MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000149 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617203758775411^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_17_K1_4.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=30
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	54-UNIMOD:21,49-UNIMOD:35,46-UNIMOD:35,241-UNIMOD:21,55-UNIMOD:21,327-UNIMOD:35	0.16	51.0	25	4	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	103-UNIMOD:21,108-UNIMOD:4,107-UNIMOD:21,83-UNIMOD:21,102-UNIMOD:21,100-UNIMOD:21	0.25	51.0	12	6	3
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	45-UNIMOD:21	0.05	45.0	1	1	1
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	332-UNIMOD:21,335-UNIMOD:21	0.05	44.0	3	2	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	1053-UNIMOD:21,1054-UNIMOD:35	0.02	43.0	5	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	58-UNIMOD:21,30-UNIMOD:21,57-UNIMOD:21	0.22	43.0	8	3	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	349-UNIMOD:21,357-UNIMOD:4,337-UNIMOD:4,339-UNIMOD:4,336-UNIMOD:21	0.18	42.0	9	6	4
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	175-UNIMOD:21,454-UNIMOD:21,459-UNIMOD:35	0.06	41.0	5	2	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	41.0	null	77-UNIMOD:21,157-UNIMOD:21,161-UNIMOD:4,79-UNIMOD:21,51-UNIMOD:21,52-UNIMOD:4,110-UNIMOD:21,115-UNIMOD:4	0.47	41.0	15	8	5
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	1184-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	109-UNIMOD:21,107-UNIMOD:28,400-UNIMOD:21,114-UNIMOD:21	0.07	39.0	5	2	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1387-UNIMOD:21,1389-UNIMOD:4,1384-UNIMOD:21,1386-UNIMOD:21,1390-UNIMOD:21,1760-UNIMOD:21	0.01	39.0	4	3	2
PRT	sp|Q7Z4S6|KI21A_HUMAN	Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	853-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	235-UNIMOD:35,148-UNIMOD:21	0.17	39.0	10	3	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	460-UNIMOD:21,479-UNIMOD:21,462-UNIMOD:21,452-UNIMOD:21,466-UNIMOD:35,58-UNIMOD:21,412-UNIMOD:4,482-UNIMOD:21	0.11	39.0	12	6	3
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	2-UNIMOD:1,2-UNIMOD:21,96-UNIMOD:21	0.10	39.0	3	2	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	354-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	448-UNIMOD:21,124-UNIMOD:21,189-UNIMOD:21,166-UNIMOD:21,86-UNIMOD:21,445-UNIMOD:21	0.16	38.0	9	8	7
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	237-UNIMOD:4,141-UNIMOD:21,145-UNIMOD:21	0.18	38.0	4	3	2
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2-UNIMOD:1,2-UNIMOD:21,243-UNIMOD:21,11-UNIMOD:21,255-UNIMOD:35	0.15	38.0	8	3	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	152-UNIMOD:21,153-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	36-UNIMOD:21	0.07	37.0	6	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	59-UNIMOD:21,60-UNIMOD:21,47-UNIMOD:21	0.24	37.0	8	4	3
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	176-UNIMOD:21,178-UNIMOD:4,46-UNIMOD:21,336-UNIMOD:21,339-UNIMOD:4,36-UNIMOD:21,39-UNIMOD:21,37-UNIMOD:21	0.20	37.0	14	8	5
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	157-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	185-UNIMOD:21,189-UNIMOD:35,163-UNIMOD:21,194-UNIMOD:35	0.16	36.0	12	3	1
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	226-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	65-UNIMOD:21	0.04	36.0	2	2	2
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	83-UNIMOD:21,86-UNIMOD:21,91-UNIMOD:35,36-UNIMOD:4,42-UNIMOD:21,36-UNIMOD:385	0.15	36.0	13	2	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	54-UNIMOD:21	0.03	36.0	4	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	6967-UNIMOD:21	0.00	36.0	2	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,2-UNIMOD:21	0.13	36.0	1	1	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	85-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	452-UNIMOD:21,593-UNIMOD:21,599-UNIMOD:4	0.05	35.0	3	2	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	635-UNIMOD:4,636-UNIMOD:21,827-UNIMOD:21,521-UNIMOD:21	0.03	35.0	7	4	2
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	133-UNIMOD:21,410-UNIMOD:21,413-UNIMOD:4	0.05	35.0	3	2	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	286-UNIMOD:21	0.07	35.0	3	2	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	60-UNIMOD:21,62-UNIMOD:35,2-UNIMOD:1,3-UNIMOD:21	0.05	35.0	5	2	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	200-UNIMOD:21,211-UNIMOD:4,199-UNIMOD:21,204-UNIMOD:21	0.05	35.0	10	3	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	240-UNIMOD:21,382-UNIMOD:21,190-UNIMOD:21	0.08	35.0	3	3	3
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	663-UNIMOD:21,478-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.09	35.0	12	1	0
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	646-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1542-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	623-UNIMOD:21,625-UNIMOD:35,628-UNIMOD:35,317-UNIMOD:21,460-UNIMOD:21	0.14	35.0	16	9	5
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	2-UNIMOD:1	0.18	35.0	3	2	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	641-UNIMOD:21,654-UNIMOD:21	0.04	35.0	3	2	1
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	481-UNIMOD:21,480-UNIMOD:21,87-UNIMOD:21	0.04	34.0	4	3	2
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	105-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	85-UNIMOD:21	0.04	34.0	2	2	2
PRT	sp|Q6L8Q7|PDE12_HUMAN	2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	103-UNIMOD:21,108-UNIMOD:4,119-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	7-UNIMOD:21,2-UNIMOD:1	0.08	34.0	3	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	202-UNIMOD:21,49-UNIMOD:4,55-UNIMOD:21,37-UNIMOD:21	0.13	34.0	5	5	5
PRT	sp|O15357|SHIP2_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1176-UNIMOD:21,1187-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	596-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	75-UNIMOD:21,379-UNIMOD:21,401-UNIMOD:21	0.11	33.0	5	4	3
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	303-UNIMOD:21,437-UNIMOD:21	0.08	33.0	2	2	2
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	488-UNIMOD:21,493-UNIMOD:35,494-UNIMOD:35,185-UNIMOD:21,490-UNIMOD:35,489-UNIMOD:21	0.12	33.0	21	6	3
PRT	sp|Q676U5|A16L1_HUMAN	Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	287-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	202-UNIMOD:21	0.07	33.0	2	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	215-UNIMOD:21,893-UNIMOD:21,216-UNIMOD:21	0.02	33.0	4	2	1
PRT	sp|Q16637|SMN_HUMAN	Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	25-UNIMOD:21	0.07	33.0	3	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	44-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4,142-UNIMOD:4,143-UNIMOD:21,145-UNIMOD:4,151-UNIMOD:4,154-UNIMOD:4	0.10	33.0	3	2	1
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,2-UNIMOD:21,367-UNIMOD:21	0.08	33.0	4	3	2
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,3-UNIMOD:21,65-UNIMOD:21,69-UNIMOD:4,5-UNIMOD:21	0.33	33.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	182-UNIMOD:21,183-UNIMOD:21,107-UNIMOD:21	0.04	32.0	9	7	5
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	145-UNIMOD:21	0.14	32.0	3	2	1
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	46-UNIMOD:21	0.14	32.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	119-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|O15013|ARHGA_HUMAN	Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1232-UNIMOD:21,1289-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1541-UNIMOD:21,1542-UNIMOD:21,871-UNIMOD:21,872-UNIMOD:4,1003-UNIMOD:21,1444-UNIMOD:21,1455-UNIMOD:21,2692-UNIMOD:21,1043-UNIMOD:21,1079-UNIMOD:21,983-UNIMOD:21,988-UNIMOD:21,992-UNIMOD:21,1102-UNIMOD:21,2114-UNIMOD:35,2115-UNIMOD:21,2116-UNIMOD:4,2121-UNIMOD:21,1443-UNIMOD:21,1458-UNIMOD:21	0.06	32.0	13	11	9
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	50-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	30-UNIMOD:21,38-UNIMOD:35	0.03	32.0	8	1	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	58-UNIMOD:21,258-UNIMOD:21,60-UNIMOD:21	0.10	32.0	7	4	2
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	51-UNIMOD:21,96-UNIMOD:21	0.04	32.0	3	2	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	141-UNIMOD:21,155-UNIMOD:35	0.08	32.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	189-UNIMOD:21,216-UNIMOD:21	0.14	32.0	4	3	2
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	588-UNIMOD:21,597-UNIMOD:21,566-UNIMOD:21,569-UNIMOD:21,591-UNIMOD:21,750-UNIMOD:21,753-UNIMOD:4,754-UNIMOD:21,488-UNIMOD:21	0.06	31.0	7	7	7
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	76-UNIMOD:21,313-UNIMOD:21	0.08	31.0	2	2	2
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	45-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	2152-UNIMOD:21,2160-UNIMOD:4,2336-UNIMOD:21	0.01	31.0	2	2	2
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	20-UNIMOD:21,21-UNIMOD:21,279-UNIMOD:21,281-UNIMOD:4	0.11	31.0	6	4	2
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	105-UNIMOD:21,113-UNIMOD:4,106-UNIMOD:35	0.01	31.0	3	1	0
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	359-UNIMOD:21,406-UNIMOD:21,597-UNIMOD:21	0.09	31.0	4	4	4
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	200-UNIMOD:21,181-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	24-UNIMOD:21,168-UNIMOD:21,175-UNIMOD:35,70-UNIMOD:4,74-UNIMOD:21,77-UNIMOD:4,126-UNIMOD:21,26-UNIMOD:21	0.14	31.0	12	4	0
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	84-UNIMOD:21,82-UNIMOD:28,515-UNIMOD:28,520-UNIMOD:21,521-UNIMOD:21,522-UNIMOD:4	0.06	31.0	7	5	3
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	140-UNIMOD:21	0.06	31.0	2	2	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	60-UNIMOD:21,44-UNIMOD:21,147-UNIMOD:21	0.22	31.0	4	3	2
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	700-UNIMOD:21,708-UNIMOD:4	0.03	31.0	2	1	0
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	73-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	78-UNIMOD:21,82-UNIMOD:21,80-UNIMOD:28,83-UNIMOD:21	0.10	31.0	10	3	1
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1167-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	46-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,13-UNIMOD:21,12-UNIMOD:35,218-UNIMOD:21,226-UNIMOD:4,2-UNIMOD:21,6-UNIMOD:35,11-UNIMOD:21	0.13	31.0	14	3	2
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	57-UNIMOD:21,60-UNIMOD:21,19-UNIMOD:21,176-UNIMOD:21	0.27	30.0	4	4	4
PRT	sp|P50579-2|MAP2_HUMAN	Isoform 2 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	49-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	268-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	30.0	2	1	0
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	626-UNIMOD:21,346-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	124-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	730-UNIMOD:21,594-UNIMOD:21,595-UNIMOD:21,733-UNIMOD:21	0.02	30.0	4	3	2
PRT	sp|P47736|RPGP1_HUMAN	Rap1 GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RAP1GAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	498-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	76-UNIMOD:21,756-UNIMOD:21	0.03	30.0	3	2	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	60-UNIMOD:21	0.07	30.0	4	2	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	93-UNIMOD:21,58-UNIMOD:21,30-UNIMOD:21,57-UNIMOD:21	0.32	30.0	10	3	0
PRT	sp|Q9HAU0|PKHA5_HUMAN	Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	410-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	58-UNIMOD:21,249-UNIMOD:21,255-UNIMOD:4	0.10	30.0	5	2	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	96-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.18	30.0	4	3	2
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	285-UNIMOD:4,287-UNIMOD:21,288-UNIMOD:4,285-UNIMOD:385,293-UNIMOD:35	0.06	30.0	3	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	112-UNIMOD:21	0.10	30.0	3	2	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	2-UNIMOD:1,14-UNIMOD:21,16-UNIMOD:35,17-UNIMOD:4,199-UNIMOD:21,44-UNIMOD:35,47-UNIMOD:35,52-UNIMOD:21	0.20	30.0	11	5	2
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	37-UNIMOD:21	0.07	30.0	4	1	0
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	0.09	30.0	2	1	0
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,6-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	270-UNIMOD:21,268-UNIMOD:28	0.05	29.0	4	2	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1740-UNIMOD:21,125-UNIMOD:21,127-UNIMOD:21	0.01	29.0	2	2	2
PRT	sp|Q9Y6X9|MORC2_HUMAN	ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	739-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	573-UNIMOD:21,574-UNIMOD:21	0.05	29.0	5	4	3
PRT	sp|Q9Y6E0|STK24_HUMAN	Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	434-UNIMOD:21,46-UNIMOD:21	0.06	29.0	2	2	2
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	627-UNIMOD:21,1324-UNIMOD:21,1328-UNIMOD:21	0.02	29.0	2	2	2
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	320-UNIMOD:21,323-UNIMOD:21,162-UNIMOD:21,164-UNIMOD:4,302-UNIMOD:21,303-UNIMOD:21	0.16	29.0	14	5	3
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	153-UNIMOD:21,174-UNIMOD:21,175-UNIMOD:21,176-UNIMOD:35,2-UNIMOD:1,2-UNIMOD:21	0.10	29.0	9	4	1
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	331-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	51-UNIMOD:21,131-UNIMOD:21,135-UNIMOD:21,347-UNIMOD:21	0.13	29.0	7	5	4
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	98-UNIMOD:21,45-UNIMOD:21	0.20	29.0	3	2	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	123-UNIMOD:21,127-UNIMOD:35	0.11	29.0	2	2	2
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	188-UNIMOD:21,195-UNIMOD:21	0.03	29.0	3	1	0
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	279-UNIMOD:21,276-UNIMOD:28,215-UNIMOD:21	0.08	29.0	7	2	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	852-UNIMOD:21,360-UNIMOD:21	0.03	29.0	4	2	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	285-UNIMOD:21	0.07	29.0	2	2	2
PRT	sp|Q8IX94|CTGE4_HUMAN	cTAGE family member 4 OS=Homo sapiens OX=9606 GN=CTAGE4 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	140-UNIMOD:21,148-UNIMOD:4	0.02	29.0	2	2	2
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	63-UNIMOD:21,115-UNIMOD:21,65-UNIMOD:21	0.17	29.0	3	2	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	45-UNIMOD:21,69-UNIMOD:21,43-UNIMOD:35	0.21	29.0	3	2	1
PRT	sp|Q58FG0|HS905_HUMAN	Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens OX=9606 GN=HSP90AA5P PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	41-UNIMOD:21	0.05	29.0	3	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	799-UNIMOD:21,53-UNIMOD:35,59-UNIMOD:21	0.06	29.0	7	2	0
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	162-UNIMOD:21,163-UNIMOD:21,173-UNIMOD:4,231-UNIMOD:21	0.13	29.0	3	2	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	322-UNIMOD:28,325-UNIMOD:21,328-UNIMOD:4,39-UNIMOD:21,47-UNIMOD:21,51-UNIMOD:21	0.09	29.0	5	3	1
PRT	sp|Q05682-3|CALD1_HUMAN	Isoform 3 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	12-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	31-UNIMOD:21	0.18	28.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	104-UNIMOD:21,305-UNIMOD:21,303-UNIMOD:35,444-UNIMOD:21	0.07	28.0	22	4	2
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	114-UNIMOD:21	0.04	28.0	2	2	2
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	112-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:4,161-UNIMOD:21	0.05	28.0	4	2	0
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	48-UNIMOD:21,50-UNIMOD:4	0.17	28.0	1	1	1
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	340-UNIMOD:21,341-UNIMOD:21,1188-UNIMOD:21,779-UNIMOD:21,1094-UNIMOD:21,1095-UNIMOD:21	0.05	28.0	6	4	3
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	117-UNIMOD:21,118-UNIMOD:21,120-UNIMOD:21	0.05	28.0	3	1	0
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	94-UNIMOD:21	0.05	28.0	4	3	2
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	936-UNIMOD:21,1000-UNIMOD:28,1002-UNIMOD:21,1009-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|Q8N6T3|ARFG1_HUMAN	ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	360-UNIMOD:21,363-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q5JXC2|MIIP_HUMAN	Migration and invasion-inhibitory protein OS=Homo sapiens OX=9606 GN=MIIP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	303-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|O95785-3|WIZ_HUMAN	Isoform 3 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	12-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q5T5C0|STXB5_HUMAN	Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	692-UNIMOD:21,697-UNIMOD:4,688-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	139-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	656-UNIMOD:21,903-UNIMOD:21,653-UNIMOD:28,900-UNIMOD:21	0.03	28.0	5	2	0
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	10-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	156-UNIMOD:21,377-UNIMOD:21	0.08	28.0	4	3	2
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	767-UNIMOD:21,768-UNIMOD:21	0.03	28.0	3	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	462-UNIMOD:21	0.05	28.0	2	1	0
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	62-UNIMOD:21,66-UNIMOD:21,64-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21,3-UNIMOD:35,72-UNIMOD:21	0.09	28.0	6	4	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,3-UNIMOD:21,8-UNIMOD:21,129-UNIMOD:21,139-UNIMOD:4,156-UNIMOD:21	0.36	28.0	12	5	4
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:21	0.20	28.0	3	1	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	473-UNIMOD:21,138-UNIMOD:21,482-UNIMOD:35	0.05	27.0	6	5	4
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	358-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	299-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	430-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	305-UNIMOD:21,659-UNIMOD:21	0.04	27.0	2	2	2
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	746-UNIMOD:21,765-UNIMOD:21,2-UNIMOD:1,7-UNIMOD:21	0.05	27.0	3	3	3
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	783-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	31-UNIMOD:21	0.09	27.0	4	2	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	147-UNIMOD:21,151-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	256-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:21,37-UNIMOD:21	0.10	27.0	3	2	1
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	537-UNIMOD:21,340-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	17-UNIMOD:21	0.21	27.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	429-UNIMOD:21,882-UNIMOD:21,872-UNIMOD:21,1666-UNIMOD:21,1158-UNIMOD:21,936-UNIMOD:21,712-UNIMOD:21,716-UNIMOD:4	0.06	27.0	8	7	6
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	730-UNIMOD:21,43-UNIMOD:21,564-UNIMOD:21	0.06	27.0	3	3	3
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	454-UNIMOD:21,453-UNIMOD:21	0.04	27.0	4	2	1
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	67-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	395-UNIMOD:21,114-UNIMOD:21,123-UNIMOD:4	0.06	27.0	4	2	1
PRT	sp|Q9Y608|LRRF2_HUMAN	Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	18-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	319-UNIMOD:21	0.10	27.0	5	3	2
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	15-UNIMOD:21	0.10	27.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	648-UNIMOD:21,804-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	253-UNIMOD:21,330-UNIMOD:21	0.06	27.0	2	2	2
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1378-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	482-UNIMOD:21,933-UNIMOD:21,936-UNIMOD:35	0.03	27.0	6	2	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	36-UNIMOD:35,37-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	449-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	246-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	447-UNIMOD:4,453-UNIMOD:21,488-UNIMOD:21,398-UNIMOD:21	0.14	27.0	9	6	4
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	281-UNIMOD:21,1706-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	715-UNIMOD:21,852-UNIMOD:21,962-UNIMOD:21	0.04	27.0	3	3	3
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	539-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	671-UNIMOD:21,667-UNIMOD:21,651-UNIMOD:21	0.06	27.0	4	2	1
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,10-UNIMOD:21	0.02	27.0	3	2	1
PRT	sp|O00560|SDCB1_HUMAN	Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,2-UNIMOD:21	0.05	27.0	4	2	0
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	235-UNIMOD:21,236-UNIMOD:21,240-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	62-UNIMOD:21	0.04	26.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	541-UNIMOD:21,549-UNIMOD:35,163-UNIMOD:21,544-UNIMOD:21,538-UNIMOD:21,511-UNIMOD:21	0.13	26.0	12	7	5
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	113-UNIMOD:21,364-UNIMOD:21,373-UNIMOD:4	0.05	26.0	3	3	3
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	59-UNIMOD:21,60-UNIMOD:4,62-UNIMOD:4,61-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	910-UNIMOD:21,695-UNIMOD:21,696-UNIMOD:21,445-UNIMOD:21,691-UNIMOD:28,509-UNIMOD:21,478-UNIMOD:21	0.07	26.0	8	6	4
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	298-UNIMOD:21,145-UNIMOD:21,139-UNIMOD:21,136-UNIMOD:21,299-UNIMOD:35,40-UNIMOD:21	0.19	26.0	12	6	4
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	99-UNIMOD:21,101-UNIMOD:4,396-UNIMOD:21,58-UNIMOD:21,350-UNIMOD:21	0.17	26.0	5	5	5
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	57-UNIMOD:21,49-UNIMOD:28	0.26	26.0	5	3	2
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	43-UNIMOD:21,53-UNIMOD:4,71-UNIMOD:21,77-UNIMOD:4	0.04	26.0	3	2	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	322-UNIMOD:21,321-UNIMOD:35,323-UNIMOD:35	0.04	26.0	5	3	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	460-UNIMOD:21,479-UNIMOD:21,452-UNIMOD:21	0.05	26.0	3	3	3
PRT	sp|P98194|AT2C1_HUMAN	Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	637-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O43379|WDR62_HUMAN	WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	113-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	652-UNIMOD:21,655-UNIMOD:21	0.02	26.0	3	2	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	69-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	581-UNIMOD:21,582-UNIMOD:21,428-UNIMOD:21,608-UNIMOD:21,557-UNIMOD:21	0.08	26.0	6	4	3
PRT	sp|P14927|QCR7_HUMAN	Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	37-UNIMOD:21,33-UNIMOD:35	0.15	26.0	2	1	0
PRT	sp|O15321|TM9S1_HUMAN	Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	76-UNIMOD:21,78-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	875-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	350-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	16-UNIMOD:21,31-UNIMOD:21,63-UNIMOD:21	0.34	26.0	9	5	3
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	54-UNIMOD:21,52-UNIMOD:21,51-UNIMOD:21,133-UNIMOD:4,139-UNIMOD:21,133-UNIMOD:385	0.14	26.0	8	2	0
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	87-UNIMOD:21,88-UNIMOD:21,149-UNIMOD:21,150-UNIMOD:21	0.19	26.0	7	3	1
PRT	sp|P41229|KDM5C_HUMAN	Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	317-UNIMOD:21,327-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	127-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|Q6PJG9|LRFN4_HUMAN	Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	584-UNIMOD:4,585-UNIMOD:21,593-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	879-UNIMOD:21,1160-UNIMOD:21,1167-UNIMOD:21,644-UNIMOD:21	0.03	26.0	3	3	3
PRT	sp|Q9P2N2|RHG28_HUMAN	Rho GTPase-activating protein 28 OS=Homo sapiens OX=9606 GN=ARHGAP28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	69-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	718-UNIMOD:21,723-UNIMOD:21	0.02	26.0	2	2	2
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	48-UNIMOD:21	0.18	26.0	5	5	5
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	668-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9BZD3|GCOM2_HUMAN	Putative GRINL1B complex locus protein 2 OS=Homo sapiens OX=9606 GN=GCOM2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	179-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1672-UNIMOD:21,1676-UNIMOD:4,920-UNIMOD:21,881-UNIMOD:21	0.03	26.0	3	3	3
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.17	26.0	2	2	2
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	41-UNIMOD:28,43-UNIMOD:21,419-UNIMOD:21	0.06	26.0	2	2	2
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1831-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	221-UNIMOD:21,330-UNIMOD:21,394-UNIMOD:21,226-UNIMOD:21,202-UNIMOD:21,203-UNIMOD:21	0.20	25.0	7	5	4
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	253-UNIMOD:21,251-UNIMOD:28	0.04	25.0	3	1	0
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	156-UNIMOD:21,158-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	193-UNIMOD:21,333-UNIMOD:21	0.03	25.0	3	2	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	268-UNIMOD:21,267-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	656-UNIMOD:21,455-UNIMOD:21	0.03	25.0	3	3	3
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	20-UNIMOD:21,21-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	5-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	426-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	46-UNIMOD:21,234-UNIMOD:4	0.03	25.0	3	2	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	142-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	242-UNIMOD:21,668-UNIMOD:21,239-UNIMOD:21	0.02	25.0	3	2	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	474-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1186-UNIMOD:21,1174-UNIMOD:21,560-UNIMOD:21	0.04	25.0	3	3	3
