MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000207 -- new pLH27,28,30
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\PeakList.MaxQuantPlist1\120105_pLH23.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220628\20220628140121263410^10.242.16.160^jpost@jpost.jpost\Psearch.MaxQuantExec1\120105_pLH23.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Phospho (S),Phospho (T),Phospho (Y),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=1000
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Label:13C(6) (K),Label:13C(6)15N(4) (R),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	variable_mod[2]-site	R
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	S
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	T
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	Y
MTD	variable_mod[5]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	482-UNIMOD:21	0.04	47.0	1	1	1
PRT	sp|Q14966-2|ZN638_HUMAN	Isoform 2 of Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	605-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	311-UNIMOD:21	0.08	41.0	1	1	1
PRT	sp|Q8N573-2|OXR1_HUMAN	Isoform 2 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	50-UNIMOD:4,61-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q8WWM7-7|ATX2L_HUMAN	Isoform 7 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	31-UNIMOD:21,58-UNIMOD:4	0.12	40.0	1	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	15-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|Q9P2Y5|UVRAG_HUMAN	UV radiation resistance-associated gene protein OS=Homo sapiens OX=9606 GN=UVRAG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	563-UNIMOD:188,564-UNIMOD:188,571-UNIMOD:21,593-UNIMOD:267	0.05	40.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	39.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	251-UNIMOD:188,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:188	0.04	38.0	1	1	1
PRT	sp|Q5T200-2|ZC3HD_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	263-UNIMOD:21,265-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	81-UNIMOD:21	0.09	38.0	1	1	1
PRT	sp|Q5VT06|CE350_HUMAN	Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	1648-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	152-UNIMOD:21,153-UNIMOD:4	0.03	38.0	2	1	0
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	705-UNIMOD:21,712-UNIMOD:4,717-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	295-UNIMOD:21,297-UNIMOD:21,351-UNIMOD:21,353-UNIMOD:21,349-UNIMOD:267,356-UNIMOD:267,373-UNIMOD:267,294-UNIMOD:267,302-UNIMOD:267	0.02	38.0	4	2	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	552-UNIMOD:267,554-UNIMOD:21,560-UNIMOD:267,582-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	202-UNIMOD:21	0.12	37.0	1	1	1
PRT	sp|Q68D20|PMS2L_HUMAN	Protein PMS2CL OS=Homo sapiens OX=9606 GN=PMS2CL PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	53-UNIMOD:21	0.09	37.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q6PJT7-8|ZC3HE_HUMAN	Isoform 8 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	211-UNIMOD:21,228-UNIMOD:4	0.09	37.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	1157-UNIMOD:21,1162-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	19-UNIMOD:21	0.20	37.0	2	1	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	188-UNIMOD:21,190-UNIMOD:267,197-UNIMOD:188,212-UNIMOD:188	0.08	36.0	1	1	1
PRT	sp|Q8TF74-2|WIPF2_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	85-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	42-UNIMOD:21,49-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1160-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	147-UNIMOD:267,151-UNIMOD:21,155-UNIMOD:21,158-UNIMOD:267,171-UNIMOD:267	0.03	36.0	1	1	1
PRT	sp|Q6XZF7|DNMBP_HUMAN	Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	1369-UNIMOD:21,1373-UNIMOD:267,1376-UNIMOD:267	0.02	36.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	326-UNIMOD:21,333-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	31-UNIMOD:21,58-UNIMOD:4	0.04	36.0	1	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	363-UNIMOD:188,366-UNIMOD:21,383-UNIMOD:188,384-UNIMOD:267	0.06	36.0	1	1	1
PRT	sp|Q9C009|FOXQ1_HUMAN	Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	248-UNIMOD:21	0.08	35.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	1487-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9P2K8-2|E2AK4_HUMAN	Isoform 2 of eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	667-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q9BRD0|BUD13_HUMAN	BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	271-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q53F19-2|NCBP3_HUMAN	Isoform 2 of Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	220-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	802-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9BUL5|PHF23_HUMAN	PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	150-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y4B5-2|MTCL1_HUMAN	Isoform 2 of Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	253-UNIMOD:267,261-UNIMOD:21,275-UNIMOD:267,276-UNIMOD:267	0.02	34.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	156-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	240-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q9UD71-2|PPR1B_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	36-UNIMOD:4,39-UNIMOD:21,42-UNIMOD:21,44-UNIMOD:188	0.11	34.0	1	1	1
