MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH22.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH22.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	49.0	null	32-UNIMOD:21,58-UNIMOD:4,26-UNIMOD:267,31-UNIMOD:21,70-UNIMOD:267	0.04	49.0	6	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	null	183-UNIMOD:21,186-UNIMOD:267	0.03	48.0	6	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	null	802-UNIMOD:21	0.02	45.0	2	1	0
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	28-UNIMOD:21	0.08	43.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	43.0	1	1	1
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null	687-UNIMOD:21	0.05	42.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	154-UNIMOD:21,176-UNIMOD:267	0.04	42.0	1	1	1
PRT	sp|Q86SQ0-2|PHLB2_HUMAN	Isoform 2 of Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	157-UNIMOD:21	0.01	41.0	1	1	1
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	617-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	202-UNIMOD:21	0.12	40.0	2	1	0
PRT	sp|Q14966-3|ZN638_HUMAN	Isoform 3 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	605-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	307-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	295-UNIMOD:21,297-UNIMOD:21,294-UNIMOD:267,302-UNIMOD:267,351-UNIMOD:21,353-UNIMOD:21	0.02	40.0	4	3	2
PRT	sp|O75190-4|DNJB6_HUMAN	Isoform D of DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	226-UNIMOD:4,228-UNIMOD:21,236-UNIMOD:267,238-UNIMOD:267	0.06	39.0	2	1	0
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.09	39.0	1	1	1
PRT	sp|Q9Y4G8|RPGF2_HUMAN	Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	585-UNIMOD:21,595-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q9Y2H5|PKHA6_HUMAN	Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	866-UNIMOD:267,867-UNIMOD:21,881-UNIMOD:267	0.02	39.0	1	1	1
PRT	sp|Q53F19-2|NCBP3_HUMAN	Isoform 2 of Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	220-UNIMOD:21,226-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	568-UNIMOD:267	0.02	38.0	2	1	0
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	428-UNIMOD:267,430-UNIMOD:21,441-UNIMOD:267,431-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q8WWM7-7|ATX2L_HUMAN	Isoform 7 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	31-UNIMOD:21,58-UNIMOD:4,26-UNIMOD:267,70-UNIMOD:267	0.12	38.0	3	1	0
PRT	sp|Q9H4M7-2|PKHA4_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	229-UNIMOD:21,238-UNIMOD:267,241-UNIMOD:21,247-UNIMOD:267,249-UNIMOD:267,237-UNIMOD:21,534-UNIMOD:21	0.09	38.0	4	2	1
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	91-UNIMOD:21	0.08	37.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	340-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q02086-2|SP2_HUMAN	Isoform 2 of Transcription factor Sp2 OS=Homo sapiens OX=9606 GN=SP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	64-UNIMOD:188,71-UNIMOD:21,74-UNIMOD:188,83-UNIMOD:188	0.04	36.0	1	1	1
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	226-UNIMOD:21,234-UNIMOD:21,224-UNIMOD:267,244-UNIMOD:267	0.09	36.0	3	1	0
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPTIN9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	123-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	311-UNIMOD:21	0.08	36.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1149-UNIMOD:21,1162-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q9GZP8|IMUP_HUMAN	Immortalization up-regulated protein OS=Homo sapiens OX=9606 GN=IMUP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	1-UNIMOD:1	0.25	36.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	251-UNIMOD:188,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1688-UNIMOD:21,1692-UNIMOD:4	0.01	35.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	2236-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	513-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q13506-2|NAB1_HUMAN	Isoform Short of NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	183-UNIMOD:21,185-UNIMOD:188	0.06	35.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	152-UNIMOD:21,153-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	495-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	28-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	8-UNIMOD:21	0.16	35.0	1	1	1