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	42-UNIMOD:4,44-UNIMOD:21,45-UNIMOD:21	0.06	25.0	2	2	2
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	25.0	null	34-UNIMOD:21	0.09	25.0	2	1	0
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	41-UNIMOD:21,43-UNIMOD:4,46-UNIMOD:4	0.12	25.0	1	1	1
PRT	sp|Q9Y2I7|FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	307-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	200-UNIMOD:21,208-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	89-UNIMOD:21	0.14	25.0	3	1	0
PRT	sp|Q9H788|SH24A_HUMAN	SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	25.0	null	315-UNIMOD:21,51-UNIMOD:21	0.06	25.0	2	2	2
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	412-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	678-UNIMOD:21	0.01	25.0	2	2	2
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	182-UNIMOD:21,183-UNIMOD:35	0.06	25.0	2	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	99-UNIMOD:21,63-UNIMOD:21,131-UNIMOD:35,139-UNIMOD:35,146-UNIMOD:21	0.20	25.0	4	3	2
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1162-UNIMOD:21,346-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	663-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	43-UNIMOD:21,46-UNIMOD:21,45-UNIMOD:21	0.18	25.0	3	2	1
PRT	sp|Q86X27|RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	315-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	230-UNIMOD:21,286-UNIMOD:21	0.07	25.0	3	2	1
PRT	sp|Q15390|MTFR1_HUMAN	Mitochondrial fission regulator 1 OS=Homo sapiens OX=9606 GN=MTFR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	119-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	296-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	323-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	128-UNIMOD:21	0.09	25.0	2	2	2
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	32-UNIMOD:21	0.11	25.0	3	3	3
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	451-UNIMOD:28,453-UNIMOD:21,1260-UNIMOD:28,1263-UNIMOD:21,1244-UNIMOD:21,799-UNIMOD:21	0.02	25.0	7	5	4
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1811-UNIMOD:21,1812-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	26-UNIMOD:28,32-UNIMOD:21	0.15	25.0	3	2	1
PRT	sp|P08174|DAF_HUMAN	Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	98-UNIMOD:4,106-UNIMOD:21,78-UNIMOD:21,81-UNIMOD:4,162-UNIMOD:21,163-UNIMOD:4	0.10	24.0	3	3	3
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	416-UNIMOD:21,495-UNIMOD:21,414-UNIMOD:35,420-UNIMOD:35,494-UNIMOD:21	0.06	24.0	6	2	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	11-UNIMOD:35,13-UNIMOD:21	0.04	24.0	5	2	1
PRT	sp|P15923-2|TFE2_HUMAN	Isoform E47 of Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	530-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	269-UNIMOD:21,268-UNIMOD:35,270-UNIMOD:21,271-UNIMOD:21	0.04	24.0	4	2	1
PRT	sp|Q6ZS17|RIPR1_HUMAN	Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	346-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	293-UNIMOD:21,294-UNIMOD:21,303-UNIMOD:4,312-UNIMOD:21,315-UNIMOD:4	0.02	24.0	5	4	3
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	23-UNIMOD:21,41-UNIMOD:4,22-UNIMOD:35	0.03	24.0	5	2	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	386-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	330-UNIMOD:21,332-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|P49821|NDUV1_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	31-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	382-UNIMOD:21,392-UNIMOD:21,385-UNIMOD:21	0.03	24.0	3	1	0
PRT	sp|Q9H2J7|S6A15_HUMAN	Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	699-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	658-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P49902|5NTC_HUMAN	Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	511-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	33-UNIMOD:21,37-UNIMOD:21	0.10	24.0	3	2	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	759-UNIMOD:21,1106-UNIMOD:21,458-UNIMOD:21,19-UNIMOD:21,1087-UNIMOD:21,761-UNIMOD:21	0.04	24.0	8	8	8
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	455-UNIMOD:21,464-UNIMOD:35	0.03	24.0	3	1	0
PRT	sp|Q13510|ASAH1_HUMAN	Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	301-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	3744-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1371-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	333-UNIMOD:21,335-UNIMOD:21,331-UNIMOD:21,334-UNIMOD:21	0.05	24.0	3	1	0
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	29-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	64-UNIMOD:21,66-UNIMOD:4,74-UNIMOD:4	0.11	24.0	5	3	2
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	13-UNIMOD:21	0.06	24.0	3	2	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	76-UNIMOD:21,215-UNIMOD:28,220-UNIMOD:21,219-UNIMOD:21,198-UNIMOD:21,184-UNIMOD:21,325-UNIMOD:21,52-UNIMOD:21	0.13	24.0	11	7	5
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	544-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	646-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	41-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	41-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	142-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|Q16513|PKN2_HUMAN	Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	583-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	340-UNIMOD:21,347-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1029-UNIMOD:21,1032-UNIMOD:4,1313-UNIMOD:21,462-UNIMOD:21	0.03	24.0	4	3	2
PRT	sp|Q8N350|CBARP_HUMAN	Voltage-dependent calcium channel beta subunit-associated regulatory protein OS=Homo sapiens OX=9606 GN=CBARP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	343-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	270-UNIMOD:21,52-UNIMOD:21	0.07	24.0	2	2	2
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	353-UNIMOD:21,358-UNIMOD:21,467-UNIMOD:21	0.06	24.0	5	2	1
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	397-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P50213|IDH3A_HUMAN	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	351-UNIMOD:4,352-UNIMOD:21,359-UNIMOD:4,207-UNIMOD:21	0.08	24.0	2	2	2
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	648-UNIMOD:21,452-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|Q96G74|OTUD5_HUMAN	OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	433-UNIMOD:21,434-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	739-UNIMOD:21,744-UNIMOD:4,330-UNIMOD:21,336-UNIMOD:4,337-UNIMOD:4	0.02	24.0	2	2	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	79-UNIMOD:28,81-UNIMOD:21	0.07	24.0	6	2	0
PRT	sp|P48637|GSHB_HUMAN	Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,7-UNIMOD:21,276-UNIMOD:21	0.05	24.0	3	2	1
PRT	sp|Q9Y2H0|DLGP4_HUMAN	Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	971-UNIMOD:28,973-UNIMOD:21,975-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	31-UNIMOD:4,32-UNIMOD:21	0.12	23.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	254-UNIMOD:4,255-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q13610|PWP1_HUMAN	Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	485-UNIMOD:21	0.02	23.0	4	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	247-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	93-UNIMOD:21,160-UNIMOD:21	0.07	23.0	2	2	2
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	87-UNIMOD:21,96-UNIMOD:4,23-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	282-UNIMOD:21,322-UNIMOD:21,109-UNIMOD:21	0.08	23.0	4	3	2
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	633-UNIMOD:21,511-UNIMOD:21,631-UNIMOD:21,40-UNIMOD:21	0.09	23.0	13	4	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	404-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|O00458|IFRD1_HUMAN	Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	14-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	584-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	429-UNIMOD:35,432-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	43-UNIMOD:21,8-UNIMOD:21,21-UNIMOD:4	0.08	23.0	2	2	2
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	663-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	130-UNIMOD:21,133-UNIMOD:21,14-UNIMOD:21	0.11	23.0	4	4	4
PRT	sp|Q9UN86|G3BP2_HUMAN	Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	48-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|O43353|RIPK2_HUMAN	Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	531-UNIMOD:21	0.02	23.0	3	1	0
PRT	sp|P11532|DMD_HUMAN	Dystrophin OS=Homo sapiens OX=9606 GN=DMD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	3623-UNIMOD:21,3627-UNIMOD:35	0.00	23.0	2	1	0
PRT	sp|Q9HC36|MRM3_HUMAN	rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	105-UNIMOD:21,106-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	162-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	18-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q86X02|CDR2L_HUMAN	Cerebellar degeneration-related protein 2-like OS=Homo sapiens OX=9606 GN=CDR2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:21,317-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q96CW6|S7A6O_HUMAN	Probable RNA polymerase II nuclear localization protein SLC7A6OS OS=Homo sapiens OX=9606 GN=SLC7A6OS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	16-UNIMOD:21,27-UNIMOD:4	0.05	23.0	2	1	0
PRT	sp|Q6UVK1|CSPG4_HUMAN	Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	321-UNIMOD:21,1609-UNIMOD:21	0.01	23.0	3	2	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	729-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	871-UNIMOD:21,875-UNIMOD:35,870-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	408-UNIMOD:21,148-UNIMOD:21,89-UNIMOD:21,212-UNIMOD:21,469-UNIMOD:21,627-UNIMOD:21,294-UNIMOD:21	0.17	23.0	10	8	6
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	264-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2690-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	229-UNIMOD:21,754-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	408-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	493-UNIMOD:21,432-UNIMOD:21	0.06	23.0	3	2	1
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	36-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|P82673|RT35_HUMAN	28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	295-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	413-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	446-UNIMOD:385,446-UNIMOD:4,447-UNIMOD:21,374-UNIMOD:21,275-UNIMOD:21,368-UNIMOD:21,369-UNIMOD:21	0.07	23.0	5	4	3
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1278-UNIMOD:21,1541-UNIMOD:21	0.01	23.0	3	3	3
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	190-UNIMOD:28,193-UNIMOD:21,200-UNIMOD:4	0.02	23.0	4	1	0
PRT	sp|P40189|IL6RB_HUMAN	Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	836-UNIMOD:28,838-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	206-UNIMOD:21,209-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q3MII6|TBC25_HUMAN	TBC1 domain family member 25 OS=Homo sapiens OX=9606 GN=TBC1D25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	504-UNIMOD:28,506-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21	0.12	23.0	2	1	0
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	861-UNIMOD:21,864-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	12-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	58-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1500-UNIMOD:21,1681-UNIMOD:21,918-UNIMOD:21	0.02	22.0	3	3	3
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	773-UNIMOD:21	0.01	22.0	2	2	2
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	522-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9UK45|LSM7_HUMAN	U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens OX=9606 GN=LSM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	11-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	759-UNIMOD:21,579-UNIMOD:21,587-UNIMOD:21,589-UNIMOD:4	0.04	22.0	3	3	3
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	92-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1230-UNIMOD:21,1241-UNIMOD:35	0.00	22.0	2	1	0
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1233-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9NZ53|PDXL2_HUMAN	Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	207-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	72-UNIMOD:21,70-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4	0.03	22.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.20	22.0	1	1	1
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	22.0	null	855-UNIMOD:21,1229-UNIMOD:21,1192-UNIMOD:21	0.04	22.0	3	3	3
PRT	sp|Q86V85|GP180_HUMAN	Integral membrane protein GPR180 OS=Homo sapiens OX=9606 GN=GPR180 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	24-UNIMOD:21,28-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	434-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P49959|MRE11_HUMAN	Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	619-UNIMOD:21,618-UNIMOD:35	0.01	22.0	3	1	0
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	117-UNIMOD:21,118-UNIMOD:35,119-UNIMOD:21	0.02	22.0	4	1	0
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1706-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q5JTJ3|COA6_HUMAN	Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	84-UNIMOD:21,90-UNIMOD:4,85-UNIMOD:21	0.13	22.0	2	2	2
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	650-UNIMOD:21,79-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	197-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O75746|CMC1_HUMAN	Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	360-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	343-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	301-UNIMOD:21,299-UNIMOD:35	0.04	22.0	3	1	0
PRT	sp|Q9UMY4|SNX12_HUMAN	Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	73-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|P21731|TA2R_HUMAN	Thromboxane A2 receptor OS=Homo sapiens OX=9606 GN=TBXA2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	331-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	328-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	465-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	548-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	68-UNIMOD:21,70-UNIMOD:4	0.09	22.0	2	2	2
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	180-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1091-UNIMOD:21,1092-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	79-UNIMOD:21	0.11	22.0	2	1	0
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	704-UNIMOD:21,706-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	152-UNIMOD:21,162-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	104-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	336-UNIMOD:21,217-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	513-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	102-UNIMOD:21	0.26	22.0	2	2	2
PRT	sp|Q6NUQ4|TM214_HUMAN	Transmembrane protein 214 OS=Homo sapiens OX=9606 GN=TMEM214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	455-UNIMOD:21,464-UNIMOD:4,468-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O00217|NDUS8_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	141-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1508-UNIMOD:21,1378-UNIMOD:21,1506-UNIMOD:35	0.01	21.0	4	3	2
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	242-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:21,101-UNIMOD:4,451-UNIMOD:21,453-UNIMOD:21	0.04	21.0	4	2	0
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	366-UNIMOD:21,368-UNIMOD:35,298-UNIMOD:21	0.05	21.0	5	2	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	252-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	7-UNIMOD:21,334-UNIMOD:35,335-UNIMOD:21	0.02	21.0	4	2	1
PRT	sp|Q9HBD1|RC3H2_HUMAN	Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1119-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q8WVC0|LEO1_HUMAN	RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	608-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	320-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	902-UNIMOD:21,903-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	156-UNIMOD:21,395-UNIMOD:21	0.05	21.0	3	3	3
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1799-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P61956|SUMO2_HUMAN	Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	28-UNIMOD:21	0.14	21.0	1	1	1
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	259-UNIMOD:21,201-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q6NZI2|CAVN1_HUMAN	Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	300-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1003-UNIMOD:21,794-UNIMOD:21,602-UNIMOD:21,1001-UNIMOD:21,603-UNIMOD:21	0.05	21.0	6	4	3
PRT	sp|Q13740|CD166_HUMAN	CD166 antigen OS=Homo sapiens OX=9606 GN=ALCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	77-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	173-UNIMOD:21	0.07	21.0	2	2	2
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1383-UNIMOD:21,1384-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	345-UNIMOD:21,481-UNIMOD:35,486-UNIMOD:21	0.07	21.0	2	2	2
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	627-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:35	0.03	21.0	5	3	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	424-UNIMOD:21	0.07	21.0	2	2	2
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	726-UNIMOD:4,727-UNIMOD:21,726-UNIMOD:385	0.02	21.0	3	3	3
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	50-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	672-UNIMOD:21,677-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	584-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P18859|ATP5J_HUMAN	ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	56-UNIMOD:21	0.19	21.0	2	2	2
PRT	sp|P43121|MUC18_HUMAN	Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	93-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.18	21.0	2	1	0
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	77-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|Q8N142|PURA1_HUMAN	Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens OX=9606 GN=ADSS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	452-UNIMOD:21,453-UNIMOD:35	0.02	21.0	3	1	0
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	335-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	249-UNIMOD:21,203-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	683-UNIMOD:21,1018-UNIMOD:21,1027-UNIMOD:4	0.02	21.0	2	2	2
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	41-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P35573|GDE_HUMAN	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	878-UNIMOD:21,1282-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1093-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q14108|SCRB2_HUMAN	Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	124-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	427-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1877-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	138-UNIMOD:21,139-UNIMOD:21,150-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	798-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P52298|NCBP2_HUMAN	Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	13-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	90-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NUL7|DDX28_HUMAN	Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens OX=9606 GN=DDX28 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	123-UNIMOD:21,124-UNIMOD:21,524-UNIMOD:21	0.05	21.0	3	2	1
PRT	sp|Q8TB72|PUM2_HUMAN	Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	67-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	367-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	83-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1113-UNIMOD:21,1114-UNIMOD:4,1117-UNIMOD:4,1129-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	21.0	null	416-UNIMOD:4,424-UNIMOD:21,427-UNIMOD:4,310-UNIMOD:21,308-UNIMOD:21	0.09	21.0	4	3	2
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,5-UNIMOD:21,1-UNIMOD:35,4-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	2-UNIMOD:1,14-UNIMOD:21,20-UNIMOD:21,27-UNIMOD:35	0.04	21.0	3	2	1
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,11-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P20340|RAB6A_HUMAN	Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,2-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,2-UNIMOD:21	0.14	21.0	3	1	0
PRT	sp|P11441|UBL4A_HUMAN	Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	57-UNIMOD:21,13-UNIMOD:4,14-UNIMOD:21	0.19	20.0	2	2	2
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	83-UNIMOD:21,82-UNIMOD:35	0.03	20.0	2	1	0
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	321-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	40-UNIMOD:21,42-UNIMOD:4,44-UNIMOD:4,50-UNIMOD:4	0.09	20.0	3	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	135-UNIMOD:21	0.15	20.0	4	4	4
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	183-UNIMOD:21	0.05	20.0	5	2	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1205-UNIMOD:21,1211-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O15066|KIF3B_HUMAN	Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	725-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	186-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1859-UNIMOD:21,1406-UNIMOD:21	0.01	20.0	4	3	2
PRT	sp|Q9UJW0|DCTN4_HUMAN	Dynactin subunit 4 OS=Homo sapiens OX=9606 GN=DCTN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	89-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q05682-4|CALD1_HUMAN	Isoform 4 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	202-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	85-UNIMOD:21,86-UNIMOD:21,84-UNIMOD:21,89-UNIMOD:35,87-UNIMOD:21	0.04	20.0	7	5	4
PRT	sp|P16615|AT2A2_HUMAN	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	493-UNIMOD:21,498-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	260-UNIMOD:21,72-UNIMOD:21	0.10	20.0	2	2	2
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	319-UNIMOD:21,414-UNIMOD:21,422-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	163-UNIMOD:21,167-UNIMOD:4,59-UNIMOD:21,69-UNIMOD:4	0.13	20.0	2	2	2
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:21,1259-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	332-UNIMOD:21,339-UNIMOD:4,342-UNIMOD:4,344-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	10-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	177-UNIMOD:21,182-UNIMOD:4,83-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	316-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|O94875|SRBS2_HUMAN	Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	211-UNIMOD:21,843-UNIMOD:21	0.02	20.0	2	2	2
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	913-UNIMOD:21,52-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	520-UNIMOD:21,477-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.06	20.0	4	3	2
PRT	sp|Q13425|SNTB2_HUMAN	Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	258-UNIMOD:21,395-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q8N4S0|CCD82_HUMAN	Coiled-coil domain-containing protein 82 OS=Homo sapiens OX=9606 GN=CCDC82 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	186-UNIMOD:21,187-UNIMOD:21,190-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q9Y5P4|CERT_HUMAN	Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	null	377-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1068-UNIMOD:21,1067-UNIMOD:35,2708-UNIMOD:21,886-UNIMOD:21,177-UNIMOD:21,819-UNIMOD:21,4850-UNIMOD:21	0.06	20.0	8	7	6
PRT	sp|Q07866-4|KLC1_HUMAN	Isoform J of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	599-UNIMOD:21,600-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	115-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	146-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	722-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	169-UNIMOD:21,170-UNIMOD:35,48-UNIMOD:21	0.08	20.0	4	2	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	387-UNIMOD:21,298-UNIMOD:21,631-UNIMOD:21,645-UNIMOD:4,390-UNIMOD:21,272-UNIMOD:4,280-UNIMOD:21	0.08	20.0	5	5	5
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	234-UNIMOD:21,335-UNIMOD:4,184-UNIMOD:21,314-UNIMOD:21	0.16	20.0	5	4	3
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	279-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q15172|2A5A_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	49-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q15149-4|PLEC_HUMAN	Isoform 4 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	21-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	22-UNIMOD:21,36-UNIMOD:4,21-UNIMOD:21	0.03	20.0	3	3	3
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	10-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	776-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	8-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	48-UNIMOD:35,53-UNIMOD:4,54-UNIMOD:21	0.06	20.0	2	1	0
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	2-UNIMOD:1,6-UNIMOD:21,11-UNIMOD:4,15-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	20.0	null	2-UNIMOD:1,2-UNIMOD:21	0.07	20.0	2	2	2
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	18-UNIMOD:21,24-UNIMOD:35	0.11	20.0	1	1	1
PRT	sp|Q14011|CIRBP_HUMAN	Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	163-UNIMOD:21	0.11	20.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,2-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	121-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	7-UNIMOD:21,17-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	158-UNIMOD:35,161-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	58-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	236-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	433-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O94763|RMP_HUMAN	Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	372-UNIMOD:21,418-UNIMOD:21,420-UNIMOD:4	0.08	19.0	2	2	2
