2783.3128	2783.3128	R	Q	87	115
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	2	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	26-UNIMOD:21	ms_run[2]:scan=25038	132.34	3	3131.439	3131.4390	K	E	158	187
PSM	SHSSPASLQLGTGAGAAGSPAQQHAHLR	3	sp|Q9GZV5|WWTR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=10211	49.907	3	2773.3046	2773.3046	R	Q	87	115
PSM	REEQTDTSDGESVTHHIR	4	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:267,8-UNIMOD:21,18-UNIMOD:267	ms_run[2]:scan=4074	18.564	2	2195.9348	2195.9348	R	R	44	62
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	5	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	26-UNIMOD:21	ms_run[2]:scan=24876	131.33	3	3131.439	3131.4390	K	E	158	187
PSM	KIDTHPSPSHSSTVKDSLIELK	6	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	9-UNIMOD:21	ms_run[2]:scan=11348	55.957	2	2498.2418	2498.2418	R	E	232	254
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	7	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	26-UNIMOD:21	ms_run[2]:scan=24710	130.32	3	3131.439	3131.4390	K	E	158	187
PSM	ASHQQNGDAGGDAKVELSPGPPKPAGR	8	sp|Q8IZ73-2|RUSD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:21	ms_run[2]:scan=6752	32.025	3	2720.2668	2720.2668	R	E	51	78
PSM	CHRKDSLPDADLASCGSLSQSSASFFTPR	9	sp|Q86SQ0-2|PHLB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=19441	100.61	3	3276.4329	3276.4329	R	S	508	537
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	10	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[1]:scan=24871	131.311	3	3141.445531	3141.447250	K	E	158	187
PSM	GGGLRLPLLPPESPGPLR	11	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=24152	127.04	2	1905.0237	1905.0237	R	Q	760	778
PSM	GGGLRLPLLPPESPGPLR	12	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	13-UNIMOD:21	ms_run[2]:scan=24325	128.07	2	1905.0237	1905.0237	R	Q	760	778
PSM	HEDLVPPAGSPELSPPQPLFRPR	13	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=20839	108.78	3	2695.2561	2695.2561	R	S	1607	1630
PSM	KLSLQERPAGSYLEAQAGPYATGPASHISPR	14	sp|Q8N5S9|KKCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	29-UNIMOD:21	ms_run[2]:scan=16479	83.407	4	3331.6351	3331.6351	R	A	72	103
PSM	MTTTSAAAYGTHLSPHVPHR	15	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	11-UNIMOD:21	ms_run[2]:scan=11254	55.476	2	2214.0041	2214.0041	R	V	1391	1411
PSM	RQGSFSEDVISHKGDLR	16	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	6-UNIMOD:21	ms_run[2]:scan=10507	51.512	2	2009.932	2009.9320	K	F	1857	1874
PSM	TKFASDDEHDEHDENGATGPVKR	17	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	5-UNIMOD:21	ms_run[2]:scan=3284	14.975	3	2634.0984	2634.0984	K	A	362	385
PSM	HASSSPESPKPAPAPGSHR	18	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	5-UNIMOD:21	ms_run[2]:scan=1228	6.4125	2	1975.8902	1975.8902	R	E	433	452
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVK	19	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=28221	152.468675	3	3700.604901	3700.608762	R	L	102	135
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	20	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	26-UNIMOD:21	ms_run[1]:scan=25199	133.34459833333335	3	3132.440917	3131.438981	K	E	158	187
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	21	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22239	116.37724666666665	3	4104.020841	4103.041199	R	R	26	71
PSM	FGPGVAFRAPSIHGGSGGR	22	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:21	ms_run[2]:scan=15305	76.953	2	1905.8999	1905.8999	R	G	25	44
PSM	HAPHCLSEEEGEQDRPR	23	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,7-UNIMOD:21,15-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=3994	18.27	2	2145.8802	2145.8802	R	A	222	239
PSM	RAEVLGHKTPEPAPR	24	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:21	ms_run[2]:scan=3157	14.422	2	1736.8723	1736.8723	K	R	115	130
PSM	RRSQFFEQGSSDSVVPDLPVPTISAPSR	25	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=23246	121.83	3	3138.5135	3138.5135	K	W	861	889
PSM	SLGGQQGSPKHGPHSGAPK	26	sp|Q6DN90-2|IQEC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:21	ms_run[2]:scan=1187	6.2734	2	1905.8847	1905.8847	R	S	288	307
PSM	SPDLFTPLSRPPSPLSLPRPR	27	sp|Q9H4M7-2|PKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=24164	127.1	3	2489.2233	2489.2233	R	S	229	250
PSM	TKFASDDEHDEHDENGATGPVKR	28	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:21	ms_run[2]:scan=3488	16.063	2	2634.0984	2634.0984	K	A	362	385
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	29	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22458	117.51451000000002	3	4104.019449	4103.041199	R	R	26	71
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGR	30	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6901	32.744	4	2870.2416	2870.2416	R	R	200	233
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	31	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=23051	120.74	4	3925.6891	3925.6891	R	I	250	282
PSM	HAPHCLSEEEGEQDRPR	32	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=4000	18.291	2	2125.8637	2125.8637	R	A	222	239
PSM	IHEKDPNSATATAPPSPLKR	33	sp|Q92766-6|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=5895	28.075	2	2209.0892	2209.0892	K	R	146	166
PSM	KIDTHPSPSHSSTVKDSLIELK	34	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=11518	56.865	3	2498.2418	2498.2418	R	E	232	254
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	35	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	32-UNIMOD:188,36-UNIMOD:188,37-UNIMOD:188	ms_run[2]:scan=11213	55.284	3	4263.6037	4263.6037	K	S	158	195
PSM	RHSSDINHLVTQGR	36	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,3-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=6202	29.572	2	1718.8117	1718.8117	R	E	428	442
PSM	RLGGLRPESPESLTSVSR	37	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=13123	65.124	2	2020.0103	2020.0103	R	T	10	28
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	38	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24703	130.28	3	3141.4472	3141.4472	K	E	158	187