PRT	sp|O43491-4|E41L2_HUMAN	Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	613-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	165-UNIMOD:188,169-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4,185-UNIMOD:267	0.05	35.0	1	1	1
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	147-UNIMOD:21	0.13	35.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	366-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q5VT52|RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	928-UNIMOD:21,930-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	772-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9Y2K2-6|SIK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	294-UNIMOD:21,296-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	238-UNIMOD:21,232-UNIMOD:188,246-UNIMOD:188,253-UNIMOD:188	0.06	34.0	3	1	0
PRT	sp|Q8IXQ4-4|GPAM1_HUMAN	Isoform 4 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	105-UNIMOD:21	0.13	34.0	3	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	544-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q9ULH7-4|MRTFB_HUMAN	Isoform 4 of Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	802-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	65-UNIMOD:21	0.31	34.0	1	1	1
PRT	sp|Q96B97-3|SH3K1_HUMAN	Isoform 3 of SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	271-UNIMOD:21,273-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q96II8-3|LRCH3_HUMAN	Isoform 3 of DISP complex protein LRCH3 OS=Homo sapiens OX=9606 GN=LRCH3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	419-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	863-UNIMOD:21,861-UNIMOD:267,862-UNIMOD:267,888-UNIMOD:267	0.02	34.0	2	1	0
PRT	sp|Q6DN90-2|IQEC1_HUMAN	Isoform 2 of IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	295-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q86UU1-3|PHLB1_HUMAN	Isoform 3 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	518-UNIMOD:21,522-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1067-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9C009|FOXQ1_HUMAN	Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	228-UNIMOD:267,248-UNIMOD:21,250-UNIMOD:267	0.08	33.0	1	1	1
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	173-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1616-UNIMOD:21,1620-UNIMOD:21,1627-UNIMOD:267,1629-UNIMOD:267	0.01	33.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	1362-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	867-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	235-UNIMOD:21,241-UNIMOD:188	0.10	33.0	1	1	1
PRT	sp|Q8N201|INT1_HUMAN	Integrator complex subunit 1 OS=Homo sapiens OX=9606 GN=INTS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	13-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|A1L170|CA226_HUMAN	Uncharacterized protein C1orf226 OS=Homo sapiens OX=9606 GN=C1orf226 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	18-UNIMOD:21,24-UNIMOD:188,47-UNIMOD:21,52-UNIMOD:188	0.13	33.0	1	1	1
PRT	sp|Q96F45-3|ZN503_HUMAN	Isoform 3 of Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	102-UNIMOD:21	0.10	33.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	177-UNIMOD:188,188-UNIMOD:21,194-UNIMOD:21,203-UNIMOD:188	0.04	33.0	1	1	1
PRT	sp|Q96B97|SH3K1_HUMAN	SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	493-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	326-UNIMOD:188,328-UNIMOD:21,330-UNIMOD:21,340-UNIMOD:267	0.01	33.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	1	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22329	116.34759833333334	3	4103.033046	4103.041199	R	R	26	71
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	2	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	26-UNIMOD:21	ms_run[2]:scan=24802	131.13	3	3131.439	3131.4390	K	E	158	187
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	3	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22144	115.30984333333333	3	4103.036695	4103.041199	R	R	26	71