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	79-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	684-UNIMOD:21,898-UNIMOD:21,794-UNIMOD:21,799-UNIMOD:35	0.02	19.0	3	3	3
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	507-UNIMOD:21	0.01	19.0	2	1	0
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	500-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	129-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q96EP0|RNF31_HUMAN	E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	466-UNIMOD:21,473-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	303-UNIMOD:21,280-UNIMOD:21,284-UNIMOD:4,260-UNIMOD:21	0.06	19.0	3	3	3
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	51-UNIMOD:21	0.03	19.0	3	2	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	109-UNIMOD:21,361-UNIMOD:21,171-UNIMOD:21	0.07	19.0	7	5	4
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	123-UNIMOD:21,209-UNIMOD:21	0.10	19.0	2	2	2
PRT	sp|Q8IX90|SKA3_HUMAN	Spindle and kinetochore-associated protein 3 OS=Homo sapiens OX=9606 GN=SKA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	110-UNIMOD:21,126-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	377-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|Q96K21|ANCHR_HUMAN	Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	213-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	19.0	null	39-UNIMOD:21,63-UNIMOD:21	0.26	19.0	2	2	2
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	403-UNIMOD:21,404-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	120-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	78-UNIMOD:21,82-UNIMOD:21,83-UNIMOD:21	0.02	19.0	3	2	1
PRT	sp|Q8TEA8|DTD1_HUMAN	D-aminoacyl-tRNA deacylase 1 OS=Homo sapiens OX=9606 GN=DTD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	196-UNIMOD:21	0.08	19.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	301-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	657-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	172-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	92-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	168-UNIMOD:21,169-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	36-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	118-UNIMOD:21,116-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	110-UNIMOD:21,211-UNIMOD:21	0.07	19.0	3	2	1
PRT	sp|Q8N0T1|RBIS_HUMAN	Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	67-UNIMOD:21	0.10	19.0	2	1	0
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	144-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	392-UNIMOD:21,111-UNIMOD:21,120-UNIMOD:4	0.06	19.0	3	2	1
PRT	sp|Q96GS4|BORC6_HUMAN	BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	196-UNIMOD:21,107-UNIMOD:21	0.09	19.0	2	2	2
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	118-UNIMOD:21,126-UNIMOD:35	0.09	19.0	6	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	228-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	188-UNIMOD:4,198-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	79-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1554-UNIMOD:21,2361-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	319-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	717-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|O95490|AGRL2_HUMAN	Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1430-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9H3H1|MOD5_HUMAN	tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	431-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2720-UNIMOD:21,1507-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1158-UNIMOD:21,1133-UNIMOD:21,1144-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	364-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	518-UNIMOD:385,518-UNIMOD:4,519-UNIMOD:21,520-UNIMOD:21	0.02	19.0	3	2	1
PRT	sp|Q7Z4Q2|HEAT3_HUMAN	HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	340-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q14997|PSME4_HUMAN	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1746-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q10571|MN1_HUMAN	Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1170-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	9-UNIMOD:21,10-UNIMOD:21,7-UNIMOD:21	0.06	19.0	4	3	2
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1583-UNIMOD:21,359-UNIMOD:21,362-UNIMOD:4,364-UNIMOD:4	0.01	19.0	2	2	2
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	105-UNIMOD:35,106-UNIMOD:21	0.06	19.0	3	1	0
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	335-UNIMOD:21,336-UNIMOD:21	0.04	19.0	3	2	1
PRT	sp|Q8NBJ4|GOLM1_HUMAN	Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	153-UNIMOD:21,159-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|O43164|PJA2_HUMAN	E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	196-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	105-UNIMOD:4,108-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O00487|PSDE_HUMAN	26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	224-UNIMOD:21,238-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	607-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|O60291|MGRN1_HUMAN	E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	515-UNIMOD:21,528-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	277-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	33-UNIMOD:28,36-UNIMOD:21,38-UNIMOD:4,569-UNIMOD:21	0.04	19.0	2	2	2
PRT	sp|P13473|LAMP2_HUMAN	Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	153-UNIMOD:385,153-UNIMOD:4,155-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	618-UNIMOD:21,623-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	211-UNIMOD:21	0.09	18.0	2	2	2
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	515-UNIMOD:21	0.01	18.0	2	2	2
PRT	sp|Q86TI2|DPP9_HUMAN	Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	45-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	316-UNIMOD:21	0.02	18.0	2	2	2
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	62-UNIMOD:21,69-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P33240|CSTF2_HUMAN	Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	310-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|P30305|MPIP2_HUMAN	M-phase inducer phosphatase 2 OS=Homo sapiens OX=9606 GN=CDC25B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	353-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q02127|PYRD_HUMAN	Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Homo sapiens OX=9606 GN=DHODH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	187-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	152-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	430-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	554-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	1808-UNIMOD:21,1195-UNIMOD:21,1398-UNIMOD:21	0.02	18.0	3	3	3
PRT	sp|O60220|TIM8A_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	94-UNIMOD:21	0.12	18.0	1	1	1
PRT	sp|O95835|LATS1_HUMAN	Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	464-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	184-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	332-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	290-UNIMOD:21	0.07	18.0	2	2	2
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	761-UNIMOD:4,762-UNIMOD:21,766-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q96EN8|MOCOS_HUMAN	Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	528-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|P82933|RT09_HUMAN	28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	68-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	672-UNIMOD:21,676-UNIMOD:21,569-UNIMOD:21,584-UNIMOD:4	0.05	18.0	3	2	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	120-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	326-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q969X5|ERGI1_HUMAN	Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens OX=9606 GN=ERGIC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	206-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	307-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	343-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	856-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	null	35-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	524-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q6RFH5|WDR74_HUMAN	WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	361-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	750-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1127-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	9-UNIMOD:21	0.07	18.0	2	2	2
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	1074-UNIMOD:21,1387-UNIMOD:4,1389-UNIMOD:21,1387-UNIMOD:385,1388-UNIMOD:21	0.01	18.0	3	2	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	426-UNIMOD:21,10-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q13625|ASPP2_HUMAN	Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	739-UNIMOD:21	0.02	18.0	2	2	2
PRT	sp|Q6NYC1|JMJD6_HUMAN	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	380-UNIMOD:4,381-UNIMOD:21,394-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	240-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	153-UNIMOD:21,183-UNIMOD:21	0.15	18.0	2	2	2
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	58-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	72-UNIMOD:21,77-UNIMOD:35	0.01	18.0	3	1	0
PRT	sp|Q9GZY8-5|MFF_HUMAN	Isoform 5 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	146-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	816-UNIMOD:21,288-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2291-UNIMOD:21,2107-UNIMOD:21,2113-UNIMOD:21,2115-UNIMOD:4,1442-UNIMOD:21,2103-UNIMOD:21	0.02	18.0	4	3	2
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	104-UNIMOD:21,87-UNIMOD:4,96-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	92-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	984-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1329-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9BWH6|RPAP1_HUMAN	RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	150-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	168-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	31-UNIMOD:21	0.12	18.0	1	1	1
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	609-UNIMOD:21,18-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q96AQ6|PBIP1_HUMAN	Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	407-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	182-UNIMOD:21,184-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	84-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	107-UNIMOD:21,111-UNIMOD:4	0.12	18.0	1	1	1
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1941-UNIMOD:21,1945-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|Q9BRG2|SH23A_HUMAN	SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	123-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P56937|DHB7_HUMAN	3-keto-steroid reductase OS=Homo sapiens OX=9606 GN=HSD17B7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	177-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|Q9H2U1|DHX36_HUMAN	ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	161-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	445-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	412-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|Q7Z401|MYCPP_HUMAN	C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1151-UNIMOD:21,1152-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	232-UNIMOD:21,235-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q7L2E3|DHX30_HUMAN	ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	226-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	137-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	38-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	113-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	189-UNIMOD:21,199-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,3-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9NRP4|SDHF3_HUMAN	Succinate dehydrogenase assembly factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=SDHAF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	114-UNIMOD:28,116-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	18-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|O95453|PARN_HUMAN	Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	557-UNIMOD:21	0.02	18.0	2	2	2
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	339-UNIMOD:21,533-UNIMOD:21,538-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|O60783|RT14_HUMAN	28S ribosomal protein S14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	56-UNIMOD:21,61-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	12-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	188-UNIMOD:4,190-UNIMOD:21,188-UNIMOD:385	0.03	17.0	2	1	0
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	103-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	723-UNIMOD:21,401-UNIMOD:21,721-UNIMOD:28	0.03	17.0	5	2	0
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	500-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	175-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	258-UNIMOD:21,260-UNIMOD:21	0.05	17.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	99-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	241-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	84-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O75127|PTCD1_HUMAN	Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	105-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	268-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	250-UNIMOD:21,217-UNIMOD:21	0.11	17.0	2	2	2
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	164-UNIMOD:21,159-UNIMOD:35	0.08	17.0	2	1	0
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	96-UNIMOD:21,100-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q8NEY8|PPHLN_HUMAN	Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	110-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2245-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	332-UNIMOD:21,102-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	88-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	474-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9UKV8|AGO2_HUMAN	Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	387-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q13439-5|GOGA4_HUMAN	Isoform 5 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	41-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P55735|SEC13_HUMAN	Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	184-UNIMOD:21,187-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	92-UNIMOD:21	0.11	17.0	1	1	1
PRT	sp|Q9H4I2|ZHX3_HUMAN	Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	7-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q07954|LRP1_HUMAN	Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2950-UNIMOD:21,2952-UNIMOD:4,2956-UNIMOD:4	0.00	17.0	1	1	1
PRT	sp|Q9H2H9|S38A1_HUMAN	Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	52-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	257-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	759-UNIMOD:21,767-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	25-UNIMOD:4,29-UNIMOD:21,33-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	19-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	24-UNIMOD:21,25-UNIMOD:35	0.09	17.0	2	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	3845-UNIMOD:21,1711-UNIMOD:21,1714-UNIMOD:4,1716-UNIMOD:4	0.01	17.0	2	2	2
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	473-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	273-UNIMOD:21,278-UNIMOD:4,287-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	21-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	13-UNIMOD:4,15-UNIMOD:21,115-UNIMOD:21	0.12	17.0	2	2	2
PRT	sp|Q14696|MESD_HUMAN	LRP chaperone MESD OS=Homo sapiens OX=9606 GN=MESD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	165-UNIMOD:21,88-UNIMOD:21	0.15	17.0	2	2	2
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	591-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	55-UNIMOD:21,20-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	458-UNIMOD:21,540-UNIMOD:4,546-UNIMOD:21	0.05	17.0	3	2	1
PRT	sp|Q32P44|EMAL3_HUMAN	Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	885-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P11274|BCR_HUMAN	Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1264-UNIMOD:21,239-UNIMOD:21,240-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|A6NIH7|U119B_HUMAN	Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	229-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	207-UNIMOD:21,109-UNIMOD:21	0.04	17.0	3	2	1
PRT	sp|Q8N4C8|MINK1_HUMAN	Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	701-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	601-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1861-UNIMOD:21,1471-UNIMOD:21	0.01	17.0	3	3	3
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	111-UNIMOD:21,112-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q15121|PEA15_HUMAN	Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	116-UNIMOD:21	0.11	17.0	1	1	1
PRT	sp|Q9NRA8|4ET_HUMAN	Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	5-UNIMOD:21,349-UNIMOD:21,353-UNIMOD:21,6-UNIMOD:35	0.04	17.0	3	2	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	53-UNIMOD:21,54-UNIMOD:21,55-UNIMOD:35	0.02	17.0	2	1	0
PRT	sp|O15116|LSM1_HUMAN	U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens OX=9606 GN=LSM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	123-UNIMOD:21	0.12	17.0	1	1	1
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	212-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|P15408|FOSL2_HUMAN	Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	308-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	273-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	400-UNIMOD:21	0.02	17.0	2	2	2
PRT	sp|O75976|CBPD_HUMAN	Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1358-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	294-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	11-UNIMOD:21,15-UNIMOD:21,54-UNIMOD:21,140-UNIMOD:21	0.10	17.0	3	3	3
PRT	sp|Q14318|FKBP8_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	295-UNIMOD:4,296-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62318|SMD3_HUMAN	Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q15532|SSXT_HUMAN	Protein SSXT OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9NUL5|SHFL_HUMAN	Shiftless antiviral inhibitor of ribosomal frameshifting protein OS=Homo sapiens OX=9606 GN=SHFL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	52-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	57-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|Q96BK5|PINX1_HUMAN	PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	110-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P09669|COX6C_HUMAN	Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	73-UNIMOD:21	0.12	16.0	1	1	1
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	258-UNIMOD:35,259-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1676-UNIMOD:4,1680-UNIMOD:21,617-UNIMOD:21	0.02	16.0	3	3	3
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	86-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	490-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	274-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9NPH3|IL1AP_HUMAN	Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	557-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P51957|NEK4_HUMAN	Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	377-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	160-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	136-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q5T5Y3|CAMP1_HUMAN	Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	431-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1807-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	217-UNIMOD:21,222-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	461-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9Y570|PPME1_HUMAN	Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	226-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|O60825|F262_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	466-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q8WUI4|HDAC7_HUMAN	Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	573-UNIMOD:21,486-UNIMOD:21	0.04	16.0	2	2	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	36-UNIMOD:21,50-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.19	16.0	1	1	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	146-UNIMOD:21	0.07	16.0	2	2	2
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	435-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9H6H4|REEP4_HUMAN	Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	152-UNIMOD:21,153-UNIMOD:35	0.04	16.0	2	1	0
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1043-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	78-UNIMOD:21	0.03	16.0	3	2	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	498-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	318-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	576-UNIMOD:21,440-UNIMOD:21	0.04	16.0	2	2	2
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	38-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q96B01|R51A1_HUMAN	RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	317-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9BUR5|MIC26_HUMAN	MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	34-UNIMOD:21	0.13	16.0	2	1	0
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	90-UNIMOD:21	0.13	16.0	1	1	1
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	98-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	242-UNIMOD:21,172-UNIMOD:21,175-UNIMOD:4	0.05	16.0	2	2	2
PRT	sp|A1L390|PKHG3_HUMAN	Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	636-UNIMOD:21,640-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	79-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	548-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	151-UNIMOD:21,152-UNIMOD:4,156-UNIMOD:4,210-UNIMOD:21	0.10	16.0	2	2	2
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	372-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q05655|KPCD_HUMAN	Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	306-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	172-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	274-UNIMOD:21,275-UNIMOD:35,276-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	1054-UNIMOD:35,1055-UNIMOD:21,1070-UNIMOD:4,1069-UNIMOD:35,1053-UNIMOD:28	0.02	16.0	6	2	0
PRT	sp|P84103|SRSF3_HUMAN	Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	0.07	16.0	2	1	0
PRT	sp|Q86UK7|ZN598_HUMAN	E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	851-UNIMOD:21,864-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9H8S9|MOB1A_HUMAN	MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21,10-UNIMOD:21,7-UNIMOD:21	0.05	16.0	4	2	0
PRT	sp|Q9BZL6|KPCD2_HUMAN	Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	197-UNIMOD:21,198-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O43709|BUD23_HUMAN	Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	248-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	100-UNIMOD:21,197-UNIMOD:21	0.10	15.0	2	2	2
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	595-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	187-UNIMOD:21,190-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	282-UNIMOD:21,702-UNIMOD:21	0.03	15.0	3	3	3
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	444-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q86XZ4|SPAS2_HUMAN	Spermatogenesis-associated serine-rich protein 2 OS=Homo sapiens OX=9606 GN=SPATS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	480-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q86W92-2|LIPB1_HUMAN	Isoform 2 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	532-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8IUI8|CRLF3_HUMAN	Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	298-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	356-UNIMOD:21,540-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	487-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	93-UNIMOD:21,96-UNIMOD:21	0.17	15.0	3	2	1
PRT	sp|O95819-2|M4K4_HUMAN	Isoform 2 of Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	608-UNIMOD:21,625-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	276-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	53-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|Q8TF05|PP4R1_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	538-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	39-UNIMOD:21,43-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|O75477|ERLN1_HUMAN	Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	346-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	21-UNIMOD:21,24-UNIMOD:21	0.09	15.0	1	1	1
PRT	sp|Q96CW1|AP2M1_HUMAN	AP-2 complex subunit mu OS=Homo sapiens OX=9606 GN=AP2M1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	240-UNIMOD:21,246-UNIMOD:4,251-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1071-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|O95363|SYFM_HUMAN	Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	49-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	23-UNIMOD:21,27-UNIMOD:4	0.30	15.0	1	1	1