PRT	sp|Q9Y4F5-3|C170B_HUMAN	Isoform 3 of Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	290-UNIMOD:21	0.01	34.0	1	1	0
PRT	sp|P08047|SP1_HUMAN	Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	126-UNIMOD:21,128-UNIMOD:21,131-UNIMOD:21,136-UNIMOD:21,137-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q9Y4F5|C170B_HUMAN	Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	360-UNIMOD:21	0.01	34.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RSSLGEKGGPILGASPHHSSSGEEK	1	sp|Q9BXF6|RFIP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:21	ms_run[1]:scan=6044	29.507425	3	2583.201537	2583.207859	R	A	480	505
PSM	HLEAADKGHSPAQKPK	2	sp|Q14966-2|ZN638_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=974	5.7783	2	1792.8621	1792.8621	K	T	596	612
PSM	RAQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	3	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	30-UNIMOD:21	ms_run[2]:scan=12842	64.995	3	3248.5113	3248.5113	R	V	282	316
PSM	FEDYLREPAQGDLGCGSPPHRPPAPSSPEGPDTGQK	4	sp|Q8N573-2|OXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4,26-UNIMOD:21	ms_run[2]:scan=14459	74.343	4	3925.7367	3925.7367	R	K	36	72
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	5	sp|Q8WWM7-7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[2]:scan=21916	116.52	4	4103.0412	4103.0412	R	R	26	71
PSM	RPAERSSPGQTPEEGAQALAEFAALHGPALR	6	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21	ms_run[1]:scan=23538	127.14771499999999	3	3293.595573	3293.594253	R	A	10	41
PSM	KKGEDLVGSLNGGHANVHPSQEQGEALSGHR	7	sp|Q9P2Y5|UVRAG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:188,2-UNIMOD:188,9-UNIMOD:21,31-UNIMOD:267	ms_run[1]:scan=10459	52.281965	3	3310.577131	3309.591807	K	A	563	594
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	8	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18388	96.48200833333334	3	3442.4026	3442.4027	K	L	104	135
PSM	ADKDYHFKVDNDENEHQLSLR	9	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=10999	55.014	3	2572.1942	2572.1942	K	T	25	46
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	10	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:188,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:188	ms_run[2]:scan=22637	121.14	4	3925.6891	3925.6891	R	I	250	282
PSM	KGPRTPSPPPPIPEDIALGK	11	sp|Q5T200-2|ZC3HD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=16382	85.284	3	2226.0851	2226.0851	K	K	259	279
PSM	NSQKHSPTSEPTPPGDALPPVSSPHTHR	12	sp|Q9H6S3-2|ES8L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	12-UNIMOD:21	ms_run[2]:scan=8310	40.664	3	3037.4043	3037.4043	R	G	70	98
PSM	RGHHDDSDEEASPEKTTLSTAK	13	sp|Q5VT06|CE350_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=3275	15.357	3	2490.066	2490.0660	R	E	1642	1664
PSM	RNSCNVGGGGGGFKHPAFK	14	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=7435	36.354	2	2025.8993	2025.8993	R	R	150	169
PSM	RSASPHDVDLCLVSPCEFEHRK	15	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=15722	81.561	3	2718.2044	2718.2044	R	A	702	724
PSM	THTTALAGRSPSPASGR	16	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3119	14.701	2	1825.7873	1825.7873	K	R	286	303
PSM	LLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPR	17	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:267,5-UNIMOD:21,11-UNIMOD:267,33-UNIMOD:267	ms_run[1]:scan=14185	72.68601833333334	4	3502.703166	3501.714417	K	T	550	583
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGR	18	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=7155	34.902	4	2870.2416	2870.2416	R	R	200	233
PSM	HTTENKPHSPKTPEPR	19	sp|Q68D20|PMS2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:21	ms_run[2]:scan=1166	6.3744	2	1934.9	1934.9000	R	R	42	58
PSM	LNFSHGTHEYHAETIK	20	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7807	38.215	2	1882.8962	1882.8962	R	N	74	90
PSM	RIPVLSPKPAVAPPAPPSSSQLCR	21	sp|Q6PJT7-8|ZC3HE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=15928	82.733	3	2604.3611	2604.3611	R	Y	206	230
PSM	RRHSSETFSSTTTVTPVSPSFAHNPK	22	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=11865	59.594	3	3017.3434	3017.3434	R	R	1145	1171
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	23	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=19268	101.22	3	2715.4361	2715.4361	K	I	17	42
PSM	APGSPRGQHEPSKPPPAGETVTGGFGAK	24	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21,6-UNIMOD:267,13-UNIMOD:188,28-UNIMOD:188	ms_run[2]:scan=8206	40.142	4	2815.3721	2811.3839	R	K	185	213