PSM	VKAPVHFVEPLSPTGVAGHR	4	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21	ms_run[2]:scan=14535	72.505	2	2177.1147	2177.1147	K	K	791	811
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	5	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	26-UNIMOD:21	ms_run[2]:scan=24965	132.18	3	3131.439	3131.4390	K	E	158	187
PSM	KPRPPPALGPEETSASAGLPK	6	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	14-UNIMOD:21	ms_run[2]:scan=11322	55.051	3	2179.1038	2179.1038	K	K	15	36
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	7	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18572	95.646445	3	3442.3982	3442.4027	K	L	104	135
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	8	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:267,6-UNIMOD:21,33-UNIMOD:4,45-UNIMOD:267	ms_run[1]:scan=22519	117.34637166666666	3	4124.036992	4123.057737	R	R	26	71
PSM	RASAGPAPGPVVTAEGLHPSLPSPTGNSTPLGSSKETR	9	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=17945	91.983	4	3759.8581	3759.8581	R	K	685	723
PSM	QTHLRATPTKAPAPVVLGSPVVLGPPVGQAR	10	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	9-UNIMOD:21,31-UNIMOD:267	ms_run[1]:scan=20395	105.65649666666665	3	3204.766678	3203.757172	R	V	146	177
PSM	HKSHDNVYSLGGLEGR	11	sp|Q86SQ0-2|PHLB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21	ms_run[2]:scan=10789	52.173	2	1847.8316	1847.8316	R	K	155	171
PSM	SHSDASVGSHSSTESEHGSSSPRFPR	12	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=4482	20.517	3	2791.1583	2791.1583	R	Q	597	623
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGR	13	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=7031	33.287	4	2870.2416	2870.2416	R	R	200	233
PSM	HLEAADKGHSPAQKPK	14	sp|Q14966-3|ZN638_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21	ms_run[2]:scan=891	5.4016	2	1792.8621	1792.8621	K	T	596	612
PSM	SGPKPFSAPKPQTSPSPK	15	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	14-UNIMOD:21	ms_run[2]:scan=6839	32.308	2	1916.9397	1916.9397	R	R	294	312
PSM	THTTALAGRSPSPASGR	16	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2887	13.005	2	1825.7873	1825.7873	K	R	286	303
PSM	HAPHCLSEEEGEQDRPR	17	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=4667	21.387	2	2125.8637	2125.8637	R	A	222	239
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	18	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=24450	128.87	3	3010.5625	3010.5625	R	L	40	70
PSM	HIPTALPVSGTLSSSNPDLLQSHHR	19	sp|Q9Y4G8|RPGF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:21,25-UNIMOD:267	ms_run[2]:scan=17103	86.928	3	2753.3526	2753.3526	K	I	571	596
PSM	HRSIHEVDISNLEAALR	20	sp|Q9Y2H5|PKHA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:267,3-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=19485	100.79	2	2059.0115	2059.0115	R	A	865	882
PSM	RPHSPEKAFSSNPVVR	21	sp|Q53F19-2|NCBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:21	ms_run[2]:scan=7067	33.474	2	1886.9152	1886.9152	K	R	217	233
PSM	VKAPVHFVEPLSPTGVAGHR	22	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=14638	73.018	3	2177.1147	2177.1147	K	K	791	811
PSM	HWDQDDDFEFTGSHLTVR	23	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:267	ms_run[2]:scan=17591	89.807	3	2213.9642	2213.9642	K	N	551	569
PSM	RHSSDINHLVTQGR	24	sp|Q5T0N5-3|FBP1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:267,3-UNIMOD:21,14-UNIMOD:267	ms_run[2]:scan=6389	30.038	2	1718.8117	1718.8117	R	E	428	442
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	25	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=22090	115.03	4	4103.0412	4103.0412	R	R	26	71
PSM	SPDLFTPLSRPPSPLSLPRPR	26	sp|Q9H4M7-2|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:21,10-UNIMOD:267,13-UNIMOD:21,19-UNIMOD:267,21-UNIMOD:267	ms_run[2]:scan=24105	126.68	3	2519.2481	2519.2481	R	S	229	250
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	27	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	26-UNIMOD:21	ms_run[2]:scan=24641	130.09	3	3131.439	3131.4390	K	E	158	187
PSM	HSPTSEPTPPGDALPPVSSPHTHR	28	sp|Q9H6S3-2|ES8L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:21	ms_run[2]:scan=9438	45.145	3	2580.1758	2580.1758	K	G	74	98
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	29	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=22275	116.05	4	4103.0412	4103.0412	R	R	26	71