PRT	sp|Q9NVU0|RPC5_HUMAN	DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	192-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P26374|RAE2_HUMAN	Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens OX=9606 GN=CHML PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	320-UNIMOD:4,321-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	253-UNIMOD:21,254-UNIMOD:4,257-UNIMOD:21,264-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	175-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|Q16134|ETFD_HUMAN	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=ETFDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	551-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	707-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	49-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	761-UNIMOD:21,762-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	104-UNIMOD:21,232-UNIMOD:4	0.10	15.0	3	3	3
PRT	sp|Q9H3Q1|BORG4_HUMAN	Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	307-UNIMOD:21,313-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|Q5J8M3|EMC4_HUMAN	ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	36-UNIMOD:21,41-UNIMOD:21	0.12	15.0	2	2	2
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	54-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	342-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	174-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|Q9BRT6|LLPH_HUMAN	Protein LLP homolog OS=Homo sapiens OX=9606 GN=LLPH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	31-UNIMOD:21,41-UNIMOD:35	0.10	15.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	176-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	529-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	408-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,5-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	75-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	798-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	507-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q6P3W7|SCYL2_HUMAN	SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	677-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9UPV0|CE164_HUMAN	Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	765-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9Y666|S12A7_HUMAN	Solute carrier family 12 member 7 OS=Homo sapiens OX=9606 GN=SLC12A7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	319-UNIMOD:21,323-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q8NI08|NCOA7_HUMAN	Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	89-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P34896|GLYC_HUMAN	Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	409-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	40-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q93100|KPBB_HUMAN	Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	27-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	269-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	500-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9BWH2|FUND2_HUMAN	FUN14 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FUNDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	151-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	41-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	337-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	223-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	14.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	601-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9BZ23|PANK2_HUMAN	Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	189-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	34-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q5T653|RM02_HUMAN	39S ribosomal protein L2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	300-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	104-UNIMOD:21	0.05	14.0	2	2	2
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	924-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P33527|MRP1_HUMAN	Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	915-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	74-UNIMOD:21,81-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	279-UNIMOD:21,1398-UNIMOD:21	0.02	14.0	2	2	2
PRT	sp|Q3ZCQ8|TIM50_HUMAN	Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	45-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1443-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	114-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q4KMQ2|ANO6_HUMAN	Anoctamin-6 OS=Homo sapiens OX=9606 GN=ANO6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	256-UNIMOD:21,261-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q86TB9|PATL1_HUMAN	Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	177-UNIMOD:21,178-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P61073|CXCR4_HUMAN	C-X-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CXCR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	339-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	null	310-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	901-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q8N983|RM43_HUMAN	39S ribosomal protein L43, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL43 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	30-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	191-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	283-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	256-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	672-UNIMOD:21	0.01	14.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1509-UNIMOD:21,1140-UNIMOD:21	0.01	14.0	3	2	1
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1173-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	410-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	2	2	2
PRT	sp|P08237|PFKAM_HUMAN	ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	477-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	111-UNIMOD:21	0.03	14.0	2	1	0
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	47-UNIMOD:4	0.09	14.0	2	2	2
PRT	sp|Q86YS7-2|C2CD5_HUMAN	Isoform 2 of C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	855-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	790-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q12972|PP1R8_HUMAN	Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PPP1R8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	202-UNIMOD:21	0.07	14.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	958-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	710-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1080-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P15056|BRAF_HUMAN	Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	446-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	654-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P52943|CRIP2_HUMAN	Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	114-UNIMOD:21,126-UNIMOD:4	0.08	14.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	43-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q15032|R3HD1_HUMAN	R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	302-UNIMOD:21,304-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,2-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	147-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P11802|CDK4_HUMAN	Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	285-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	136-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|O75438|NDUB1_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 OS=Homo sapiens OX=9606 GN=NDUFB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	42-UNIMOD:21	0.12	13.0	1	1	1
PRT	sp|P53355|DAPK1_HUMAN	Death-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=DAPK1 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	57-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	206-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1016-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	431-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	416-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	387-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	748-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	317-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.09	13.0	1	1	1
PRT	sp|Q5T0N5|FBP1L_HUMAN	Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	489-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9Y3B8|ORN_HUMAN	Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	203-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1666-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O95429|BAG4_HUMAN	BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	7-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	416-UNIMOD:21,1134-UNIMOD:21	0.01	13.0	2	2	2
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	432-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	709-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	123-UNIMOD:21,124-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	240-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	268-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	128-UNIMOD:21	0.14	13.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1327-UNIMOD:21,1456-UNIMOD:21	0.02	13.0	3	2	1
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	239-UNIMOD:21,240-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P79522|PRR3_HUMAN	Proline-rich protein 3 OS=Homo sapiens OX=9606 GN=PRR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	135-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	74-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	23-UNIMOD:21	0.03	13.0	2	1	0
PRT	sp|O95571|ETHE1_HUMAN	Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	19-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	153-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	86-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	504-UNIMOD:4,505-UNIMOD:21,507-UNIMOD:4	0.03	13.0	2	1	0
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|Q14141|SEPT6_HUMAN	Septin-6 OS=Homo sapiens OX=9606 GN=SEPTIN6 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	388-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	6-UNIMOD:21,10-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9NZJ7|MTCH1_HUMAN	Mitochondrial carrier homolog 1 OS=Homo sapiens OX=9606 GN=MTCH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	382-UNIMOD:21,385-UNIMOD:4	0.03	13.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	667-UNIMOD:21,674-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	420-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q9NZL9|MAT2B_HUMAN	Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens OX=9606 GN=MAT2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	9-UNIMOD:21,17-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	109-UNIMOD:4,111-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	109-UNIMOD:4,111-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1368-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1140-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	37-UNIMOD:21	0.14	13.0	1	1	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	247-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|O60566|BUB1B_HUMAN	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	508-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	133-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	90-UNIMOD:21,92-UNIMOD:4,94-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q5VYS8|TUT7_HUMAN	Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	783-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	167-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9Y3B7|RM11_HUMAN	39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	45-UNIMOD:21,50-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q4V321|GAG13_HUMAN	G antigen 13 OS=Homo sapiens OX=9606 GN=GAGE13 PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	8-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	322-UNIMOD:4,329-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	574-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9NX00|TM160_HUMAN	Transmembrane protein 160 OS=Homo sapiens OX=9606 GN=TMEM160 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	36-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|O94766|B3GA3_HUMAN	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	325-UNIMOD:28,329-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q8N4N8|KIF2B_HUMAN	Kinesin-like protein KIF2B OS=Homo sapiens OX=9606 GN=KIF2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	653-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P09496|CLCA_HUMAN	Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	234-UNIMOD:35,236-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1162-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|Q8WWY3|PRP31_HUMAN	U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens OX=9606 GN=PRPF31 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	432-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.05	12.0	1	1	1
PRT	sp|P61289|PSME3_HUMAN	Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	248-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q6ZV73|FGD6_HUMAN	FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	605-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	195-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q14194|DPYL1_HUMAN	Dihydropyrimidinase-related protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	8-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	384-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q8TEB1|DCA11_HUMAN	DDB1- and CUL4-associated factor 11 OS=Homo sapiens OX=9606 GN=DCAF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	147-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	199-UNIMOD:4,201-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	48-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	82-UNIMOD:21	0.07	12.0	1	1	1
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	316-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	null	931-UNIMOD:21,932-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	89-UNIMOD:21	0.07	12.0	1	1	1
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	429-UNIMOD:21,433-UNIMOD:4,437-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|P57772|SELB_HUMAN	Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	28-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1049-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P50548|ERF_HUMAN	ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	185-UNIMOD:21,189-UNIMOD:4	0.05	12.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	317-UNIMOD:4	0.04	12.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	95-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.04	12.0	1	1	1
PRT	sp|P30260|CDC27_HUMAN	Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	379-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1373-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1236-UNIMOD:4,1237-UNIMOD:21,1243-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1118-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|O00273|DFFA_HUMAN	DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	27-UNIMOD:21,38-UNIMOD:4	0.06	12.0	1	1	1
PRT	sp|P16333|NCK1_HUMAN	Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	85-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|P23142|FBLN1_HUMAN	Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	242-UNIMOD:4,247-UNIMOD:21,248-UNIMOD:4,260-UNIMOD:4	0.03	12.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.16	12.0	1	1	1
PRT	sp|P53814|SMTN_HUMAN	Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	301-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P27482|CALL3_HUMAN	Calmodulin-like protein 3 OS=Homo sapiens OX=9606 GN=CALML3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.06	12.0	1	1	1
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	61-UNIMOD:21	0.13	12.0	1	1	1
PRT	sp|P42684|ABL2_HUMAN	Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	633-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8TDM6|DLG5_HUMAN	Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	972-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	174-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9UMF0|ICAM5_HUMAN	Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	225-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	269-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	159-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	9-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	53-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	172-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9H9A6|LRC40_HUMAN	Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	49-UNIMOD:21,54-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	104-UNIMOD:21	0.11	12.0	1	1	1
PRT	sp|Q9UMZ2|SYNRG_HUMAN	Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	752-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9NVI7|ATD3A_HUMAN	ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	48-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	417-UNIMOD:4,420-UNIMOD:4	0.03	12.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	208-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P49815|TSC2_HUMAN	Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1427-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	96-UNIMOD:21,116-UNIMOD:4	0.05	12.0	1	1	1
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	2-UNIMOD:1,19-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|P25098|ARBK1_HUMAN	Beta-adrenergic receptor kinase 1 OS=Homo sapiens OX=9606 GN=GRK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	685-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	202-UNIMOD:21,204-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q8TBF4|ZCRB1_HUMAN	Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=ZCRB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	206-UNIMOD:21	0.07	12.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	449-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q14679|TTLL4_HUMAN	Tubulin polyglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	471-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	156-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|O75665|OFD1_HUMAN	Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	899-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|O00716-2|E2F3_HUMAN	Isoform 2 of Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	48-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	92-UNIMOD:21	0.10	12.0	1	1	1
PRT	sp|Q8IWY4|SCUB1_HUMAN	Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	577-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9H1H9|KI13A_HUMAN	Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1759-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8WZ42|TITIN_HUMAN	Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	25718-UNIMOD:21	0.00	12.0	1	1	1
PRT	sp|Q96QB1|RHG07_HUMAN	Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1468-UNIMOD:21,1473-UNIMOD:4	0.01	12.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HQGVMVGMGQKDSYVGDEAQSK	1	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2780.3	27.34713	4	2430.033694	2430.034511	R	R	42	64
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	2	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	7-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2562.4	21.83735	4	3188.308894	3188.312914	K	K	97	126
PSM	SKGPSAAGEQEPDKESGASVDEVAR	3	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2574.2	22.13128	4	2580.133294	2580.134085	K	Q	45	70
PSM	KGSLESPATDVFGSTEEGEK	4	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.4	36.03077	3	2146.932071	2146.930741	R	R	330	350
PSM	TMQGEGPQLLLSEAVSR	5	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3968.2	53.06898	3	1894.890071	1894.885979	K	A	1053	1070
PSM	DNLTLWTSDTQGDEAEAGEGGEN	6	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3546.2	46.49795	3	2407.989071	2407.988786	R	-	223	246
PSM	DATNVGDEGGFAPNILENK	7	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3410.3	43.26725	3	1959.923471	1959.917400	K	E	203	222
PSM	KASSDLDQASVSPSEEENSESSSESEK	8	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2637.6	23.71817	3	2922.170171	2922.177526	R	T	172	199
PSM	HNGTGGKSIYGEKFEDENFILK	9	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3195.2	37.83393	4	2562.183294	2562.179185	R	H	70	92
PSM	SNSVGIQDAFNDGSDSTFQK	10	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3364.5	42.14718	3	2195.901371	2195.900837	R	R	1182	1202
PSM	QASTDAGTAGALTPQHVR	11	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2667.2	24.47403	3	1859.852771	1859.852705	R	A	107	125
PSM	KGSSSSVCSVASSSDISLGSTK	12	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2924.6	30.962	3	2209.971971	2209.977373	R	T	1382	1404
PSM	KLSSSDAPAQDTGSSAAAVETDASR	13	sp|Q7Z4S6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2738.6	26.28973	3	2501.087771	2501.091886	R	T	851	876
PSM	DNLTLWTSDMQGDGEEQNK	14	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3446.3	44.17073	3	2179.937171	2179.932792	R	E	226	245
PSM	YHTSQSGDEMTSLSEYVSR	15	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	39.98057	3	2255.908871	2255.904208	R	M	457	476
PSM	SLQYGAEETPLAGSYGAADSFPK	16	sp|Q9HB90|RRAGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4177.2	55.41445	3	2480.0836	2480.0779	M	D	2	25
PSM	TRSWDSSSPVDRPEPEAASPTTR	17	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2762.5	26.89557	4	2608.155294	2608.155489	R	T	352	375
PSM	SQIFSTASDNQPTVTIK	18	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3223.3	38.54603	3	1915.894271	1915.892839	K	V	448	465
PSM	DNLTLWTSDSAGEECDAAEGAEN	19	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3589.4	47.43893	3	2453.976971	2453.976507	R	-	223	246
PSM	SSIGTGYDLSASTFSPDGR	20	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3965.2	53.03173	3	2038.8587	2038.8516	M	V	2	21
PSM	SLQYGAEETPLAGSYGAADSFPK	21	sp|Q9HB90|RRAGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4158.2	55.20088	3	2480.0836	2480.0779	M	D	2	25
PSM	RRNSCNVGGGGGGFK	22	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2378.2	17.48827	3	1601.687171	1601.688223	K	H	149	164
PSM	KASGPPVSELITK	23	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2953.4	31.68885	2	1405.719047	1405.721798	R	A	34	47
PSM	HQGVMVGMGQKDSYVGDEAQSK	24	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2612.3	23.0832	4	2446.024894	2446.029426	R	R	42	64
PSM	TMQGEGPQLLLSEAVSR	25	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3953.2	52.86255	3	1894.890071	1894.885979	K	A	1053	1070
PSM	DNLTLWTSENQGDEGDAGEGEN	26	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3474.5	44.82735	3	2349.951071	2349.946922	R	-	225	247
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	27	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4096.2	54.55957	4	3099.472894	3099.462419	R	R	174	201
PSM	KAEAGAGSATEFQFR	28	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2887.3	30.00868	3	1648.720871	1648.724651	K	G	150	165
PSM	KASGPPVSELITK	29	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2944.4	31.46612	2	1405.719047	1405.721798	R	A	34	47
PSM	GASQAGMTGYGMPR	30	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2960.3	31.86335	2	1462.568647	1462.573436	R	Q	183	197
PSM	KGSYNPVTHIYTAQDVK	31	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2909.5	30.57177	3	1999.935071	1999.940458	R	E	224	241
PSM	SCVEEPEPEPEAAEGDGDK	32	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2688.4	25.01102	3	2123.784971	2123.787841	K	K	107	126
PSM	AASAATAAPTATPAAQESGTIPK	33	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2830.6	28.5619	3	2162.019971	2162.025644	R	K	63	86
PSM	AITGASLADIMAK	34	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3825.2	51.09105	2	1420.608647	1420.607435	R	R	81	94
PSM	NVSSFPDDATSPLQENR	35	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3246.5	39.14287	3	1955.829071	1955.826216	R	N	52	69
PSM	NVSSFPDDATSPLQENR	36	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3238.5	38.93587	3	1955.829071	1955.826216	R	N	52	69
PSM	SLSQPTPPPMPILSQSEAK	37	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3554.2	46.68775	3	2087.001671	2087.001009	K	N	6967	6986
PSM	QASTDAGTAGALTPQHVR	38	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.2873.4	29.65487	3	1842.8203	1842.8256	R	A	107	125
PSM	SVAGGEIRGDTGGEDTAAPGR	39	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.2825.5	28.43008	3	2093.8949	2093.9010	M	F	2	23
PSM	NYGSYSTQASAAAATAELLK	40	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3707.2	49.16033	3	2095.949771	2095.946331	K	K	82	102
PSM	SAETRESTQLSPADLTEGKPTDPSK	41	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2879.2	29.80248	4	2724.242894	2724.249115	K	L	446	471
PSM	KCSLPAEEDSVLEK	42	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2891.2	30.1086	3	1683.740171	1683.742669	K	L	634	648
PSM	SLTPAVPVESKPDKPSGK	43	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2706.2	25.4638	3	1915.963571	1915.965610	K	S	133	151
PSM	GGNFGGRSSGPYGGGGQYFAK	44	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2934.3	31.2073	3	2099.883671	2099.885068	K	P	278	299
PSM	DASLMVTNDGATILK	45	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	44.14543	2	1627.754847	1627.752840	R	N	58	73
PSM	SIYGEKFEDENFILK	46	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3549.2	46.56532	3	1910.871971	1910.870312	K	H	77	92
PSM	KTSDFNTFLAQEGCTK	47	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3166.2	37.08793	3	1925.821571	1925.823045	R	G	198	214
PSM	SLSELESLKLPAESNEK	48	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3539.2	46.33715	3	1952.939471	1952.934369	R	I	238	255
PSM	KTSLFEEDEEDDLFAIAK	49	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3867.2	51.7556	3	2178.968471	2178.960978	K	D	661	679