PSM	EGPPAPPPVKPPPSPVNIR	25	sp|Q8TF74-2|WIPF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=13403	68.032	2	2025.0449	2025.0449	R	T	72	91
PSM	IHLGSSPKKGGNCDLSHQER	26	sp|Q9H410-4|DSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4192	20.329	2	2299.0529	2299.0529	R	L	37	57
PSM	NHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVK	27	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:21	ms_run[2]:scan=18901	99.192	3	3617.5584	3617.5584	K	T	1153	1186
PSM	RLEISPDSSPERAHYTHSDYQYSQR	28	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:267,5-UNIMOD:21,9-UNIMOD:21,12-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=11000	55.016	4	3211.354	3211.3540	R	S	147	172
PSM	SHSDASVGSHSSTESEHGSSSPRFPR	29	sp|Q6XZF7|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	19-UNIMOD:21,23-UNIMOD:267,26-UNIMOD:267	ms_run[2]:scan=4640	22.496	3	2811.1749	2811.1749	R	Q	1351	1377
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	30	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	3-UNIMOD:21	ms_run[2]:scan=19452	102.24	3	2715.4361	2715.4361	K	I	17	42
PSM	SPSPPLPTHIPPEPPRTPPFPAK	31	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=19362	101.76	3	2616.2543	2616.2543	R	T	326	349
PSM	RPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAAGSGLR	32	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=21753	115.51661333333332	4	4103.039511	4103.041199	R	R	26	71
PSM	TKFASDDEHDEHDENGATGPVKR	33	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:188,5-UNIMOD:21,22-UNIMOD:188,23-UNIMOD:267	ms_run[1]:scan=4067	19.763415	3	2657.133688	2656.146895	K	A	362	385
PSM	APVPAPGLRPEEAPGLPAAPPPAPAAPASPR	34	sp|Q9C009|FOXQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	29-UNIMOD:21	ms_run[2]:scan=17056	89.061	3	2998.543	2998.5430	R	M	220	251
PSM	FNHNLLPSETAHKPDLSSKTPTSPK	35	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	20-UNIMOD:21	ms_run[2]:scan=10958	54.81	3	2825.3749	2825.3749	K	T	1468	1493
PSM	HERPAGPGTPPPDSGPLAKDDR	36	sp|Q9P2K8-2|E2AK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	9-UNIMOD:21	ms_run[2]:scan=6318	30.811	3	2346.0754	2346.0754	R	A	659	681
PSM	IHLGSSPKKGGNCDLSHQER	37	sp|Q9H410-4|DSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4157	20.161	3	2299.0529	2299.0529	R	L	37	57
PSM	RARHDSPDLAPNVTYSLPR	38	sp|Q9BRD0|BUD13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=13543	68.804	3	2244.0801	2244.0801	R	T	266	285
PSM	RNSCNVGGGGGGFKHPAFK	39	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=7387	36.09	3	2025.8993	2025.8993	R	R	150	169
PSM	RPHSPEKAFSSNPVVR	40	sp|Q53F19-2|NCBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:21	ms_run[2]:scan=7156	34.904	2	1886.9152	1886.9152	K	R	217	233
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	41	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=14490	74.528	3	3044.4006	3044.4006	K	H	346	374
PSM	VKAPVHFVEPLSPTGVAGHR	42	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:21	ms_run[2]:scan=14393	73.936	3	2177.1147	2177.1147	K	K	791	811
PSM	VASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPR	43	sp|Q9BUL5|PHF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21	ms_run[1]:scan=20832	110.03812666666666	4	3663.880849	3663.877411	K	K	145	180
PSM	ASFNHFDKDHGGALGPEEFK	44	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12572	63.526	3	2202.013	2202.0130	R	A	772	792
PSM	EGPGRDHAPSIPTSPFGDSLESSTELRR	45	sp|Q9Y4B5-2|MTCL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:267,13-UNIMOD:21,27-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=17973	94.264	3	3104.4343	3104.4343	R	H	249	277
PSM	HFRSSRGQEEISGALPVASPASSR	46	sp|Q9UBK8|MTRR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:21	ms_run[2]:scan=11558	57.944	3	2605.2398	2605.2398	K	T	153	177
PSM	KIDTHPSPSHSSTVKDSLIELK	47	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:21	ms_run[2]:scan=11471	57.489	3	2498.2418	2498.2418	R	E	232	254
PSM	RPNPCAYTPPSLKAVQR	48	sp|Q9UD71-2|PPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:188	ms_run[2]:scan=8052	39.438	2	2119.9735	2119.9735	K	I	32	49
PSM	SATRPSPSPERSSTGPEPPAPTPLLAER	49	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	4-UNIMOD:267,6-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:267,28-UNIMOD:267	ms_run[2]:scan=14700	75.784	3	3074.4254	3074.4254	K	H	346	374
PSM	THTTALAGRSPSPASGR	50	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:267,10-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:267	ms_run[2]:scan=3094	14.603	3	1845.8039	1845.8039	K	R	286	303
PSM	TLKGHKHEDGTQSDSEDPLAK	51	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=2773	12.868	3	2372.0645	2372.0645	R	A	278	299
PSM	EQSGSSTNGSNGSESSKNR	52	sp|P08047|SP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21,7-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=9915	49.370113333333336	3	2313.632551	2311.647109	K	T	122	141
PSM	TLKGHKHEDGTQSDSEDPLAK	53	sp|Q9Y4F5|C170B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=2788	12.947321666666666	2	2373.066913	2372.064549	R	A	348	369