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	30	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:267,6-UNIMOD:21,33-UNIMOD:4,45-UNIMOD:267	ms_run[2]:scan=22214	115.7	3	4123.0577	4123.0577	R	R	26	71
PSM	RYSDHAGPAIPSVVAYPKR	31	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=13145	64.781	3	2163.0626	2163.0626	R	S	338	357
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	32	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	26-UNIMOD:21	ms_run[2]:scan=24929	131.94	4	3131.439	3131.4390	K	E	158	187
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGR	33	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=7236	34.313	4	2870.2416	2870.2416	R	R	200	233
PSM	HWDQDDDFEFTGSHLTVR	34	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17580	89.744	3	2203.9559	2203.9559	K	N	551	569
PSM	LVPIKPAPLPLSPGKNSFGILSSK	35	sp|Q02086-2|SP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:188,12-UNIMOD:21,15-UNIMOD:188,24-UNIMOD:188	ms_run[2]:scan=23552	123.31	3	2557.4783	2557.4783	K	G	60	84
PSM	NRHSPDHPGMGSSQASSSSSLR	36	sp|A0JLT2|MED19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=3383	15.334	3	2360.9917	2360.9917	K	-	223	245
PSM	RAEVLGHKTPEPAPR	37	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:21	ms_run[2]:scan=3513	15.864	2	1736.8723	1736.8723	K	R	115	130
PSM	RAQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	38	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	30-UNIMOD:21	ms_run[2]:scan=13032	64.145	3	3248.5113	3248.5113	R	V	282	316
PSM	RHSSETFSSTTTVTPVSPSFAHNPKR	39	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=12081	59.06	3	3017.3434	3017.3434	R	H	1146	1172
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	40	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24647	130.12	3	3141.4472	3141.4472	K	E	158	187
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	41	sp|Q8N1G0-2|ZN687_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	26-UNIMOD:21,29-UNIMOD:267	ms_run[2]:scan=24803	131.14	3	3141.4472	3141.4472	K	E	158	187
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	42	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22393	116.69753333333333	3	4104.023475	4103.041199	R	R	26	71
PSM	MEFDLGAALEPTSQKPGVGAGHGGD	43	sp|Q9GZP8|IMUP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1	ms_run[1]:scan=24697	130.42616166666667	2	2482.1415	2482.1429	-	P	1	26
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	44	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:188,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=22951	119.82	4	3925.6891	3925.6891	R	I	250	282
PSM	HAPHCLSEEEGEQDRPR	45	sp|O75190-4|DNJB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:4,7-UNIMOD:21,15-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=4682	21.461	2	2145.8802	2145.8802	R	A	222	239
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	46	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11342	55.141	3	4245.5433	4245.5433	K	S	158	195
PSM	LHKRDSFDNCSLGESSK	47	sp|Q5UIP0-2|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=4945	22.709	2	2058.883	2058.8830	R	I	1683	1700
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	48	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=24426	128.72	3	3387.6977	3387.6977	R	L	2234	2264
PSM	LSSVDRHHSVEIKIEK	49	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=7776	36.863	2	1955.983	1955.9830	K	T	505	521
PSM	LWQGHHATESEHSLSPADLGSPASPK	50	sp|Q13506-2|NAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	24-UNIMOD:21,26-UNIMOD:188	ms_run[2]:scan=12609	61.96	3	2824.2913	2824.2913	R	E	160	186
PSM	NRHSPDHPGMGSSQASSSSSLR	51	sp|A0JLT2|MED19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=3450	15.616	2	2360.9917	2360.9917	K	-	223	245
PSM	NRHSPDHPGMGSSQASSSSSLR	52	sp|A0JLT2|MED19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:267,4-UNIMOD:21,22-UNIMOD:267	ms_run[2]:scan=3488	15.765	3	2381.0083	2381.0083	K	-	223	245
PSM	RNSCNVGGGGGGFKHPAFK	53	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=7531	35.733	3	2025.8993	2025.8993	R	R	150	169
PSM	RPHSPEKAFSSNPVVR	54	sp|Q53F19-2|NCBP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=7268	34.479	2	1886.9152	1886.9152	K	R	217	233