PSM	DNLTLWTSDMQGDGEEQNK	50	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3438.3	43.96587	3	2179.937171	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	51	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3495.5	45.33783	3	2192.877371	2192.873028	R	-	228	248
PSM	SVAEGLSGSLVQEPFQLATEK	52	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4229.2	55.8231	3	2269.089971	2269.087910	K	R	646	667
PSM	RASQGLLSSIENSESDSSEAK	53	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3197.6	37.88593	3	2274.002771	2274.001280	R	E	1540	1561
PSM	GVVDSEDLPLNISR	54	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3335.2	41.40703	2	1512.775447	1512.778387	R	E	387	401
PSM	ADQLTEEQIAEFK	55	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3557.2	46.76387	2	1562.7447	1562.7459	M	E	2	15
PSM	TPEELDDSDFETEDFDVR	56	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3616.6	47.95662	3	2237.851571	2237.852550	R	S	634	652
PSM	KNSSQDDLFPTSDTPR	57	sp|Q9H6T3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2937.3	31.28513	3	1886.803271	1886.804752	K	A	478	494
PSM	KLSVPTSDEEDEVPAPKPR	58	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2871.4	29.60303	4	2173.030894	2173.030395	K	G	103	122
PSM	SCVEEPEPEPEAAEGDGDKK	59	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2587.6	22.4491	3	2251.877471	2251.882804	K	G	107	127
PSM	HQGVMVGMGQKDSYVGDEAQSK	60	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2621.3	23.30358	4	2446.024894	2446.029426	R	R	42	64
PSM	HQGVMVGMGQKDSYVGDEAQSK	61	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2546.4	21.42907	4	2462.023694	2462.024341	R	R	42	64
PSM	HQGVMVGMGQKDSYVGDEAQSK	62	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2538.4	21.2299	4	2462.023694	2462.024341	R	R	42	64
PSM	KASSSDSEDSSEEEEEVQGPPAK	63	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2517.5	20.77227	3	2500.991771	2500.996648	K	K	81	104
PSM	SRPNASGGAACSGPGPEPAVFCEPVVK	64	sp|Q6L8Q7|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21,11-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3163.3	37.00577	4	2777.235694	2777.230251	K	L	98	125
PSM	GYSFSLTTFSPSGK	65	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3831.2	51.18602	2	1557.677647	1557.675241	R	L	5	19
PSM	GADFLVTEVENGGSLGSK	66	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3615.2	47.93112	3	1858.836671	1858.834990	K	K	189	207
PSM	IRESIQEDLAEEAPCLQGGR	67	sp|O15357|SHIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3337.3	41.465	3	2350.065071	2350.062440	R	A	1173	1193
PSM	HGSGADSDYENTQSGDPLLGLEGK	68	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3308.2	40.7269	3	2526.054671	2526.054772	R	R	590	614
PSM	ALRTDYNASVSVPDSSGPER	69	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2895.2	30.20713	4	2199.979694	2199.979756	K	I	67	87
PSM	RGSNTTSHLHQAVAK	70	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2361.2	17.1005	4	1685.798894	1685.799882	K	A	301	316
PSM	AQALRDNSTMGYMMAK	71	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2969.4	32.09352	3	1866.784871	1866.782776	K	K	481	497
PSM	SLTPAVPVESKPDKPSGK	72	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2698.5	25.27182	3	1915.963571	1915.965610	K	S	133	151
PSM	SVSSFPVPQDNVDTHPGSGK	73	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2997.5	32.81565	3	2133.933371	2133.936829	R	E	287	307
PSM	AITGASLADIMAK	74	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3570.2	47.05767	2	1340.643247	1340.641104	R	R	81	94
PSM	TLSNAEDYLDDEDSD	75	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	46.94212	2	1780.620847	1780.620031	R	-	200	215
PSM	NPSTVEAFDLAQSNSEHSR	76	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3072.6	34.71601	3	2167.917671	2167.917156	R	H	213	232
PSM	RGTGQSDDSDIWDDTALIK	77	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3504.3	45.55748	3	2171.940971	2171.937223	R	A	23	42
PSM	DNLTLWTSDQQDDDGGEGNN	78	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3514.4	45.76385	3	2192.876471	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	79	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3477.3	44.89252	3	2192.877371	2192.873028	R	-	228	248
PSM	VHNDAQSFDYDHDAFLGAEEAK	80	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	37.17628	4	2558.046494	2558.038728	K	T	38	60
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	81	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3237.2	38.90322	4	2861.128894	2861.124466	R	L	22	47
PSM	SSIGTGYDLSASTFSPDGR	82	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3983.2	53.24085	3	2038.8587	2038.8516	M	V	2	21
PSM	SVPAFIDISEEDQAAELR	83	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5427.2	65.04967	3	2110.9535	2110.9455	M	A	2	20
PSM	ASQSQGIQQLLQAEK	84	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4032.2	53.7602	3	1749.8350	1749.8293	M	R	2	17
PSM	SRINSSGESGDESDEFLQSRK	85	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2737.4	26.25725	4	2407.034494	2407.028891	R	G	178	199
PSM	AQALRDNSTMGYMAAK	86	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2613.3	23.1078	3	1822.772171	1822.774321	K	K	616	632
PSM	KNSVVEASEAAYK	87	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2628.3	23.481	2	1474.666647	1474.670490	K	E	143	156
PSM	KQSGYGGQTKPIFR	88	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2622.5	23.33592	3	1645.794671	1645.797756	R	K	44	58
PSM	AQALRDNSTMGYMMAK	89	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2755.3	26.70777	3	1882.776671	1882.777691	K	K	481	497
PSM	SDSRAQAVSEDAGGNEGR	90	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2412.3	18.28862	3	1884.760571	1884.759927	R	A	117	135
PSM	SRDSLAPGPEPQDEDQK	91	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2533.3	21.10085	3	1947.819671	1947.821130	K	D	1229	1246
PSM	SGSSQELDVKPSASPQER	92	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2619.2	23.25425	3	1980.873371	1980.878980	R	S	1539	1557
PSM	SRTSVQTEDDQLIAGQSAR	93	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2770.5	27.10327	3	2140.970771	2140.975005	R	A	652	671
PSM	KFSAHYDAVEAELK	94	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3017.2	33.31662	3	1686.764171	1686.765453	K	S	48	62
PSM	TLTIVDTGIGMTK	95	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3630.2	48.1632	2	1428.692447	1428.693534	R	A	28	41
PSM	IRYESLTDPSKLDSGK	96	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3046.3	34.04508	3	1887.900071	1887.897924	K	E	54	70
PSM	TMQGEGPQLLLSEAVSR	97	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3802.2	50.62898	3	1910.885171	1910.880894	K	A	1053	1070
PSM	DATNVGDEGGFAPNILENK	98	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3401.3	43.04232	3	1959.923471	1959.917400	K	E	203	222
PSM	SLGYAYVNFQQPADAER	99	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3480.2	44.96088	3	2007.883271	2007.872772	R	A	51	68
PSM	SLSQPTPPPMPILSQSEAK	100	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3562.3	46.8913	3	2087.001671	2087.001009	K	N	6967	6986
PSM	SSILLDVKPWDDETDMAK	101	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3720.2	49.39617	3	2141.960471	2141.959204	K	L	140	158
PSM	GDRSEDFGVNEDLADSDAR	102	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3028.5	33.60943	3	2146.840871	2146.844051	K	A	186	205
PSM	GRLGSVDSFERSNSLASEK	103	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2965.3	31.9919	4	2197.939694	2197.940608	R	D	584	603
PSM	DSGRGDSVSDSGSDALR	104	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2503.3	20.4008	3	1759.699271	1759.701015	R	S	70	87
PSM	RLSQIGVENTEENRR	105	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2658.6	24.2543	3	1879.888271	1879.890153	K	L	43	58
PSM	RAPSVANVGSHCDLSLK	106	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2821.4	28.32702	3	1889.876171	1889.881897	R	I	2149	2166
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	107	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2573.2	22.11745	4	2739.152094	2739.163428	R	A	17	51
PSM	GASQAGMTGYGMPR	108	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2951.3	31.63667	2	1462.568647	1462.573436	R	Q	183	197
PSM	SQSMDIDGVSCEK	109	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2811.4	28.07558	2	1534.567047	1534.568076	R	S	103	116
PSM	AASIFGGAKPVDTAAR	110	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2944.2	31.45945	3	1610.781071	1610.781772	R	E	357	373
PSM	RLSSSSATLLNSPDR	111	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2847.4	28.99383	3	1682.796071	1682.798879	K	A	198	213
PSM	GVSLTNHHFYDESK	112	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2810.3	28.04815	3	1712.722871	1712.719566	R	P	22	36
PSM	VRQASVADYEETVKK	113	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2653.5	24.12158	3	1801.859471	1801.861145	R	A	80	95
PSM	KQQSIAGSADSKPIDVSR	114	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2585.6	22.3977	3	1965.947771	1965.952085	K	L	137	155
PSM	SLAGSSGPGASSGTSGDHGELVVR	115	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2812.6	28.10653	3	2264.007071	2264.007034	K	I	60	84
PSM	KPTDGASSSNCVTDISHLVR	116	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3085.4	35.0408	4	2223.001294	2222.999112	R	K	698	718
PSM	IYGLGSLALYEK	117	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3952.2	52.83827	2	1405.689447	1405.689435	R	A	68	80
PSM	ALSRQLSSGVSEIR	118	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3051.2	34.16532	3	1661.757971	1661.753917	R	H	76	90
PSM	ANSGGVDLDSSGEFASIEK	119	sp|Q92766|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3363.5	42.1213	3	1961.829971	1961.825547	R	M	1165	1184
PSM	SQSLPNSLDYTQTSDPGR	120	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3084.5	35.01814	3	2044.874471	2044.873894	R	H	44	62
PSM	DNLTLWTSDQQDDDGGEGNN	121	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3486.2	45.10743	3	2192.877371	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	122	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	47.73046	3	2237.851571	2237.852550	R	S	634	652
PSM	SGDEMIFDPTMSK	123	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4055.2	54.09381	2	1579.5982	1578.5982	M	K	2	15
PSM	HQGVMVGMGQKDSYVGDEAQSK	124	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2796.3	27.74683	4	2430.033694	2430.034511	R	R	42	64
PSM	EKKSLDSDESEDEEDDYQQK	125	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2460.2	19.36253	4	2495.972494	2495.970099	K	R	54	74
PSM	SKGPSAGEQEPDKESGASVDEVAR	126	sp|P50579-2|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2556.6	21.69173	4	2509.089694	2509.096971	K	Q	45	69
PSM	GDRSEDFGVNEDLADSDAR	127	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2943.3	31.43803	3	2066.879471	2066.877720	K	A	186	205
PSM	SIADSEESEAYK	128	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2612.5	23.08987	2	1407.540047	1407.544287	R	S	268	280
PSM	PCSEETPAISPSK	129	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2569.5	22.01733	2	1481.6059	1481.6104	M	R	2	15
PSM	KHTLSYVDVGTGK	130	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2683.2	24.87663	3	1483.707071	1483.707210	R	V	624	637
PSM	RVSISEGDDKIEYR	131	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2769.3	27.07065	3	1745.797871	1745.798544	K	A	122	136
PSM	AQALRDNSTMGYMMAK	132	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2793.5	27.67642	3	1882.778771	1882.777691	K	K	481	497
PSM	SASQSSLDKLDQELK	133	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.3	36.02743	3	1727.796671	1727.797876	R	E	728	743
PSM	RSSAIGIENIQEVQEK	134	sp|P47736|RPGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	33.6253	3	1879.902071	1879.904072	R	R	497	513
PSM	AFSDPFVEAEK	135	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	43.63187	2	1318.550447	1318.548250	R	S	74	85
PSM	AITGASLADIMAK	136	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3561.2	46.85262	2	1340.643247	1340.641104	R	R	81	94
PSM	FASENDLPEWK	137	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	42.67311	2	1414.583447	1414.580613	R	E	58	69
PSM	STGGAPTFNVTVTK	138	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3090.3	35.167	2	1458.675047	1458.675576	K	T	92	106
PSM	TNSMQQLEQWIK	139	sp|Q9HAU0|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3839.2	51.34932	2	1584.700847	1584.700745	R	I	408	420
PSM	KQSLGELIGTLNAAK	140	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3521.2	45.92102	3	1621.845371	1621.844038	R	V	56	71
PSM	DASLMVTNDGATILK	141	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3454.3	44.35047	3	1627.756271	1627.752840	R	N	58	73
PSM	DGKYSQVLANGLDNK	142	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3071.5	34.68657	3	1700.779271	1700.777081	K	L	92	107
PSM	DRSSFYVNGLTLGGQK	143	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3330.6	41.29588	2	1820.848447	1820.845829	K	C	55	71
PSM	SQIFSTASDNQPTVTIK	144	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3215.2	38.33963	3	1915.894271	1915.892839	K	V	448	465
PSM	CASCPYLGMPAFKPGEK	145	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3294.3	40.36128	3	1991.836871	1991.834478	R	V	285	302
PSM	INSSGESGDESDEFLQSR	146	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3029.3	33.62863	3	2035.801571	2035.800789	R	K	180	198
PSM	RLSEDYGVLKTDEGIAYR	147	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3178.4	37.3859	3	2164.023071	2164.020165	R	G	110	128
PSM	DSGSDEDFLMEDDDDSDYGSSK	148	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3289.5	40.23878	3	2427.867971	2427.865619	K	K	129	151
PSM	DDDIAALVVDNGSGMCK	149	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4052.2	54.0191	3	1916.7554	1916.7528	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	150	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4467.2	58.06792	3	1900.7621	1900.7579	M	A	2	19
PSM	HQGVMVGMGQKDSYVGDEAQSK	151	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2775.3	27.22653	4	2446.027694	2446.029426	R	R	42	64
PSM	ADQLTEEQIAEFK	152	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3558.2	46.78948	3	1562.7482	1562.7459	M	E	2	15
PSM	RKASGPPVSELITK	153	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2783.2	27.41613	3	1561.822271	1561.822909	K	A	34	48
PSM	SVELEEALPVTTAEGMAK	154	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4666.2	59.60958	3	1995.9188	1995.9107	M	K	2	20
PSM	STRESFNPESYELDK	155	sp|P49903|SPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3287.4	40.18393	3	1922.8004	1922.7930	M	S	2	17
PSM	SLGPSLATDKS	156	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2810.4	28.05148	2	1154.521647	1154.522035	R	-	270	281
PSM	VSYRASQPDLVDTPTSSKPQPK	157	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2752.5	26.63718	4	2480.188494	2480.194835	K	R	1735	1757
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	158	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2637.2	23.70483	4	2512.020094	2512.025203	R	A	19	51
PSM	KRSVAVSDEEEVEEEAER	159	sp|Q9Y6X9|MORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2759.6	26.82108	3	2169.938471	2169.942702	R	R	737	755
PSM	GASQAGMTGYGMPR	160	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.2739.5	26.31228	2	1478.564247	1478.568351	R	Q	183	197
PSM	SGSSSPDSEITELK	161	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2982.5	32.42787	2	1515.630447	1515.634164	R	F	571	585
PSM	LQRYSLSGGGTSSH	162	sp|Q9Y6E0|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2608.3	22.97925	3	1528.665371	1528.667136	R	-	430	444
PSM	RPSESDKEDELDK	163	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2374.3	17.38833	3	1626.676871	1626.677426	R	V	625	638
PSM	VRQASVADYEETVK	164	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2752.4	26.63385	3	1673.765471	1673.766182	R	K	80	94
PSM	LIAPVAEEEATVPNNK	165	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2980.3	32.3696	3	1693.887671	1693.888666	K	I	8	24
PSM	AEPAKIEAFRASLSK	166	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2856.2	29.21165	3	1696.850471	1696.854937	K	L	142	157
PSM	SKNEEKEEDDAENYR	167	sp|Q8WVM0|TFB1M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2427.6	18.57225	3	1934.750771	1934.753110	K	L	331	346
PSM	RSLSEQPVMDTATATEQAK	168	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2844.5	28.91957	3	2141.961971	2141.966414	K	Q	48	67
PSM	KATLELTHNWGTEDDETQSYHNGNSDPR	169	sp|Q04760|LGUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2957.4	31.78952	5	3294.382118	3294.385108	R	G	96	124
PSM	AHSIQIMKVEEIAASK	170	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	37.22432	4	1833.909294	1833.905986	R	C	121	137
PSM	NPSTVEAFDLAQSNSEHSR	171	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3072.2	34.70268	4	2167.918894	2167.917156	R	H	213	232
PSM	RDSFDDRGPSLNPVLDYDHGSR	172	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3141.4	36.45995	4	2597.131294	2597.129609	R	S	186	208
PSM	KITIADCGQLE	173	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3035.3	33.7779	2	1326.587447	1326.589069	K	-	155	166
PSM	SLYESFVSSSDR	174	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3293.5	40.34192	2	1455.593647	1455.591906	K	L	131	143
PSM	QAGSLASLSDAPPLK	175	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3255.4	39.36815	2	1533.741847	1533.743990	K	S	276	291
PSM	DGSLASNPYSGDLTK	176	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3078.5	34.86388	2	1603.675447	1603.676698	R	F	850	865
PSM	ALTVPELTQQVFDAK	177	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4133.2	54.94625	3	1738.860071	1738.854268	R	N	283	298
PSM	SNSELEDEILCLEK	178	sp|Q8IX94|CTGE4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.4082.2	54.39665	3	1757.748671	1757.743063	R	D	138	152
PSM	INPDGSQSVVEVPYAR	179	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3198.2	37.89874	3	1809.831371	1809.829845	R	S	58	74
PSM	SYELPDGQVITIGNER	180	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3730.2	49.53865	3	1869.855071	1869.850974	K	F	241	257
PSM	TMQGEGPQLLLSEAVSR	181	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3788.2	50.40793	3	1910.885171	1910.880894	K	A	1053	1070
PSM	MASNIFGPTEEPQNIPK	182	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	44.91313	3	1951.875971	1951.875080	R	R	43	60
PSM	KHSQFIGYPITLFVEK	183	sp|Q58FG0|HS905_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3786.2	50.3677	3	1986.005771	1986.001601	K	K	39	55
PSM	NQSQGYNQWQQGQFWGQK	184	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3448.3	44.21513	3	2290.960271	2290.954545	K	P	797	815
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	185	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3420.6	43.52105	4	3081.282094	3081.278791	K	E	160	186
PSM	RKASGPPVSELITK	186	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2792.2	27.64047	3	1561.822271	1561.822909	K	A	34	48
PSM	QVQSLTCEVDALK	187	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4123.2	54.8446	2	1552.6849	1552.6839	R	G	322	335
PSM	SLAALSQIAYQR	188	sp|Q05682-3|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	45.06956	2	1399.686647	1399.686081	R	N	12	24
PSM	DHASIQMNVAEVDK	189	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2940.3	31.36288	3	1635.699371	1635.696387	K	V	28	42
PSM	KISSDLDGHPVPK	190	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2618.2	23.22668	3	1471.704071	1471.707210	R	Q	102	115
PSM	RLTVSSLQESGLK	191	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2998.2	32.83163	3	1496.758871	1496.759974	R	V	2334	2347
PSM	KGSITEYTAAEEK	192	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2621.5	23.31025	2	1505.660647	1505.665071	R	E	112	125
PSM	RNSLTGEEGQLAR	193	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2652.4	24.0923	3	1509.691871	1509.693685	R	V	110	123
PSM	NRVIGSGCNLDSAR	194	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2548.5	21.48323	3	1517.733671	1517.736873	K	F	156	170
PSM	EAELSKGESVCLDR	195	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2740.3	26.33122	3	1671.716471	1671.717517	K	C	40	54
PSM	RASSDLSIASSEEDK	196	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2788.2	27.53937	3	1753.680671	1753.680871	K	L	338	353
PSM	HASSGSFLPSANEHLK	197	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2838.5	28.7646	3	1760.786771	1760.788314	R	E	115	131
PSM	SPSKPLPEVTDEYKNDVK	198	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2907.2	30.51015	4	2124.996494	2124.998032	R	N	92	110
PSM	SRINSSGESGDESDEFLQSR	199	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2882.5	29.88673	3	2278.928171	2278.933928	R	K	178	198
PSM	RNTTQNTGYSSGTQNANYPVR	200	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2603.6	22.86105	3	2408.046671	2408.050630	R	A	933	954
PSM	RSSDSWEVWGSASTNR	201	sp|Q8N6T3|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	37.56388	3	1903.789871	1903.785020	R	N	359	375
PSM	DSPSVWAAVPGK	202	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3218.5	38.42722	2	1292.579847	1292.580219	K	T	27	39
PSM	SFDASDTLALPR	203	sp|Q5JXC2|MIIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3432.3	43.81413	2	1371.606847	1371.607162	K	H	303	315
PSM	SLPVPGALEQVASR	204	sp|O95785-3|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	47.71867	3	1502.748971	1502.749409	K	L	12	26
PSM	SRQPSGAGLCDISEGTVVPEDR	205	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3106.5	35.58358	3	2409.064271	2409.063169	K	C	688	710
PSM	KQSLGELIGTLNAAK	206	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3512.2	45.7037	3	1621.845371	1621.844038	R	V	56	71
PSM	FASENDLPEWKER	207	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	36.45329	3	1699.728071	1699.724317	R	G	58	71
PSM	SLGDDISSETSGDFRK	208	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3023.2	33.46992	3	1792.750571	1792.751654	K	A	139	155
PSM	QFASQANVVGPWIQTK	209	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3725.2	49.46755	3	1852.890071	1852.887300	R	M	653	669
PSM	SLSTSGESLYHVLGLDK	210	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4159.2	55.2257	3	1884.892871	1884.887025	R	N	8	25
PSM	GFSEGLWEIENNPTVK	211	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4157.2	55.17577	3	1898.852171	1898.845160	K	A	81	97
PSM	SDSSSKKDVIELTDDSFDK	212	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3136.4	36.33109	3	2194.951271	2194.951870	R	N	154	173
PSM	DNLTLWTSENQGDEGDAGEGEN	213	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3492.2	45.26317	3	2349.951071	2349.946922	R	-	225	247
PSM	TLNDRSSIVMGEPISQSSSNSQ	214	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3098.3	35.37735	3	2416.058771	2416.057749	R	-	762	784
PSM	NVNIYRDSAIPVESDTDDEGAPR	215	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3127.2	36.09727	4	2612.144494	2612.139170	K	I	455	478
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	216	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3145.6	36.56845	4	3431.358494	3431.356309	R	E	62	93
PSM	ASGVAVSDGVIK	217	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3254.3	39.33908	2	1223.5800	1223.5794	M	V	2	14
PSM	SISSDEVNFLVYR	218	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5080.2	62.64847	2	1649.7351	1649.7333	M	Y	2	15
PSM	STDTGVSLPSYEEDQGSK	219	sp|Q9Y241|HIG1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3286.4	40.15807	3	2020.8163	2020.8145	M	L	2	20
PSM	SRSYNDELQFLEK	220	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3599.2	47.6179	3	1749.7634	1749.7606	M	I	2	15
PSM	SGEGEVSGLMR	221	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2940.4	31.36622	2	1200.483047	1200.484604	R	K	473	484
PSM	NAMGSLASQATK	222	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2831.4	28.58085	2	1257.538847	1257.542453	R	D	354	366
PSM	SSSEDAESLAPR	223	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2677.2	24.72755	2	1327.525647	1327.529305	R	S	298	310
PSM	QRSASQSSLDKLDQELK	224	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2949.4	31.5917	3	2011.959971	2011.957564	K	E	726	743
PSM	RMSLIEEEGSK	225	sp|P06737|PYGL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2756.2	26.73012	2	1357.591447	1357.594882	R	R	428	439
PSM	SYSRQSSSSDTDLSLTPK	226	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2795.5	27.72808	3	2037.888671	2037.889210	K	T	299	317
PSM	HTGCCGDNDPIDVCEIGSK	227	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2875.4	29.70643	3	2132.853371	2132.856139	K	V	110	129
PSM	FARRSVSDNDIR	228	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2482.2	19.89572	3	1514.700371	1514.699105	R	K	742	754
PSM	SAADSISESVPVGPK	229	sp|P45974|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2990.6	32.63778	2	1522.687647	1522.691620	R	V	779	794
PSM	AHSSMVGVNLPQK	230	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2920.5	30.8557	2	1526.628847	1526.635381	R	A	172	185
PSM	ALSRQLSSGVSEIR	231	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2972.2	32.1607	3	1581.787571	1581.787586	R	H	76	90
PSM	SQRYESLKGVDPK	232	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2581.2	22.28127	4	1585.748494	1585.750138	R	F	26	39
PSM	NRVIGSGCNLDSAR	233	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2652.6	24.09897	3	1597.704071	1597.703204	K	F	156	170
PSM	HSSLAGCQIINYR	234	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2969.2	32.08685	3	1597.705271	1597.707227	R	T	145	158
PSM	GASWIDTADGSANHR	235	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2921.2	30.87158	3	1636.658171	1636.663113	R	A	254	269
PSM	SRKESYSVYVYK	236	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2825.4	28.42675	3	1667.696771	1667.699756	R	V	33	45
PSM	KTSASDVTNIYPGDAGK	237	sp|Q15042|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2819.3	28.2725	3	1802.808671	1802.808775	K	A	535	552
PSM	PGPTPSGTNVGSSGRSPSK	238	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2409.2	18.21368	3	1848.8369	1848.8362	M	A	2	21
PSM	ENPRNFSDNQLQEGK	239	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2639.3	23.75807	3	1854.785771	1854.789771	K	N	157	172
PSM	KQSFDDNDSEELEDK	240	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2646.5	23.94073	3	1877.718071	1877.720413	K	D	105	120
PSM	RFSEGVLQSPSQDQEK	241	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2854.4	29.16917	3	1913.850071	1913.852037	R	L	427	443
PSM	DDDGSSARGSFSGQAQPLR	242	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2698.6	25.27515	3	2029.848071	2029.849076	K	T	721	740
PSM	YAKESLKEEDESDDDNM	243	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2615.6	23.16703	3	2096.768471	2096.776942	K	-	239	256
PSM	LGPKSSVLIAQQTDTSDPEK	244	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2919.3	30.82327	3	2193.051371	2193.056610	R	V	449	469
PSM	RDSSESQLASTESDKPTTGR	245	sp|Q96B23|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2474.4	19.70558	4	2230.971694	2230.970314	R	V	64	84
PSM	GSSIFGLAPGK	246	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3336.2	41.44097	2	1112.525447	1112.526726	R	A	393	404
PSM	DRFSAEDEALSNIAR	247	sp|Q9Y608|LRRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3341.2	41.5488	3	1772.781071	1772.773058	K	E	15	30
PSM	SADTLWGIQK	248	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3304.2	40.61427	2	1197.543447	1197.543105	K	E	319	329
PSM	SINQPVAFVR	249	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3163.2	37.00243	2	1209.592847	1209.590724	R	R	15	25
PSM	SADTLWDIQK	250	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3379.3	42.52587	2	1255.549247	1255.548584	K	D	320	330
PSM	SADTLWDIQK	251	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3371.2	42.32033	2	1255.549247	1255.548584	K	D	320	330
PSM	SLEDQVEMLR	252	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3334.3	41.38647	2	1298.558047	1298.557769	K	T	168	178
PSM	SLEDQVEMLR	253	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	41.59845	2	1298.558047	1298.557769	K	T	168	178
PSM	SADTLWDIQK	254	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3594.3	47.491	2	1335.513447	1335.514915	K	D	320	330
PSM	AITGASLADIMAK	255	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3160.4	36.93687	2	1356.632847	1356.636019	R	R	81	94
PSM	RPSTSQTVSTPAPVPVIESTEAIEAK	256	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3378.5	42.50702	4	2774.379294	2774.373921	K	A	644	670
PSM	SLDMDSIIAEVK	257	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4339.2	57.01173	2	1399.633447	1399.630599	R	A	253	265
PSM	DGAGNSFDLSSLSR	258	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3437.3	43.94036	2	1504.620047	1504.619517	K	Y	1373	1387
PSM	DGAGNSFDLSSLSR	259	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3445.2	44.13543	2	1504.620047	1504.619517	K	Y	1373	1387
PSM	SLGEIPIVESEIKK	260	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3458.4	44.41648	3	1620.839471	1620.837556	R	E	482	496
PSM	TMSEVGGSVEDLIAK	261	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	43.1764	2	1630.716847	1630.716120	R	G	35	50
PSM	SLSSPTVTLSAPLEGAK	262	sp|Q96PU5|NED4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3451.2	44.28022	3	1736.862671	1736.859748	R	D	446	463
PSM	SESVPPVTDWAWYK	263	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4028.2	53.69832	3	1743.760271	1743.754554	K	I	244	258
PSM	CIPALDSLTPANEDQK	264	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3342.3	41.5768	3	1850.816771	1850.812146	R	I	447	463
PSM	TKFGSTADALVSDDETTR	265	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3073.5	34.73848	3	1992.869771	1992.867746	K	L	277	295
PSM	KHSQFIGYPITLYLEK	266	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3667.2	48.59818	3	2016.014171	2016.012166	K	E	183	199
PSM	RGTGQSDDSDIWDDTALIK	267	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3496.5	45.35992	3	2171.940971	2171.937223	R	A	23	42
PSM	RISHSLYSGIEGLDESPSR	268	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3152.5	36.74437	3	2182.008371	2182.005577	R	N	713	732
PSM	DNLTLWTSDQQDDDGGEGNN	269	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3503.4	45.53553	3	2192.876471	2192.873028	R	-	228	248
PSM	RSSSAEESGQDVLENTFSQK	270	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3178.5	37.38923	3	2277.979271	2277.975065	K	H	536	556
PSM	NQSQGYNQWQQGQFWGQK	271	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3440.3	44.0171	3	2290.960271	2290.954545	K	P	797	815
PSM	SGSSSPDSEITELKFPSINHD	272	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3604.4	47.7438	3	2325.999371	2326.000217	R	-	571	592
PSM	DNLTLWTSDTQGDEAEAGEGGEN	273	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3555.3	46.70623	3	2407.989071	2407.988786	R	-	223	246
PSM	SRQPSGAGLCDISEGTVVPEDR	274	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3252.5	39.29505	3	2489.029571	2489.029500	K	C	688	710
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	275	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3389.5	42.78045	3	3014.195171	3014.188484	K	-	661	690
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	276	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3411.2	43.28503	4	3081.282094	3081.278791	K	E	160	186
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	277	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3137.6	36.36365	4	3431.358494	3431.356309	R	E	62	93
PSM	HQGVMVGMGQKDSYVGDEAQSK	278	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2780.4	27.35047	3	2462.021471	2462.024341	R	R	42	64
PSM	ASGVAVSDGVIK	279	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3409.2	43.2494	2	1303.5473	1303.5457	M	V	2	14
PSM	ADEAPRKGSFSALVGR	280	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3050.5	34.15048	3	1781.8459	1781.8456	M	T	2	18
PSM	SLYPSLEDLKVDK	281	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	51.5866	2	1627.7801	1627.7741	M	V	2	15
PSM	RLSSLRASTSK	282	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2569.2	22.00733	3	1364.619971	1364.621446	R	S	233	244
PSM	NDSVIVADQTPTPTR	283	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2835.2	28.67738	3	1692.767171	1692.771995	R	F	60	75
PSM	SQGMALSLGDK	284	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2729.3	26.04813	2	1201.502447	1201.505005	K	I	933	944
PSM	VSSKNSLESYAFNMK	285	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2948.4	31.56645	3	1799.777171	1799.780118	K	A	536	551
PSM	HQGVMVGMGQKDSYVGDEAQSK	286	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:35,8-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.2774.5	27.20715	4	2462.023294	2462.024341	R	R	42	64
PSM	RSSQPSPTAVPASDSPPTKQEVK	287	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2565.4	21.91153	4	2473.178494	2473.184998	R	K	111	134
PSM	AKSTCSCPDLQPNGQDLGENSR	288	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2745.2	26.4542	4	2513.027694	2513.031217	K	V	56	78
PSM	SGSYSYLEER	289	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2902.5	30.39108	2	1269.487847	1269.491463	R	K	908	918
PSM	SMGLPTSDEQK	290	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2755.4	26.7111	2	1271.508047	1271.510484	K	K	298	309
PSM	RVSVCAETYNPDEEEEDTDPR	291	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2860.4	29.32087	4	2590.013694	2590.016672	R	V	97	118
PSM	VIGSGCNLDSAR	292	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2702.5	25.375	2	1327.556047	1327.559166	R	F	158	170
PSM	KASGPPVSELITK	293	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2936.4	31.26263	2	1405.719047	1405.721798	R	A	34	47
PSM	QRSLGPSLATDKS	294	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2647.3	23.96003	3	1438.677071	1438.681724	R	-	268	281
PSM	GASQAGMTGYGMPR	295	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.2731.5	26.10563	2	1478.564247	1478.568351	R	Q	183	197
PSM	SPSKPLPEVTDEYK	296	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2910.2	30.58763	3	1668.761171	1668.764785	R	N	92	106
PSM	AQALRDNSTMGYMAAK	297	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2600.4	22.7769	3	1822.773071	1822.774321	K	K	616	632
PSM	QLEDGRTLSDYNIQK	298	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2938.5	31.31768	3	1858.846871	1858.846223	K	E	49	64
PSM	AQALRDNSTMGYMMAK	299	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.2587.5	22.44577	3	1898.770271	1898.772606	K	K	481	497
PSM	RFSEGVLQSPSQDQEK	300	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2846.5	28.97127	3	1913.850071	1913.852037	R	L	427	443
PSM	NGRYSISRTEAADLCK	301	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2741.5	26.36387	3	1919.855171	1919.856076	K	A	39	55
PSM	INSSGESGDESDEFLQSRK	302	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2821.5	28.33035	3	2163.890471	2163.895752	R	G	180	199
PSM	RTGSNISGASSDISLDEQYK	303	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2953.6	31.69552	3	2206.969571	2206.974337	K	H	376	396
PSM	SCVEEPEPEPEAAEGDGDKK	304	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2579.6	22.24395	3	2251.877471	2251.882804	K	G	107	127
PSM	GRMSMKEVDEQMLNVQNK	305	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3062.3	34.4468	4	2215.980494	2215.978910	R	N	319	337
PSM	SQGMALSLGDK	306	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3016.2	33.29215	2	1185.508247	1185.510090	K	I	933	944
PSM	SIYYITGESK	307	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3032.2	33.70173	2	1239.540847	1239.542436	K	E	258	268
PSM	SISLYYTGEK	308	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3121.2	35.94817	2	1239.542647	1239.542436	R	G	458	468
PSM	NGSVVAMTGDGVNDAVALK	309	sp|P98194|AT2C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3341.4	41.55547	3	1896.868871	1896.865244	K	A	635	654
PSM	SLSALAFSPDGK	310	sp|O43379|WDR62_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3417.2	43.43215	2	1271.581647	1271.579884	K	Y	113	125
PSM	NDSWGSFDLR	311	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3519.2	45.87258	2	1275.493447	1275.492132	R	A	650	660
PSM	LGSIAIQGAIEK	312	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3268.3	39.69565	2	1278.657247	1278.658469	K	A	67	79
PSM	RSTQGVTLTDLQEAEK	313	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3170.4	37.17962	3	1934.838971	1934.838769	R	T	694	710
PSM	RASSLNFLNK	314	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3196.5	37.85675	2	1308.564447	1308.562868	K	S	579	589
PSM	LGLMRDDTIYEDEDVK	315	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3214.4	38.3203	3	1990.862471	1990.859490	K	E	30	46
PSM	SADTLWDIQK	316	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	47.68355	2	1335.513447	1335.514915	K	D	320	330
PSM	SLSLGEVLDGDR	317	sp|O15321|TM9S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3812.2	50.8462	2	1339.603047	1339.602076	K	M	76	88
PSM	SFQGDDSDLLLK	318	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3377.5	42.48118	2	1416.619447	1416.617392	K	T	875	887
PSM	KISGTTALQEALK	319	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3085.2	35.03413	3	1438.742771	1438.743261	R	E	346	359
PSM	RASGQAFELILSPR	320	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3469.3	44.69677	3	1623.817271	1623.813407	K	S	14	28
PSM	NRPTSISWDGLDSGK	321	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3101.2	35.44845	3	1711.754771	1711.756680	K	L	48	63
PSM	DASDDLDDLNFFNQK	322	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4020.2	53.59052	3	1755.762371	1755.758774	K	K	65	80
PSM	RNSSEASSGDFLDLK	323	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3338.2	41.47581	3	1784.703071	1784.701941	R	G	85	100
PSM	VSSKNSLESYAFNMK	324	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3159.3	36.90943	3	1783.783571	1783.785203	K	A	536	551
PSM	NHSNAQFIESYVCR	325	sp|P41229|KDM5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3171.4	37.20507	3	1803.738071	1803.739984	R	M	315	329
PSM	KGSLLIDSSTIDPAVSK	326	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3267.3	39.67055	3	1809.916271	1809.912512	K	E	125	142
PSM	DRSSFYVNGLTLGGQK	327	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	41.50003	3	1820.850071	1820.845829	K	C	55	71
PSM	SCSLDLGDAGCYGYAR	328	sp|Q6PJG9|LRFN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4,3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3288.3	40.20968	3	1843.694471	1843.690651	R	R	583	599
PSM	QFASQANVVGPWIQTK	329	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3712.2	49.24818	3	1852.890071	1852.887300	R	M	653	669
PSM	SESLDPDSSMDTTLILK	330	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3696.2	49.01225	3	1930.851971	1930.848256	R	D	879	896
PSM	SNSEASVDSASMEDFWR	331	sp|Q9P2N2|RHG28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3763.3	50.04565	3	1996.755971	1996.751002	R	E	67	84
PSM	KHSQFIGYPITLYLEK	332	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3647.5	48.38488	3	2016.014171	2016.012166	K	E	183	199
PSM	SQSLPNSLDYTQTSDPGR	333	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3076.4	34.81042	3	2044.874471	2044.873894	R	H	44	62
PSM	RSYSSPDITQAIQEEEK	334	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3145.3	36.55845	3	2059.910171	2059.909945	K	R	715	732
PSM	TIGGGDDSFNTFFSETGAGK	335	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	51.15362	3	2086.856771	2086.852096	K	H	41	61
PSM	SLGNVIHPDVVVNGGQDQSK	336	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3185.4	37.56721	3	2142.016871	2142.010663	K	E	668	688
PSM	VSSQAEDTSSSFDNLFIDR	337	sp|Q9BZD3|GCOM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3934.2	52.46725	3	2196.926771	2196.921238	R	L	177	196
PSM	DYEEVGVDSVEGEGEEEGEEY	338	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3398.3	42.97972	3	2347.901771	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	339	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3483.2	45.03573	3	2349.951071	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	340	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3563.3	46.91668	3	2407.989071	2407.988786	R	-	223	246
PSM	RNSEGSELSCTEGSLTSSLDSR	341	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3181.6	37.4703	3	2451.026171	2451.022092	R	R	1667	1689
PSM	KQSFDDNDSEELEDKDSK	342	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2555.6	21.66567	3	2207.869271	2207.874348	K	S	105	123
PSM	VNQIGSVTESLQACK	343	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3131.2	36.1971	3	1712.776571	1712.780452	K	L	344	359
PSM	SLEDQVEMLR	344	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3167.3	37.10546	2	1314.550847	1314.552684	K	T	168	178
PSM	RKASGPPVSELITK	345	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2774.2	27.19715	3	1561.821671	1561.822909	K	A	34	48
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	346	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3345.2	41.66325	4	3442.4060	3442.4027	K	L	104	135
PSM	SLYPSLEDLKVDK	347	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3869.4	51.80553	2	1627.7801	1627.7741	M	V	2	15
PSM	CASCPYLGMPAFKPGEK	348	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3759.2	49.96258	3	1974.8110	1974.8074	R	V	285	302
PSM	QASQGMVGQLAAR	349	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	40.746	2	1378.6043	1378.6059	R	R	41	54
PSM	AEPAKIEAFRASLSK	350	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2860.2	29.3142	4	1696.856094	1696.854937	K	L	142	157
PSM	KLSDDNTIGKEEIQQR	351	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2652.3	24.08897	4	1952.922094	1952.920451	K	L	1829	1845
PSM	RGGSGSHNWGTVKDELTESPK	352	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2870.3	29.57395	4	2321.042494	2321.043754	K	Y	216	237
PSM	QASVTLQPLK	353	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2969.3	32.09018	2	1163.593847	1163.595140	R	I	251	261
PSM	RTNPPGGKGSGIFDESTPVQTR	354	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2816.3	28.19655	4	2380.117694	2380.117253	K	Q	60	82
PSM	NGSLDSPGKQDTEEDEEEDEKDK	355	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2424.2	18.48807	4	2673.042894	2673.045055	K	G	134	157
PSM	DNNQFASASLDR	356	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2782.6	27.40528	2	1336.597047	1336.600757	K	T	154	166
PSM	SLSSSLDDTEVK	357	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2933.4	31.18492	2	1359.587847	1359.580672	K	K	156	168
PSM	SVSLTGAPESVQK	358	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2822.5	28.35557	2	1381.647247	1381.649027	R	A	191	204
PSM	VTDSSVSVQLRE	359	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2858.6	29.276	2	1398.635247	1398.639190	R	-	264	276
PSM	EGLELPEDEEEK	360	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2930.5	31.11065	2	1415.627447	1415.630385	K	K	412	424
PSM	LYRPGSVAYVSR	361	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2841.2	28.8321	3	1446.699971	1446.702065	K	S	651	663
PSM	SGSMDPSGAHPSVR	362	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2481.2	19.86018	3	1463.586371	1463.586443	R	Q	18	32
PSM	KISSDLDGHPVPK	363	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2610.2	23.02783	3	1471.704071	1471.707210	R	Q	102	115
PSM	VRYSLDPENPTK	364	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2830.2	28.54857	3	1497.6838	1497.6859	M	S	2	14
PSM	VPSPLEGSEGDGDTD	365	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2973.5	32.1959	2	1553.574447	1553.577043	K	-	413	428
PSM	NGSEADIDEGLYSR	366	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2997.6	32.81898	2	1604.634247	1604.635561	K	Q	44	58
PSM	SGRSLGTADVHFER	367	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2754.2	26.67863	3	1610.719871	1610.720234	R	K	142	156
PSM	RSSDGSLSHEEDLAK	368	sp|Q13136|LIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2540.5	21.2851	3	1709.721371	1709.725773	K	V	237	252
PSM	AQALRDNSTMGYMAAK	369	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2785.3	27.46817	3	1806.783071	1806.779406	K	K	616	632
PSM	LGSLSARSDSEATISR	370	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2817.4	28.22518	3	1808.769671	1808.770689	R	S	1158	1174
PSM	HQGVMVGMGQKDSYVGDEAQSK	371	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.2683.5	24.88663	4	2446.028894	2446.029426	R	R	42	64
PSM	SPPREGSQGELTPANSQSR	372	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2483.5	19.92125	3	2076.920471	2076.922576	K	M	468	487
PSM	KSSEGGVGVGPGGGDEPPTSPR	373	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2628.2	23.47767	3	2102.922671	2102.926992	R	Q	1184	1206
PSM	SLDSDESEDEEDDYQQK	374	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2642.6	23.84492	3	2110.732271	2110.737580	K	R	57	74
PSM	ERPERCSSSSGGGSSGDEDGLELDGAPGGGK	375	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4,8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2806.2	27.96243	4	3166.212894	3166.218376	R	R	37	68
PSM	SIQEIQELDKDDESLRK	376	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3049.2	34.11557	4	2125.0004941913203	2124.99400879832	K	Y	34	51
PSM	SWCPDCVQAEPVVR	377	sp|Q9BRA2|TXD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3219.3	38.44638	3	1781.727371	1781.726642	K	E	41	55
PSM	SASITNLSLDR	378	sp|Q9Y2I7|FYV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3086.3	35.06337	2	1255.577447	1255.580947	R	S	305	316
PSM	RDSFDDRGPSLNPVLDYDHGSR	379	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3149.5	36.66745	4	2597.131294	2597.129609	R	S	186	208
PSM	ISFSNIISDMK	380	sp|Q92665|RT31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4277.2	56.30027	2	1333.599447	1333.598905	K	V	199	210
PSM	TAFQEALDAAGDK	381	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3138.4	36.38268	2	1335.630047	1335.630660	K	L	9	22
PSM	RDSFDDRGPSLNPVLDYDHGSR	382	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3211.5	38.24577	4	2677.095294	2677.095940	R	S	186	208
PSM	GDNITLLQSVSN	383	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3497.3	45.38217	2	1339.600847	1339.602076	K	-	81	93
PSM	TLSSSAQEDIIR	384	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3033.5	33.73608	2	1398.636247	1398.639190	R	W	313	325
PSM	AITGASLADIMAK	385	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3836.3	51.30513	2	1420.608647	1420.607435	R	R	81	94
PSM	ALSLDGEQLIGNK	386	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3442.3	44.06865	2	1436.693047	1436.691226	R	H	410	423
PSM	RNSLGGDVLFVGK	387	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3205.2	38.08033	3	1440.711071	1440.712630	R	H	676	689
PSM	RFSMVVQDGIVK	388	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3203.2	38.02857	3	1457.711171	1457.710187	K	A	180	192
PSM	GFSVVADTPELQR	389	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3436.3	43.91493	2	1497.684847	1497.686475	K	I	97	110
PSM	SSLSGDEEDELFK	390	sp|Q5T1M5|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3272.5	39.80247	2	1534.608447	1534.607615	R	G	1161	1174
PSM	SPSFASEWDEIEK	391	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3621.2	48.0283	2	1603.646247	1603.644335	K	I	661	674
PSM	SKESVPEFPLSPPK	392	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3210.3	38.21293	3	1620.767771	1620.780041	R	K	28	42
PSM	DGKYSQVLANGLDNK	393	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3079.3	34.8824	3	1700.779271	1700.777081	K	L	92	107
PSM	RNSSEASSGDFLDLK	394	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3120.4	35.92927	3	1704.735971	1704.735610	R	G	85	100
PSM	TLTTVQGIADDYDKK	395	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3143.2	36.50383	3	1746.805571	1746.807712	K	K	43	58
PSM	SVAAEGALLPQTPPSPR	396	sp|Q86X27|RGPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3241.2	39.00343	3	1769.871371	1769.871315	K	N	315	332
PSM	NSVTPDMMEEMYKK	397	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3172.4	37.23098	3	1781.711771	1781.707546	K	A	229	243
PSM	QISLPDLSQEEPQLK	398	sp|Q15390|MTFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3679.2	48.77038	3	1803.863471	1803.865561	R	T	117	132
PSM	RLSVLEEEATEGGTSR	399	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3050.6	34.15382	3	1812.835871	1812.825487	K	V	294	310
PSM	GFSEGLWEIENNPTVK	400	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4134.2	54.97225	2	1898.848647	1898.845160	K	A	81	97
PSM	RKGTDVNVFNTILTTR	401	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3390.6	42.80513	3	1913.974571	1913.972426	R	S	213	229
PSM	GSYGDLGGPIITTQVTIPK	402	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3804.2	50.68248	3	1995.996071	1995.991825	R	D	378	397
PSM	KHSQFIGYPITLYLEK	403	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3631.3	48.18225	3	2016.014171	2016.012166	K	E	183	199
PSM	RKTSDFNTFLAQEGCTK	404	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3006.5	33.0478	3	2081.921171	2081.924156	R	G	197	214
PSM	LNRSNSELEDEILCLEK	405	sp|Q8IX94|CTGE4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3607.3	47.80142	3	2140.971371	2140.971166	K	D	135	152
PSM	RGTGQSDDSDIWDDTALIK	406	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3499.2	45.42662	4	2171.946894	2171.937223	R	A	23	42
PSM	SSLQQENLVEQAGSSSLVNGR	407	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	41.455	3	2282.059271	2282.053984	R	L	323	344
PSM	DNLTLWTSDSAGEECDAAEGAEN	408	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3600.2	47.64317	3	2453.976971	2453.976507	R	-	223	246
PSM	TDLNPDNLQGGDDLDPNYVLSSR	409	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3598.2	47.59267	3	2597.125271	2597.128271	K	V	108	131
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	410	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3144.3	36.53277	5	3562.493618	3562.491898	K	V	60	92
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	411	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3623.3	48.07875	4	3756.442894	3756.438824	K	A	469	503
PSM	QQSEISAAVER	412	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3259.4	39.47135	2	1279.5457	1279.5440	R	A	451	462
PSM	QRGSETDTDSEIHESASDKDSLSK	413	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.2599.6	22.75782	4	2684.1023	2684.1081	R	G	1260	1284
PSM	SGDEMIFDPTMSK	414	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4045.2	53.88077	2	1578.5989	1578.5978	M	K	2	15
PSM	SSIGTGYDLSASTFSPDGR	415	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3941.2	52.60558	3	2038.8563	2038.8516	M	V	2	21
PSM	SSIGTGYDLSASTFSPDGR	416	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3951.4	52.81405	3	2038.8563	2038.8516	M	V	2	21
PSM	KGSLESPATDVFGSTEEGEK	417	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3116.5	35.82987	3	2146.932071	2146.930741	R	R	330	350
PSM	QAGSLASLSDAPPLK	418	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3692.2	48.94876	2	1516.7167	1516.7169	K	S	276	291
PSM	RRTTQIINITMTK	419	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3055.4	34.27338	3	1734.830771	1734.825308	R	K	1809	1822
PSM	SVELEEALPVTTAEGMAK	420	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=1.1.4051.2	53.99418	3	2011.9076	2011.9056	M	K	2	20
PSM	ADHSFSDGVPSDSVEAAK	421	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3006.4	33.04447	3	1939.7825	1939.7832	M	N	2	20
PSM	SLSDWHLAVK	422	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3670.2	48.65517	2	1276.5867	1276.5848	M	L	2	12
PSM	QEGRKDSLSVNEFK	423	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=1.1.2887.4	30.01202	3	1698.7540	1698.7609	R	E	26	40
PSM	SCEVPTRLNSASLK	424	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2827.4	28.47792	3	1640.753171	1640.759322	R	Q	97	111
PSM	GMGSLDAMDK	425	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2917.2	30.76813	2	1103.397647	1103.402848	R	H	413	423
PSM	MESALDQLK	426	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2843.3	28.88715	2	1129.469847	1129.472642	R	Q	11	20
PSM	VGSGSLDNLGR	427	sp|Q13136|LIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2786.2	27.48943	2	1153.513247	1153.512867	R	F	664	675
PSM	ARTSSTDEVLSLEEK	428	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2910.3	30.59097	3	1743.787571	1743.792790	R	D	526	541
PSM	ERAMSTTSISSPQPGK	429	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2605.3	22.90233	3	1755.782171	1755.786265	K	L	265	281
PSM	YKSTTSVSEEDVSSR	430	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2500.3	20.32383	3	1753.740671	1753.740755	R	Y	226	241
PSM	GYSFTTTAER	431	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2856.5	29.22165	2	1211.481647	1211.485984	R	E	197	207
PSM	VIGSGCNLDSAR	432	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2589.4	22.49367	2	1247.587047	1247.592835	R	F	158	170
PSM	RFSTYSQSPPDTPSLR	433	sp|Q6ZS17|RIPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2970.4	32.11792	3	1917.859571	1917.862207	K	E	344	360
PSM	DSAQNSVIIVDK	434	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2808.3	28.0036	2	1287.663847	1287.667045	K	N	194	206
PSM	RRSSSVVSAEMSGCSSK	435	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2593.5	22.59993	3	1973.775971	1973.773743	R	S	290	307
PSM	NMSVIAHVDHGK	436	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2726.5	25.97758	2	1386.608647	1386.611536	R	S	21	33
PSM	IIYGGSVTGATCK	437	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2824.4	28.40188	2	1405.628247	1405.631268	R	E	244	257