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAKK	55	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	27-UNIMOD:21	ms_run[2]:scan=17530	89.463	3	3387.646	3387.6460	R	V	469	500
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	56	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=7263	34.452	3	2750.1933	2750.1933	R	T	13	39
PSM	SLSTSGESLYHVLGLDKNATSDDIKK	57	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:21	ms_run[2]:scan=22632	118	3	2857.3746	2857.3746	R	S	8	34
PSM	SPTKAPHLQLIEGKSSHETLNIVEEK	58	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:21	ms_run[2]:scan=15337	77.024	3	2964.4958	2964.4958	R	K	598	624
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	59	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=23048	120.36444666666665	4	4104.0252	4103.0402	R	R	26	71
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	60	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=22583	117.72296333333333	3	4104.020817	4103.041199	R	R	26	71
PSM	GLAHPKNHLSPQQGGATPQVPSPCCR	61	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:188,10-UNIMOD:21,24-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:267	ms_run[1]:scan=10059	48.46012	3	2890.333153	2889.349864	R	F	160	186
PSM	KRDHANYEEDENGDITPIK	62	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:21	ms_run[1]:scan=7066	33.47164	3	2323.002341	2323.011785	R	A	132	151
PSM	TKFASDDEHDEHDENGATGPVKR	63	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=4312	19.741688333333332	3	2635.082956	2634.098368	K	A	362	385
PSM	GNEPGSDRSPSPSKNDSFFTPDSNHNSLSQSTTGHLSLPQK	64	sp|Q5VT52|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=16951	86.144465	4	4513.941162	4513.944925	R	Q	920	961
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	65	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=22956	119.84	4	3913.6489	3913.6489	R	I	250	282
PSM	GGGLRLPLLPPESPGPLR	66	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=24223	127.46	2	1905.0237	1905.0237	R	Q	760	778
PSM	HQQVPHILQGLLSPR	67	sp|Q9Y2K2-6|SIK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21,15-UNIMOD:267	ms_run[2]:scan=20867	108.19	3	1811.9435	1811.9435	R	H	282	297
PSM	HSQFIGYPITLFVEKER	68	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23407	122.45	3	2063.084	2063.0840	K	D	210	227
PSM	KIDTHPSPSHSSTVKDSLIELK	69	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=11699	56.956	3	2498.2418	2498.2418	R	E	232	254
PSM	KIDTHPSPSHSSTVKDSLIELK	70	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:188,7-UNIMOD:21,15-UNIMOD:188,22-UNIMOD:188	ms_run[2]:scan=11696	56.942	3	2516.3022	2516.3022	R	E	232	254
PSM	KQDDSPPRPIIGPALPPGFIK	71	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=21005	108.96	2	2322.2137	2322.2137	K	S	101	122
PSM	LHPESKDDKHGSYEDAVHSGALND	72	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:21	ms_run[2]:scan=7371	34.971	2	2700.1453	2700.1453	K	-	533	557
PSM	NAPLPSLQNGPNTPNKPSSPPPPQQFVVQHSLFGSPVAK	73	sp|Q9ULH7-4|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=22879	119.41	3	4153.0786	4153.0786	R	T	790	829
PSM	NSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLR	74	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:21	ms_run[2]:scan=18663	96.156	4	3904.8666	3904.8666	R	N	64	100
PSM	PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHR	75	sp|Q96B97-3|SH3K1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	19-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=19555	101.19	4	3965.7245	3965.7245	R	G	253	288
PSM	RHSSDINHLVTQGR	76	sp|Q5T0N5-3|FBP1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=6390	30.041	2	1698.7951	1698.7951	R	E	428	442
PSM	RISHEGSPVKPVAIR	77	sp|Q96II8-3|LRCH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	7-UNIMOD:21	ms_run[2]:scan=5368	24.644	2	1724.9087	1724.9087	R	E	413	428
PSM	RLGLSTLGELKQNLSR	78	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18164	93.247	3	1784.0268	1784.0268	R	S	57	73
PSM	RRSQFFEQGSSDSVVPDLPVPTISAPSR	79	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21	ms_run[2]:scan=23327	121.97	3	3138.5135	3138.5135	K	W	861	889