PSM	GRSFAGNLNTYK	438	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2772.2	27.14523	3	1406.628971	1406.634379	R	R	384	396
PSM	TASGSSVTSLDGTR	439	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2678.4	24.75867	2	1417.606447	1417.608618	R	S	328	342
PSM	SRSGEGEVSGLMR	440	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2760.2	26.83387	3	1443.613271	1443.617743	R	K	471	484
PSM	RQQSEISAAVER	441	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2597.2	22.69293	3	1452.669371	1452.672222	R	A	450	462
PSM	KTSFGSLKDEDR	442	sp|P49821|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2582.3	22.31058	3	1461.653771	1461.650089	K	I	29	41
PSM	AHSSMVGVNLPQK	443	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2641.4	23.81252	3	1462.663871	1462.663965	R	A	172	185
PSM	SSGGSEHSTEGSVSLGDGQLNR	444	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2818.5	28.25377	3	2319.901271	2319.900594	R	Y	381	403
PSM	VPSPLEGSEGDGDTD	445	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2964.6	31.97628	2	1553.574447	1553.577043	K	-	413	428
PSM	KQSGSPTLDTAPNGR	446	sp|Q9H2J7|S6A15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2476.4	19.75732	3	1607.731271	1607.730465	R	Y	697	712
PSM	HRPSEADEEELAR	447	sp|O14617|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2467.2	19.53847	3	1617.676871	1617.678429	K	R	655	668
PSM	HRVIGSGCNLDSAR	448	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2570.3	22.03625	3	1620.710771	1620.719189	K	F	157	171
PSM	ERESLQQMAEVTR	449	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2855.3	29.1903	3	1655.729771	1655.733836	K	E	123	136
PSM	NRTSVDFKDTDYK	450	sp|P49902|5NTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2632.4	23.58385	3	1667.715371	1667.719231	R	R	508	521
PSM	RASSDLSIASSEEDK	451	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2663.2	24.37072	3	1673.709971	1673.714540	K	L	338	353
PSM	SRKESYSIYVYK	452	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2926.2	30.99888	3	1681.711871	1681.715406	R	V	33	45
PSM	SRKESYSIYVYK	453	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2918.3	30.79727	3	1681.711871	1681.715406	R	V	33	45
PSM	ERSDSGGSSSEPFDR	454	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2512.3	20.63287	3	1691.636771	1691.642438	R	H	757	772
PSM	NLDIERPTYTNLNR	455	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2961.3	31.8891	3	1717.873271	1717.874747	R	L	216	230
PSM	RNSNSPPSPSSMNQR	456	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2227.2	15.96523	3	1753.717271	1753.720311	R	R	453	468
PSM	DRKESLDVYELDAK	457	sp|Q13510|ASAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2975.3	32.24077	3	1759.801571	1759.802961	R	Q	297	311
PSM	SASLSSAATTGLTTQQR	458	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2923.4	30.92973	3	1758.805871	1758.814923	R	T	3740	3757
PSM	RSSLSSHSHQSQIYR	459	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2403.3	18.07078	4	1851.836894	1851.837724	R	S	1367	1382
PSM	RTSSTLDSEGTFNSYRK	460	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2709.4	25.5447	3	2027.893271	2027.894964	R	E	41	58
PSM	SRTHSTSSSLGSGESPFSR	461	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2679.3	24.77987	3	2045.881271	2045.880377	R	S	327	346
PSM	RTSSAQVEGGVHSLHSYEK	462	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2603.3	22.85105	4	2150.972494	2150.974611	K	R	493	512
PSM	ALRTDYNASVSVPDSSGPER	463	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2893.4	30.1643	3	2199.972671	2199.979756	K	I	67	87
PSM	TRSNPEGAEDRAVGAQASVGSR	464	sp|Q9NWV8|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2535.2	21.14648	4	2294.040094	2294.040065	R	S	27	49
PSM	HQGVMVGMGQKDSYVGDEAQSK	465	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2772.4	27.1519	4	2430.033694	2430.034511	R	R	42	64
PSM	FSVCVLGDQQHCDEAK	466	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3119.2	35.89677	4	1971.793694	1971.785614	K	A	63	79
PSM	SGVGNIFIK	467	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3291.2	40.2804	2	1013.495847	1013.494698	K	N	96	105
PSM	SGVGNIFIK	468	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	40.48347	2	1013.495847	1013.494698	K	N	96	105
PSM	HGSLGFLPR	469	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3057.2	34.31737	2	1062.500247	1062.501180	R	K	11	20
PSM	VLSIGDGIAR	470	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	38.61855	2	1079.536047	1079.537626	R	V	74	84
PSM	MESALDQLK	471	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3059.2	34.36713	2	1113.477447	1113.477727	R	Q	11	20
PSM	MESALDQLK	472	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3056.3	34.2956	2	1129.470847	1129.472642	R	Q	11	20
PSM	GQRASLEAAIADAEQR	473	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3131.3	36.20043	3	1764.816371	1764.815591	K	G	326	342
PSM	VKNSLLSLSDT	474	sp|Q7L2H7|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3218.4	38.42388	2	1255.605847	1255.606099	K	-	364	375
PSM	SSSGLLEWESK	475	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3320.4	41.03757	2	1301.555247	1301.554064	R	S	542	553
PSM	KITIADCGQLE	476	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3044.5	34.00331	2	1326.587447	1326.589069	K	-	155	166
PSM	AITGASLADIMAK	477	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3169.3	37.15132	2	1356.632847	1356.636019	R	R	81	94
PSM	NLSSPFIFHEK	478	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3352.2	41.82877	3	1397.642471	1397.638068	R	T	644	655
PSM	TSSFTEQLDEGTPNRESGDTQSFAQK	479	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3042.4	33.95842	4	2939.241694	2939.245820	R	L	39	65
PSM	SSSSSSGGGLLPYPR	480	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3181.4	37.46363	2	1530.673447	1530.671553	R	R	40	55
PSM	RVSAIVEQSWNDS	481	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3259.5	39.47468	2	1569.684447	1569.682452	K	-	140	153
PSM	ASSLGEIDESSELR	482	sp|Q16513|PKN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3077.4	34.83538	2	1571.670047	1571.671613	R	V	581	595
PSM	TMSEVGGSVEDLIAK	483	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3836.4	51.3118	2	1614.722647	1614.721205	R	G	35	50
PSM	SIQFVDWCPTGFK	484	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.4241.2	55.9744	2	1663.711847	1663.710581	R	V	340	353
PSM	SFVCFGDDGEPQLK	485	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3487.3	45.14148	2	1677.676647	1677.674590	R	E	1029	1043
PSM	NRPTSISWDGLDSGK	486	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3070.4	34.65722	3	1711.760171	1711.756680	K	L	48	63
PSM	AASESTEQEEGDAPQEDFIQYIAR	487	sp|Q8N350|CBARP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4086.2	54.45867	3	2763.156971	2763.154880	R	A	339	363
PSM	NPDDITQEEYGEFYK	488	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3212.3	38.26507	3	1846.793171	1846.789740	R	S	292	307
PSM	AKRSLTSSLENIFSR	489	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3459.3	44.43892	3	1867.862171	1867.859444	K	G	563	578
PSM	KTDPSSLGATSASFNFGK	490	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3114.2	35.77	3	1893.852971	1893.850974	K	K	258	276
PSM	MSASDPNSSIFLTDTAK	491	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3461.3	44.50053	3	1943.769371	1943.762492	K	Q	350	367
PSM	VQSTADIFGDEEGDLFK	492	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4148.2	55.08142	3	1949.833271	1949.829570	K	E	476	493
PSM	SNSSSEAVLGQEELSAQAK	493	sp|Q9BXF6|RFIP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3069.5	34.63467	3	2013.889871	2013.889210	R	V	393	412
PSM	DLGGNAKCSDFTEEICR	494	sp|P50213|IDH3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,9-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3109.4	35.65378	3	2050.816871	2050.812557	K	R	344	361
PSM	KTSLDVSNSAEPGFLAPGAR	495	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3186.6	37.5999	3	2096.005571	2095.993950	R	S	646	666
PSM	DNLTLWTSDQQDEEAGEGN	496	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3504.2	45.55415	3	2120.880671	2120.877051	R	-	228	247
PSM	DNLTLWTSDMQGDGEEQNK	497	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3467.5	44.6519	3	2179.936271	2179.932792	R	E	226	245
PSM	DNLTLWTSENQGDEGDAGEGEN	498	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3511.2	45.68873	3	2349.949271	2349.946922	R	-	225	247
PSM	KASATCSSATAAASSGLEEWTSR	499	sp|Q96G74|OTUD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3225.6	38.60638	3	2408.034671	2408.031534	R	S	429	452
PSM	NVNIYRDSAIPVESDTDDEGAPR	500	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3124.6	36.03743	3	2612.139971	2612.139170	K	I	455	478
PSM	ERPTPSLNNNCTTSEDSLVLYNR	501	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3162.3	36.99175	3	2759.219771	2759.222189	K	V	734	757
PSM	RLQSIGTENTEENRR	502	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2521.5	20.87255	3	1881.866171	1881.869418	K	F	43	58
PSM	RSRSGEGEVSGLMR	503	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2629.2	23.50202	3	1599.715871	1599.718854	K	K	470	484
PSM	SLSNKLTLDK	504	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3104.2	35.52463	2	1239.6092	1239.6107	M	L	2	12
PSM	SGDEMIFDPTMSK	505	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3687.2	48.89738	2	1594.5927	1594.5927	M	K	2	15
PSM	SGDEMIFDPTMSK	506	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4075.2	54.2962	2	1578.5989	1578.5978	M	K	2	15
PSM	QLSSGVSEIR	507	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	40.23212	2	1137.5067	1137.5062	R	H	80	90
PSM	QLSILVHPDKNQDDADR	508	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	48.2848	3	2025.9167	2025.9152	R	A	79	96
PSM	QRSLGPSLATDKS	509	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.2883.2	29.9021	2	1421.6495	1421.6546	R	-	268	281
PSM	SLYPSLEDLK	510	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4351.2	57.17299	2	1285.5839	1285.5838	M	V	2	12
PSM	ATNWGSLLQDK	511	sp|P48637|GSHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4364.2	57.30995	2	1353.5964	1353.5961	M	Q	2	13
PSM	ATNWGSLLQDK	512	sp|P48637|GSHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4344.2	57.10921	2	1353.5964	1353.5961	M	Q	2	13
PSM	QNSATESADSIEIYVPEAQTR	513	sp|Q9Y2H0|DLGP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	53.21607	3	2371.0229	2371.0212	R	L	971	992
PSM	RLSSLRASTSK	514	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2633.2	23.60315	3	1444.586171	1444.587777	R	S	233	244
PSM	ERCSEQVQDFTK	515	sp|Q7Z7K0|COXM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.2646.4	23.9374	3	1605.650471	1605.649438	K	C	29	41
PSM	KCSLSLVGR	516	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2737.2	26.25058	2	1098.524847	1098.525681	K	G	253	262
PSM	TRVTDSSVSVQLRE	517	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2794.3	27.69558	3	1655.787371	1655.787980	R	-	262	276
PSM	YIDQEELNK	518	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2602.3	22.82512	2	1150.547847	1150.550619	K	T	198	207
PSM	QLSSGVSEIR	519	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2800.3	27.8436	2	1154.530647	1154.533268	R	H	80	90
PSM	NSSISGPFGSR	520	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2894.3	30.18573	2	1187.494647	1187.497217	R	S	483	494
PSM	NSSISGPFGSR	521	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2886.3	29.98285	2	1187.494647	1187.497217	R	S	483	494
PSM	RQSNVAAPGDATPPAEK	522	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2471.5	19.63467	3	1787.819771	1787.820342	K	K	245	262
PSM	SQGMALSLGDK	523	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2738.3	26.27973	2	1201.501847	1201.505005	K	I	933	944
PSM	RASAYEALEK	524	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2610.4	23.0345	2	1216.544647	1216.548919	R	Y	91	101
PSM	SGQGAFGNMCR	525	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2762.3	26.8889	2	1263.450047	1263.452592	R	G	87	98
PSM	QDSAAVGFDYK	526	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2945.3	31.4876	2	1279.510247	1279.512199	R	E	280	291
PSM	GGSGSGPTIEEVD	527	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2932.2	31.1523	2	1283.490447	1283.491857	K	-	629	642
PSM	ASIHEAWTDGK	528	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2735.4	26.20538	2	1293.535847	1293.539082	K	E	403	414
PSM	NAGVEGSLIVEK	529	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2930.4	31.10732	2	1294.614447	1294.616998	K	I	482	494
PSM	NTPHRGSSAGGGGSGAAAATAATAGGQHR	530	sp|O00458|IFRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2396.6	17.90398	4	2612.159294	2612.158952	R	N	8	37
PSM	SSSEDAESLAPR	531	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2669.5	24.53503	2	1327.525647	1327.529305	R	S	298	310
PSM	ERLESLNIQR	532	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2897.2	30.25632	2	1336.647647	1336.650030	K	E	580	590
PSM	DNSTMGYMMAK	533	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2776.4	27.25423	2	1343.451447	1343.459711	R	K	486	497
PSM	DNSTMGYMMAK	534	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2746.3	26.48507	2	1343.457247	1343.459711	R	K	486	497
PSM	DMRQTVAVGVIK	535	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.2768.2	27.04132	3	1411.686071	1411.689452	R	A	428	440
PSM	RKSELEFETLK	536	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2822.4	28.35223	3	1458.710471	1458.711961	K	T	260	271
PSM	SRSFTLDDESLK	537	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2970.5	32.12125	2	1476.647847	1476.649755	R	Y	41	53
PSM	STAGDTHLGGEDFDNR	538	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2645.3	23.90872	3	1690.716671	1690.718306	K	M	224	240
PSM	QEGRKDSLSVNEFK	539	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2720.2	25.81408	3	1715.786471	1715.787980	R	E	26	40
PSM	ETQKSIYYITGESK	540	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2830.4	28.55523	3	1725.783971	1725.786248	K	E	478	492
PSM	RLQSIGTENTEENR	541	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2594.5	22.62545	3	1725.766871	1725.768307	K	R	43	57
PSM	TDYNASVSVPDSSGPER	542	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2840.4	28.81293	3	1859.757071	1859.757467	R	I	70	87
PSM	KNSSQDDLFPTSDTPR	543	sp|Q9H6T3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2929.4	31.08162	3	1886.803271	1886.804752	K	A	478	494
PSM	AQALRDNSTMGYMAAKK	544	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2669.4	24.5317	3	1934.871971	1934.874369	K	H	616	633
PSM	RSSQPSPTAVPASDSPPTK	545	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2559.5	21.76525	3	1988.912471	1988.920451	R	Q	111	130
PSM	GKKQSFDDNDSEELEDK	546	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2541.4	21.30732	3	2062.833971	2062.836840	K	D	103	120
PSM	NGVIQHTGAAAEEFNDDTD	547	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2913.5	30.67467	3	2082.812471	2082.816773	R	-	646	665
PSM	LGPKSSVLIAQQTDTSDPEK	548	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2911.4	30.61992	3	2193.051371	2193.056610	R	V	449	469
PSM	QRGSETGSETHESDLAPSDK	549	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2421.5	18.42262	4	2209.910494	2209.912465	R	E	1103	1123
PSM	LARASGNYATVISHNPETKK	550	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2683.3	24.87997	4	2236.101694	2236.100146	K	T	126	146
PSM	DERSDSRAQAVSEDAGGNEGR	551	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2432.5	18.69752	4	2284.929694	2284.930574	R	A	114	135
PSM	NSSYVHGGVDASGKPQEAVYGQNDIHHK	552	sp|Q9UN86|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2664.4	24.40323	5	3073.365618	3073.367941	R	V	37	65
PSM	SEFGSVDGPLPHPR	553	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3085.3	35.03747	3	1573.692671	1573.692623	R	W	1702	1716
PSM	SPSLNLLQNK	554	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3176.2	37.3408	2	1192.585247	1192.585304	R	S	529	539
PSM	SYDYEAWAK	555	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3222.3	38.52122	2	1211.453047	1211.453621	K	L	87	96
PSM	SDSSQPMLLR	556	sp|P11532|DMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3018.2	33.34137	2	1212.518247	1212.520989	R	V	3621	3631
PSM	DGNGYISAAELR	557	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3023.3	33.47325	2	1264.602847	1264.604780	K	H	96	108
PSM	RLSSVMTIVK	558	sp|Q9HC36|MRM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3479.3	44.95037	2	1292.591847	1292.596477	R	S	103	113
PSM	SNSLSEQLAINTSPDAVK	559	sp|Q5T1M5|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3268.4	39.69898	3	1952.913371	1952.909217	K	A	344	362
PSM	RASSLNFLNK	560	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	37.64535	2	1308.564447	1308.562868	K	S	579	589
PSM	RLSEGQEEENLENEMK	561	sp|Q15276|RABE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3036.3	33.8022	3	2013.843971	2013.835066	R	K	160	176
PSM	SFSEDVFQSVK	562	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3433.3	43.83892	2	1351.571647	1351.569714	K	S	18	29
PSM	SFSTALYGESDL	563	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4233.2	55.8864	2	1368.550047	1368.548644	K	-	900	912
PSM	SCSDTALNAIVAK	564	sp|Q86X02|CDR2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3152.4	36.74103	2	1428.633247	1428.631997	K	D	316	329
PSM	SAEPAEALVLACK	565	sp|Q96CW6|S7A6O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3330.3	41.28588	2	1437.657647	1437.657483	R	R	16	29
PSM	GSLLLGGLDAEASR	566	sp|Q6UVK1|CSPG4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3521.3	45.92768	2	1437.685847	1437.686475	R	H	320	334
PSM	TLTIVDTGIGMTK	567	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3359.6	42.02151	2	1444.687447	1444.688449	R	A	28	41
PSM	SPSFASEWDEIEK	568	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3636.3	48.25974	2	1603.646247	1603.644335	K	I	661	674
PSM	SLNLVDSPQPLLEK	569	sp|P46019|KPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3616.3	47.94662	3	1631.818571	1631.817155	K	V	729	743
PSM	SSFDEMLPGTHFQR	570	sp|Q02218|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3091.3	35.19304	3	1746.708671	1746.707287	R	V	870	884
PSM	VQQTVQDLFGRAPSK	571	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3134.2	36.27328	3	1752.855671	1752.856000	K	A	395	410
PSM	TSDFNTFLAQEGCTK	572	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3392.5	42.8514	3	1797.733571	1797.728082	K	G	199	214
PSM	HVPDSGATATAYLCGVK	573	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3075.4	34.78572	3	1825.805471	1825.807001	K	G	110	127
PSM	NPDDITNEEYGEFYK	574	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3187.2	37.6126	3	1832.777471	1832.774089	R	S	300	315
PSM	WNTRESYDDVSSFR	575	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3048.5	34.10073	3	1840.752971	1840.741758	K	A	259	273
PSM	TMQGEGPQLLLSEAVSR	576	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3770.2	50.19435	3	1910.885171	1910.880894	K	A	1053	1070
PSM	AMSLVSSDSEGEQNELR	577	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3110.3	35.67503	3	1930.795571	1930.797952	R	N	2688	2705
PSM	NVSSFPDDATSPLQENR	578	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3254.5	39.34575	3	1955.829071	1955.826216	R	N	52	69
PSM	ENRESLVVNYEDLAAR	579	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	40.0739	3	1956.894671	1956.894236	K	E	225	241
PSM	LGSVDSFERSNSLASEK	580	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3075.5	34.78905	3	1984.818671	1984.818033	R	D	586	603
PSM	KHSQFIGYPITLFVEK	581	sp|Q58FG0|HS905_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3768.3	50.1539	3	1986.005771	1986.001601	K	K	39	55
PSM	DLLLTSSYLSDSGSTGEHTK	582	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3441.2	44.04272	3	2189.973971	2189.972940	K	S	397	417
PSM	ARSVDALDDLTPPSTAESGSR	583	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3122.5	35.98362	3	2223.997571	2224.000886	R	S	491	512
PSM	KLSGDQITLPTTVDYSSVPK	584	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3401.5	43.04898	3	2228.102471	2228.097746	R	Q	34	54
PSM	YHTSQSGDEMTSLSEYVSR	585	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3279.2	39.97057	4	2255.915694	2255.904208	R	M	457	476
PSM	SVVSLKNEEENENSISQYK	586	sp|P82673|RT35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3012.5	33.20325	3	2276.017871	2276.020953	K	E	295	314
PSM	QLSSTSPLAPYPTSQMVSSDR	587	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3388.5	42.75253	3	2331.045671	2331.045393	R	S	408	429
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	588	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3237.3	38.91322	3	2861.128271	2861.124466	R	L	22	47
PSM	QFASQANVVGPWIQTK	589	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.4737.2	60.14252	3	1835.8675	1835.8602	R	M	653	669
PSM	CSVLAAANPVYGR	590	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	50.77993	2	1439.6281	1439.6263	R	Y	446	459
PSM	SGDEMIFDPTMSK	591	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3704.3	49.09587	2	1594.5927	1594.5927	M	K	2	15
PSM	QLSILVHPDK	592	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4076.2	54.32145	2	1211.5957	1211.5946	R	N	79	89
PSM	QLSILVHPDK	593	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4056.2	54.11868	2	1211.5957	1211.5946	R	N	79	89
PSM	DRTTSFFLNSPEK	594	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3210.3	38.21293	3	1620.712571	1620.718503	K	E	1274	1287
PSM	QAGSLASLSDAPPLK	595	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3678.2	48.74548	2	1516.7167	1516.7169	K	S	276	291
PSM	QAGSVGGLQWCGEPK	596	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3498.4	45.4144	2	1635.6757	1635.6747	R	R	190	205
PSM	QVSSVNEEDFVR	597	sp|P40189|IL6RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3490.2	45.20077	2	1470.6007	1470.6023	K	L	836	848
PSM	RGSLEMSSDGEPLSR	598	sp|Q6ZN18|AEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2580.4	22.26238	3	1715.719871	1715.718580	R	M	204	219
PSM	QASLDGLQQLR	599	sp|Q3MII6|TBC25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3588.3	47.4137	2	1290.5967	1290.5964	R	D	504	515
PSM	IVRGDQPAASGDSDDDEPPPLPR	600	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2851.4	29.09637	4	2484.118494	2483.096577	K	L	45	68
PSM	SQSSHSYDDSTLPLIDR	601	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3187.4	37.61927	3	1999.857071	1999.852431	R	N	859	876
PSM	SCINLPTVLPGSPSK	602	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4114.2	54.73123	3	1690.8034	1690.7996	M	T	2	17
PSM	SFVAYEELIK	603	sp|Q96FX7|TRM61_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5152.2	63.12777	2	1319.6065	1319.6045	M	E	2	12
PSM	AASIFGGAK	604	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2826.2	28.44553	2	900.408247	900.410634	R	P	357	366
PSM	RLASSVLR	605	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2749.3	26.55467	2	980.514847	980.516830	K	C	9	17
PSM	KQSTDEEVTSLAK	606	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2658.3	24.2443	3	1514.683571	1514.686534	R	S	55	68
PSM	SSERSSLFQTDLK	607	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2922.2	30.89757	3	1576.708571	1576.713418	K	L	1496	1509
PSM	KGSFSALVGR	608	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2882.2	29.87673	2	1100.534647	1100.537960	R	T	8	18
PSM	SLDQDPVVR	609	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2721.2	25.8394	2	1107.494447	1107.496155	K	A	773	782
PSM	SCVEEPEPEPEAAEGDGDKK	610	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2586.3	22.4135	4	2251.880494	2251.882804	K	G	107	127
PSM	VTLTSEEEAR	611	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2550.5	21.53475	2	1133.551647	1133.556432	K	L	306	316
PSM	SSVLIAQQTDTSDPEK	612	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2792.4	27.64713	3	1797.802271	1797.803355	K	V	453	469
PSM	HQGVMVGMGQKDSYVGDEAQSK	613	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2757.3	26.75917	4	2430.036894	2430.034511	R	R	42	64
PSM	KASSPSPLTIGTPESQR	614	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2881.3	29.8551	3	1834.878071	1834.882608	R	K	520	537
PSM	KKESILDLSK	615	sp|Q9UK45|LSM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2701.3	25.34262	2	1239.642847	1239.647570	K	Y	8	18
PSM	MNAQNKLSLTQDPVVK	616	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2953.2	31.68218	3	1864.908971	1864.911800	K	V	752	768
PSM	SNFSNSADDIK	617	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2657.5	24.22488	2	1276.494447	1276.497277	K	S	92	103
PSM	LMIEMDGTENK	618	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2958.3	31.81202	2	1279.575247	1279.578824	K	S	93	104
PSM	RKDSAIQQQVANLQMK	619	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.2766.4	26.99617	3	1952.949371	1952.950311	R	I	1227	1243
PSM	NNASTDYDLSDK	620	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2566.6	21.94333	2	1341.565447	1341.568454	K	S	301	313
PSM	KESYSVYVYK	621	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2843.6	28.89715	2	1344.599647	1344.600285	R	V	35	45
PSM	KESYSIYVYK	622	sp|P33778|H2B1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2952.4	31.66438	2	1358.612447	1358.615935	R	V	35	45
PSM	RALANSLACQGK	623	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2516.4	20.73983	2	1367.633247	1367.638085	K	Y	331	343
PSM	RKESTDEILGR	624	sp|Q15042|RB3GP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2539.4	21.2557	3	1382.654771	1382.655509	R	S	337	348
PSM	DNPGVVTCLDEAR	625	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2968.4	32.06922	2	1444.656647	1444.661643	K	H	227	240
PSM	SRSGSSQELDVKPSASPQER	626	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2532.3	21.08007	3	2224.007171	2224.012119	R	S	1537	1557
PSM	KQSSSEISLAVER	627	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2820.2	28.29503	3	1512.708671	1512.718503	R	A	454	467
PSM	ERGSDASGQLFHGR	628	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2605.2	22.899	3	1595.682671	1595.684183	R	A	1230	1244
PSM	DFSLTSSSQTPGATK	629	sp|Q9NZ53|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2965.6	32.0019	2	1605.693047	1605.692348	R	S	205	220
PSM	KDSSSVVEWTQAPK	630	sp|Q8TC07|TBC15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2941.3	31.38895	3	1640.743871	1640.744718	R	E	68	82
PSM	SRKESYSVYVYK	631	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2817.2	28.21852	3	1667.696771	1667.699756	R	V	33	45
PSM	GGSVLVTCSTSCDQPK	632	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2750.3	26.5796	3	1774.723571	1774.726702	R	L	41	57
PSM	IVRASNGDAWVEAHGK	633	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2705.3	25.44248	3	1788.828371	1788.830848	K	L	144	160