PSM	RRSQFFEQGSSDSVVPDLPVPTISAPSR	80	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:267,2-UNIMOD:267,3-UNIMOD:21,28-UNIMOD:267	ms_run[2]:scan=23213	121.33	3	3168.5383	3168.5383	K	W	861	889
PSM	SLGGQQGSPKHGPHSGAPK	81	sp|Q6DN90-2|IQEC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=1149	6.1556	2	1905.8847	1905.8847	R	S	288	307
PSM	THTTALAGRSPSPASGR	82	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:267,10-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=2892	13.028	2	1845.8039	1845.8039	K	R	286	303
PSM	THTTALAGRSPSPASGRR	83	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2187	9.9243	2	1981.8885	1981.8885	K	G	286	304
PSM	TRSPSPTLGESLAPHKGSFSGR	84	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12391	60.727	3	2428.0938	2428.0938	R	L	516	538
PSM	GNLLHFPSSQGEEEKEKLEGDHTIR	85	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=15772	79.5208	3	2930.364473	2929.360731	R	Q	1060	1085
PSM	APVPAPGLRPEEAPGLPAAPPPAPAAPASPR	86	sp|Q9C009|FOXQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:267,29-UNIMOD:21,31-UNIMOD:267	ms_run[2]:scan=17274	87.968	3	3018.5595	3018.5595	R	M	220	251
PSM	HADGEKEDQFNGSPPRPQPR	87	sp|Q69YN4-4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:21	ms_run[2]:scan=5333	24.507	3	2341.0237	2341.0237	K	G	161	181
PSM	HEDLVPPAGSPELSPPQPLFRPR	88	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	10-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:267,23-UNIMOD:267	ms_run[2]:scan=20925	108.51	3	2715.2726	2715.2726	R	S	1607	1630
PSM	KIDTHPSPSHSSTVKDSLIELK	89	sp|Q8NI27-2|THOC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=11708	57.005	2	2498.2418	2498.2418	R	E	232	254
PSM	KPPAPDPFARSSPR	90	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:21	ms_run[2]:scan=8170	38.682	2	1601.7715	1601.7715	K	T	1351	1365
PSM	KQDDSPPRPIIGPALPPGFIK	91	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=21009	108.98	3	2322.2137	2322.2137	K	S	101	122
PSM	KQDDSPPRPIIGPALPPGFIK	92	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=21358	111.01	2	2322.2137	2322.2137	K	S	101	122
PSM	KRVSLEPHQGPGTPESK	93	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=2987	13.471	2	1925.936	1925.9360	R	K	852	869
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	94	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	25-UNIMOD:21,31-UNIMOD:188	ms_run[2]:scan=16998	86.421	3	3467.5735	3467.5735	K	G	211	242
PSM	RPSAAAKPSGHPPPGDFIALGSK	95	sp|Q8N201|INT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=12067	58.974	4	2337.1631	2337.1631	R	G	11	34
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	96	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=14735	73.542	3	3044.4006	3044.4006	K	H	346	374
PSM	SFPHLSKPVAPGSAPLGSGEPGGPGLWVGSSQHLK	97	sp|A1L170|CA226_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,7-UNIMOD:188,30-UNIMOD:21,35-UNIMOD:188	ms_run[2]:scan=21610	112.4	4	3606.7464	3606.7464	R	N	18	53
PSM	SPDLFTPLSRPPSPLSLPRPR	98	sp|Q9H4M7-2|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=23968	125.82	3	2489.2233	2489.2233	R	S	229	250
PSM	SPDLFTPLSRPPSPLSLPRPR	99	sp|Q9H4M7-2|PKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=24129	126.83	3	2489.2233	2489.2233	R	S	229	250
PSM	SPETDWGRPPGGDKDLASPHLGLGSPR	100	sp|Q9H4M7-2|PKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	25-UNIMOD:21	ms_run[2]:scan=16786	85.233	3	2878.3399	2878.3399	R	V	510	537
PSM	TGHILHPEYLQPLPSTPVSPIELDAKK	101	sp|Q96F45-3|ZN503_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	19-UNIMOD:21	ms_run[2]:scan=19905	103.01	4	3059.5733	3059.5733	R	S	84	111
PSM	TKFASDDEHDEHDENGATGPVKR	102	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=3791	17.345	3	2634.0984	2634.0984	K	A	362	385
PSM	VKEVHDELEDLPSPPPPLSPPPTTSPHK	103	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:188,13-UNIMOD:21,19-UNIMOD:21,28-UNIMOD:188	ms_run[2]:scan=17006	86.468	3	3211.5282	3211.5282	K	Q	176	204
PSM	RPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHR	104	sp|Q96B97|SH3K1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=18306	94.085675	3	4041.8557	4041.8588	R	G	490	526
PSM	KHSPSPPPPTPTESR	105	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:188,3-UNIMOD:21,5-UNIMOD:21,15-UNIMOD:267	ms_run[1]:scan=2392	10.669616666666666	3	1789.777784	1789.777229	R	K	326	341