PSM	DKPHVNVGTIGHVDHGK	634	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2548.2	21.47323	4	1808.926894	1808.928179	R	T	54	71
PSM	DLEAEHVEVEDTTLNR	635	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2987.3	32.55043	3	1868.873471	1868.875201	R	C	15	31
PSM	KVSASVAEVQEQYTER	636	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2929.5	31.08495	3	1902.871271	1902.872438	R	L	853	869
PSM	AQALRDNSTMGYMMAK	637	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.2794.6	27.70558	3	1914.762071	1914.767521	K	K	481	497
PSM	TLRGSFSSTAAQDAQGQR	638	sp|Q86V85|GP180_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2697.6	25.24943	3	1959.876971	1959.879983	K	I	24	42
PSM	KRSELSQDAEPAGSQETK	639	sp|Q9BVJ6|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2393.5	17.82852	3	2039.912471	2039.916093	R	D	432	450
PSM	RKTSDFNTFLAQEGCTK	640	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2990.2	32.62445	4	2081.925294	2081.924156	R	G	197	214
PSM	KLSVPTSDEEDEVPAPKPR	641	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2863.3	29.39487	4	2173.030894	2173.030395	K	G	103	122
PSM	HQGVMVGMGQKDSYVGDEAQSK	642	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2673.6	24.64132	3	2446.022171	2446.029426	R	R	42	64
PSM	NMSIIDAFK	643	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3766.2	50.09252	2	1117.489447	1117.487898	R	S	617	626
PSM	AFSITQGLLK	644	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	49.68173	2	1156.589247	1156.589327	R	D	891	901
PSM	SQGMALSLGDK	645	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3008.3	33.09283	2	1185.508247	1185.510090	K	I	933	944
PSM	SMSAPVIFDR	646	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3384.2	42.64563	2	1201.520847	1201.520261	K	S	117	127
PSM	YGGRDYSLDEFEANK	647	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3076.3	34.80708	3	1842.753371	1842.746174	R	I	1700	1715
PSM	SADTLWDIQK	648	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3318.3	40.97583	2	1255.547447	1255.548584	K	D	320	330
PSM	LRSSFESSCPQQWIK	649	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3189.4	37.67152	3	1931.861771	1931.860099	K	Y	82	97
PSM	SASDLSEDLFK	650	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	44.64857	2	1290.539847	1290.538079	K	V	650	661
PSM	SIFASPESVTGK	651	sp|O75940|SPF30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3138.3	36.37935	2	1301.589047	1301.590449	R	V	197	209
PSM	GSGSVVGELMYK	652	sp|O75746|CMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3303.4	40.59218	2	1305.571647	1305.567605	R	N	359	371
PSM	SPSISNMAALSR	653	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3132.5	36.23278	2	1312.585847	1312.584652	R	A	341	353
PSM	DMGSVALDAGTAK	654	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3023.5	33.47992	2	1314.548847	1314.552683	K	D	298	311
PSM	SLEDQVEMLR	655	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3175.3	37.30828	2	1314.550847	1314.552684	K	T	168	178
PSM	RYSDFEWLK	656	sp|Q9UMY4|SNX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	43.82892	2	1322.572647	1322.569654	R	N	71	80
PSM	DVSLGDWEFGK	657	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3989.2	53.33412	2	1331.547247	1331.543499	R	R	880	891
PSM	SLSLQPQLTQR	658	sp|P21731|TA2R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3084.4	35.0148	2	1349.668647	1349.670431	R	S	329	340
PSM	NSVSQISVLSGGK	659	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3066.3	34.55042	2	1354.646647	1354.649361	K	A	327	340
PSM	SESVEGFLSPSR	660	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3291.4	40.28707	2	1373.587847	1373.586426	R	C	1311	1323
PSM	QDSLSSEVDTLK	661	sp|Q08378|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3122.4	35.98028	2	1400.606247	1400.607221	R	Q	463	475
PSM	FASENDLPEWK	662	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3394.4	42.89625	2	1414.583447	1414.580613	R	E	58	69
PSM	SFQGDDSDLLLK	663	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3369.2	42.26567	3	1416.619571	1416.617392	K	T	875	887
PSM	TLTIVDTGIGMTK	664	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3581.3	47.28537	2	1428.692447	1428.693534	R	A	28	41
PSM	TLTIVDTGIGMTK	665	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3616.5	47.95329	2	1428.692447	1428.693534	R	A	28	41
PSM	FSVGGMTDVAEIK	666	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3595.4	47.51668	2	1432.628247	1432.630934	R	G	547	560
PSM	GILAADESTGSIAK	667	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3137.4	36.35698	2	1491.623647	1491.625922	K	R	29	43
PSM	NQSFCPTVNLDK	668	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3069.6	34.638	2	1501.628247	1501.627246	R	L	66	78
PSM	TTPSVVAFTADGER	669	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3127.3	36.1006	2	1529.675247	1529.676304	R	L	86	100
PSM	AGSISTLDSLDFAR	670	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3708.3	49.1854	2	1531.691247	1531.691954	R	Y	178	192
PSM	QMSCLMEALEDK	671	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.4029.3	53.72322	2	1533.592047	1533.591454	R	R	1089	1101
PSM	DTSFSGLSLEEYK	672	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	46.63157	2	1554.646847	1554.649086	R	L	77	90
PSM	DGSLASNPYSGDLTK	673	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3070.6	34.66388	2	1603.675447	1603.676698	R	F	850	865
PSM	SLTNDWEDHLAVK	674	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3292.2	40.30623	3	1606.705871	1606.702853	K	H	315	328
PSM	SMSDVSAEDVQNLR	675	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3098.2	35.37068	3	1629.669671	1629.670567	K	Q	704	718
PSM	DLSHIGDAVVISCAK	676	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3401.2	43.03898	3	1663.768271	1663.764073	R	D	150	165
PSM	RNSSEASSGDFLDLK	677	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3128.3	36.12523	3	1704.735971	1704.735610	R	G	85	100
PSM	KYEMFAQTLQQSR	678	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3063.5	34.47922	3	1708.764971	1708.764407	R	G	754	767
PSM	SSFDEMLPGTHFQR	679	sp|Q02218|ODO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	41.95673	3	1730.716271	1730.712372	R	V	870	884
PSM	NRPTSISWDGLDSGK	680	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3260.3	39.49398	3	1791.725771	1791.723011	K	L	48	63
PSM	NVSSFPDDATSPLQENR	681	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3230.6	38.73402	3	1955.829071	1955.826216	R	N	52	69
PSM	MSLDPADLTHDTTGLTAK	682	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3526.2	46.06021	3	1965.877571	1965.875474	K	E	103	121
PSM	GSSGVGLTAAVTTDQETGER	683	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3048.6	34.10406	3	2014.884371	2014.884459	R	R	372	392
PSM	SRWDETPASQMGGSTPVLTPGK	684	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3199.4	37.93783	3	2381.071571	2381.072277	K	T	336	358
PSM	SFSKEELMSSDLEETAGSTSIPK	685	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3430.4	43.76532	3	2552.133071	2552.124097	K	R	511	534
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	686	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	42.77378	4	3014.197294	3014.188484	K	-	661	690
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	687	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3362.6	42.09878	4	3393.356494	3393.345713	K	F	86	114
PSM	DDDIAALVVDNGSGMCK	688	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4063.2	54.1819	2	1820.7931	1820.7915	M	A	2	19
PSM	QTGKTSIAIDTIINQK	689	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=1.1.3555.2	46.69957	3	1792.8965	1792.8967	R	R	215	231
PSM	ASGVAVSDGVIK	690	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3060.2	34.3922	2	1143.6123	1143.6130	M	V	2	14
PSM	ASGADSKGDDLSTAILK	691	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3320.3	41.0309	3	1769.8096	1769.8079	M	Q	2	19
PSM	QQSTSSDRVSQTPESLDFLK	692	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4098.2	54.5911	3	2395.0037	2394.9977	R	V	1000	1020
PSM	AERGYSFSLTTFSPSGK	693	sp|P25787|PSA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3834.2	51.25172	3	1955.8729	1955.8661	M	L	2	19
PSM	ADHSFSDGVPSDSVEAAK	694	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2998.4	32.8383	3	1939.7825	1939.7832	M	N	2	20
PSM	KGSSNNQDVVTCDMACK	695	sp|Q6NUQ4|TM214_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2621.4	23.30692	3	1992.768371	1992.774063	R	G	453	470
PSM	IPGEKDSVICLK	696	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2923.2	30.92307	3	1437.690971	1437.693869	K	G	72	84
PSM	RTTRYDIDMTK	697	sp|O00217|NDUS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2601.2	22.79613	3	1478.658371	1478.658880	R	C	139	150
PSM	SLEQDALR	698	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2727.2	25.99325	2	1010.440047	1010.443391	K	A	1508	1516
PSM	DVNAAIATIK	699	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2965.2	31.98857	2	1014.568847	1014.570960	K	T	327	337
PSM	RVSHQGYSTEAEFEEPR	700	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2715.2	25.6889	4	2100.891694	2100.890213	R	V	240	257
PSM	GFSIPECQK	701	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2990.4	32.63111	2	1144.459847	1144.462412	R	L	95	104
PSM	KLSQMILDK	702	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2960.2	31.86002	2	1154.573847	1154.577048	R	K	364	373
PSM	KASSDLDQASVSPSEEENSESSSESEK	703	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2636.3	23.683	5	2922.175618	2922.177526	R	T	172	199
PSM	DGSDVIYPAR	704	sp|P25685|DNJB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2817.3	28.22185	2	1171.490647	1171.491069	R	I	250	260
PSM	KGTAKVDFLK	705	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2698.4	25.26848	2	1185.611447	1185.615876	R	K	5	15
PSM	IEAFRASLSK	706	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2808.2	27.99693	2	1200.588247	1200.590389	K	L	147	157
PSM	NAGVEGSLIVEK	707	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2848.4	29.01945	2	1214.647247	1214.650667	K	I	482	494
PSM	KQSLGEDHVILEEQK	708	sp|Q9HBD1|RC3H2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2760.5	26.84387	3	1831.869371	1831.871709	K	T	1117	1132
PSM	EAAALGSRGSCSTEVEKETQEK	709	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2597.4	22.6996	4	2446.064494	2446.068314	K	M	59	81
PSM	ARIYSSDSDEGSEEDK	710	sp|Q8WVC0|LEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2465.5	19.49767	3	1866.714671	1866.715662	R	A	603	619
PSM	KITIADCGQLE	711	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2884.4	29.93428	2	1246.619047	1246.622738	K	-	155	166
PSM	EQVANSAFVER	712	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2684.2	24.90183	2	1248.606247	1248.609865	K	V	365	376
PSM	AASSAAQGAFQGN	713	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2640.6	23.79332	2	1258.495647	1258.497946	R	-	317	330
PSM	SRSSDIVSSVR	714	sp|Q14C86|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2610.5	23.03783	2	1271.583647	1271.587095	R	R	900	911
PSM	GRLSKEEIER	715	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2451.3	19.14175	2	1295.621047	1295.623480	K	M	508	518
PSM	KSSTVATLQGTPDHGDPR	716	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2544.4	21.38002	3	1945.884971	1945.889485	R	T	154	172
PSM	ISVYYNEATGGK	717	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2783.5	27.42613	2	1300.628847	1300.629932	R	Y	47	59
PSM	LFSQGQDVSNK	718	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2859.4	29.29532	2	1301.560447	1301.565297	R	V	1797	1808
PSM	VAGQDGSVVQFK	719	sp|P61956|SUMO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2850.3	29.0678	2	1313.601247	1313.601682	K	I	22	34
PSM	GSNRSSLMDTADGVPVSSR	720	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2851.5	29.0997	3	2014.876871	2014.877934	K	V	254	273
PSM	SLSSSLDDTEVK	721	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2997.4	32.81232	2	1359.578247	1359.580672	K	K	156	168
PSM	SFTPDHVVYAR	722	sp|Q6NZI2|CAVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2922.4	30.90423	2	1370.598047	1370.602017	K	S	300	311
PSM	SVSLTGAPESVQK	723	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2814.5	28.15265	2	1381.647247	1381.649027	R	A	191	204
PSM	SPSASITDEDSNV	724	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2897.3	30.25965	2	1400.530847	1400.534450	R	-	999	1012
PSM	GILAADESTGSIAK	725	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2944.5	31.46945	2	1411.656647	1411.659591	K	R	29	43
PSM	SVQYDDVPEYK	726	sp|Q13740|CD166_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2957.5	31.79285	2	1421.570247	1421.575193	K	D	77	88
PSM	LAEALPKQSVDGK	727	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2646.2	23.93073	3	1434.710771	1434.711961	R	A	165	178
PSM	GASQAGMTGYGMPR	728	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2684.5	24.91183	2	1478.564447	1478.568351	R	Q	183	197
PSM	NGRVEIIANDQGNR	729	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2552.4	21.58213	3	1554.781271	1554.786266	K	I	47	61
PSM	QRNSSVAAAQLVR	730	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2768.3	27.04465	3	1558.701671	1558.701822	R	N	1380	1393
PSM	ERESLQQMAEVTR	731	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2847.3	28.9905	3	1655.729771	1655.733836	K	E	123	136
PSM	IVRGDQPAASGDSDDDEPPPLPR	732	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2860.5	29.3242	3	2483.091971	2483.096577	K	L	45	68
PSM	RNQSFCPTVNLDK	733	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2875.3	29.7031	3	1657.729571	1657.728357	K	L	65	78
PSM	SPSKPLPEVTDEYK	734	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2902.3	30.38442	3	1668.761171	1668.764785	R	N	92	106
PSM	KCSLPAEEDSVLEK	735	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2802.3	27.89305	3	1683.738971	1683.742669	K	L	634	648
PSM	NIRNSLQQPEGIDR	736	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2702.2	25.365	3	1718.803571	1718.810112	K	A	341	355
PSM	TASFSESRADEVAPAK	737	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2668.3	24.50287	3	1744.767071	1744.766910	R	K	453	469
PSM	SVLGEADQKGSLVAPDR	738	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2899.2	30.30533	3	1820.862971	1820.866958	R	L	617	634
PSM	ELGEKLSKDPNIVIAK	739	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2938.4	31.31435	3	1832.964071	1832.964882	K	M	418	434
PSM	QNPSRCSVSLSNVEAR	740	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2764.4	26.94425	3	1882.836371	1882.835675	R	R	721	737
PSM	SQRYSGAYGASVSDEELK	741	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2849.5	29.04883	3	2025.864071	2025.868081	K	R	46	64
PSM	SPLLRQSSSEQCSDGEGR	742	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2554.4	21.63348	3	2071.860071	2071.863012	R	K	666	684
PSM	THSVNGITEEADPTIYSGK	743	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2998.6	32.84497	3	2097.921971	2097.925596	K	V	582	601
PSM	RVSHQGYSTEAEFEEPR	744	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2711.3	25.5914	3	2100.885971	2100.890213	R	V	240	257
PSM	RKDSVWGSGGGQQSVNHLVK	745	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2735.3	26.20205	4	2218.064094	2218.064429	K	E	310	330
PSM	SSGGSEHSTEGSVSLGDGQLNR	746	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2757.6	26.76917	3	2239.928771	2239.934263	R	Y	381	403
PSM	RQTSGGPVDASSEYQQELER	747	sp|P18859|ATP5J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2934.4	31.21063	3	2316.001571	2316.001948	K	E	54	74
PSM	QGQGQSEPGEYEQRLSLQDR	748	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2856.4	29.21832	4	2384.036494	2384.039397	R	G	78	98
PSM	PVTHRKSDASDMNSDTSPSCR	749	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	7-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.2312.2	16.6599	4	2426.9908	2426.9939	M	L	2	23
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	750	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2554.5	21.64015	4	3188.308894	3188.312914	K	K	97	126
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	751	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2976.5	32.27325	4	3223.230094	3223.230486	K	-	122	148
PSM	MPSLPSYK	752	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3120.2	35.9226	2	1001.428047	1001.429321	R	V	303	311
PSM	GFSLEELR	753	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3414.2	43.35857	2	1029.455447	1029.453227	R	V	75	83
PSM	SVSSFPVPQDNVDTHPGSGK	754	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3000.2	32.88325	4	2133.938494	2133.936829	R	E	287	307
PSM	ALSRQLSSGVSEIR	755	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3094.3	35.27122	3	1661.757971	1661.753917	R	H	76	90
PSM	GDLGIEIPAEK	756	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3128.4	36.12857	2	1140.600847	1140.602654	R	V	295	306
PSM	NRPTSISWDGLDSGK	757	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3109.2	35.64712	3	1711.754771	1711.756680	K	L	48	63
PSM	SRESMIQLF	758	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3636.2	48.24973	2	1189.522647	1189.520261	K	-	449	458
PSM	AASPPASASDLIEQQQK	759	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3036.2	33.79887	3	1819.834871	1819.835324	R	R	333	350
PSM	TGTLQPWNSDSTLNSR	760	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3197.2	37.8726	3	1855.812971	1855.810172	K	Q	249	265
PSM	SADTLWDIQK	761	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	40.76508	2	1255.547447	1255.548584	K	D	320	330
PSM	SMDLGIADETK	762	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3133.3	36.25137	2	1258.512247	1258.515235	K	L	852	863
PSM	EGMNIVEAMER	763	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3294.2	40.35795	2	1277.576447	1277.574407	K	F	134	145
PSM	LAKLSDGVAVLK	764	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3100.3	35.42583	2	1292.709647	1292.710505	R	V	394	406
PSM	HSNSNSVDDTIVALNMR	765	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3212.4	38.2684	3	1951.849571	1951.845905	K	A	678	695
PSM	QASLDGLQQLR	766	sp|Q3MII6|TBC25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3170.5	37.18295	2	1307.622247	1307.623480	R	D	504	515
PSM	SLEDQVEMLR	767	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3147.5	36.61637	2	1314.552647	1314.552684	K	T	168	178
PSM	DAGQISGLNVLR	768	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3444.2	44.10652	2	1321.642447	1321.639131	K	V	207	219
PSM	TNSTFNQVVLK	769	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3100.4	35.42916	2	1329.631047	1329.632983	R	R	39	50
PSM	SLSLGEVLDGDR	770	sp|O15321|TM9S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3802.3	50.63565	2	1339.603047	1339.602076	K	M	76	88
PSM	QYSLQNWEAR	771	sp|P48637|GSHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	37.73028	2	1373.590047	1373.576530	R	L	274	284
PSM	SAEPAEALVLACK	772	sp|Q96CW6|S7A6O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3322.3	41.08275	2	1437.657647	1437.657483	R	R	16	29
PSM	TGSYGALAEITASK	773	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3327.3	41.21218	2	1447.659447	1447.659591	K	E	443	457
PSM	CSVLAAANPVYGR	774	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3124.5	36.0341	2	1456.654047	1456.653401	R	Y	446	459
PSM	SLYESFVSSSDR	775	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3285.6	40.13883	2	1455.593647	1455.591906	K	L	131	143
PSM	SGSLAVDNADPILK	776	sp|P35573|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3257.3	39.4164	2	1478.706447	1478.701790	K	I	876	890
PSM	TQIDELLRQSLS	777	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3498.3	45.40773	2	1481.713647	1481.712689	K	-	1082	1094
PSM	DQSVGDPKIDLIR	778	sp|Q14108|SCRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3147.4	36.61303	3	1534.740971	1534.739239	R	T	122	135
PSM	KTSFVNFTDICK	779	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3246.3	39.1362	3	1538.686571	1538.684032	K	L	216	228
PSM	SKESVPEFPLSPPK	780	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3202.5	38.01248	3	1620.767771	1620.780041	R	K	28	42
PSM	RASGQAFELILSPR	781	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3461.2	44.49053	3	1623.817271	1623.813407	K	S	14	28
PSM	TYSLGSALRPSTSR	782	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3173.2	37.25003	3	1654.713071	1654.711718	R	S	37	51
PSM	RMTGSEFDFEEMK	783	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3252.2	39.28505	3	1685.648471	1685.646660	K	R	423	436
PSM	QSFTMVADTPENLR	784	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	41.25706	3	1687.733771	1687.727688	K	L	60	74
PSM	KASPPSGLWSPAYASH	785	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3149.3	36.66078	3	1734.775871	1734.776687	R	-	1872	1888
PSM	LYGPSSVSFADDFVR	786	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3918.2	52.34575	3	1738.764371	1738.760368	R	S	134	149
PSM	SSSTSDILEPFTVER	787	sp|Q6GYQ0|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	50.16913	3	1746.774371	1746.771327	R	A	795	810
PSM	VQQTVQDLFGRAPSK	788	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3142.3	36.48193	3	1752.855671	1752.856000	K	A	395	410
PSM	ALRSDSYVELSQYR	789	sp|P52298|NCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3044.3	33.99665	3	1765.803071	1765.803630	K	D	8	22
PSM	VKSIDLPIQSSLCR	790	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3346.4	41.68238	3	1774.806371	1774.808989	K	Q	577	591
PSM	SYELPDGQVITIGNER	791	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3494.2	45.29942	3	1789.886771	1789.884643	K	F	241	257
PSM	TSDFNTFLAQEGCTK	792	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3438.2	43.95587	3	1797.733871	1797.728082	K	G	199	214
PSM	KGSLLIDSSTIDPAVSK	793	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	39.89622	3	1809.916271	1809.912512	K	E	125	142
PSM	QTGKTSIAIDTIINQK	794	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3230.5	38.73068	3	1809.925271	1809.923745	R	R	215	231
PSM	YMSQMSVPEQAELEK	795	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3359.4	42.01485	3	1848.778271	1848.767504	R	L	88	103
PSM	KLSSKGSFADLGLEPR	796	sp|Q9NUL7|DDX28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3182.2	37.48278	3	1863.856871	1863.853296	R	V	121	137
PSM	SGQGFHGNSEVNAILSPR	797	sp|Q8TB72|PUM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3199.3	37.93117	3	1948.881371	1948.879254	R	S	67	85
PSM	SLSEQPVMDTATATEQAK	798	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3039.4	33.87902	3	1985.865671	1985.865303	R	Q	49	67
PSM	KHSQFIGYPITLFVEK	799	sp|Q58FG0|HS905_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	50.58192	3	1986.006971	1986.001601	K	K	39	55
PSM	SSSFSSWDDSSDSYWKK	800	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3275.4	39.87408	3	2077.798571	2077.794247	R	E	365	382
PSM	RTGYESGEYEMLGEGLGVK	801	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3408.2	43.22495	3	2153.920271	2153.934052	K	E	78	97
PSM	YHTSQSGDEMTSLSEYVSR	802	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3121.5	35.95817	3	2175.937271	2175.937877	R	M	457	476
PSM	KQTIDNSQGAYQEAFDISKK	803	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3006.3	33.04113	4	2350.085694	2350.084221	R	E	139	159
PSM	TCSECQELFWGDPDVECR	804	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,2-UNIMOD:4,5-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3735.2	49.6661	3	2366.865371	2366.864335	R	A	1113	1131
PSM	TDGCHAYLSKNSLDCEIVSAK	805	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,12-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3003.2	32.96058	4	2447.046094	2447.049827	K	S	413	434
PSM	SNTKGSMSDGSYSPDYSLAAVDLK	806	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3292.4	40.31956	3	2588.104871	2588.098945	R	S	475	499
PSM	SLSNKLTLDK	807	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3113.3	35.74868	2	1239.6092	1239.6107	M	L	2	12
PSM	SGDEMIFDPTMSK	808	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4115.2	54.75618	2	1578.6007	1578.5978	M	K	2	15
PSM	SGDEMIFDPTMSK	809	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.4054.2	54.06893	2	1610.5887	1610.5876	M	K	2	15
PSM	QLSILVHPDKNQDDADR	810	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3659.2	48.48832	3	2025.9167	2025.9152	R	A	79	96
PSM	QLEDGRTLSDYNIQK	811	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3268.2	39.69232	3	1841.8243	1841.8191	K	E	49	64
PSM	MEPSSLELPADTVQR	812	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	50.60383	3	1793.7935	1793.7902	-	I	1	16
PSM	MEPSSLELPADTVQR	813	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3431.3	43.77962	3	1809.7898	1809.7851	-	I	1	16
PSM	ATGANATPLDFPSK	814	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3454.4	44.35713	2	1510.6712	1510.6700	M	K	2	16
PSM	AAAAAAAGDSDSWDADAFSVEDPVRK	815	sp|O75822|EIF3J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	51.11615	3	2714.1592	2714.1492	M	V	2	28
PSM	STGTFVVSQPLNYR	816	sp|P49189|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3811.2	50.83103	2	1689.7773	1689.7758	M	G	2	16
PSM	STGGDFGNPLRK	817	sp|P20340|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3015.5	33.27773	2	1369.6001	1369.6022	M	F	2	14
PSM	SDAAVDTSSEITTK	818	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.2898.5	30.29075	2	1545.6389	1545.6442	M	D	2	16
PSM	SPSTLLPK	819	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2946.2	31.50935	2	921.457447	921.457250	R	K	825	833
PSM	RLSDYSIGPNSK	820	sp|P11441|UBL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2790.2	27.58962	3	1415.643371	1415.644610	K	L	55	67
PSM	SCNCLLLK	821	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2793.2	27.66642	2	1006.493247	1006.493973	K	V	336	344
PSM	KMSNALAIQVDSEGK	822	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2959.2	31.83432	3	1669.770971	1669.774638	K	I	81	96
PSM	GMGSLDAMDK	823	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2593.3	22.59327	2	1119.395647	1119.397763	R	H	413	423
PSM	SSEDSGSRKDSSSEVFSDAAK	824	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2555.5	21.66233	4	2254.921694	2254.922695	K	E	914	935
PSM	NLQTVNVDEN	825	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2728.3	26.0224	2	1144.533647	1144.536031	K	-	116	126
PSM	IYQYIQSR	826	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2642.2	23.83158	2	1149.518047	1149.521975	R	F	318	326
PSM	SIDTGMGLER	827	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	31.83765	2	1157.474047	1157.478790	K	L	237	247
PSM	QASVTLQPLK	828	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2977.3	32.2924	2	1163.593847	1163.595140	R	I	251	261
PSM	NPSTVCLCPEQPTCSNADSR	829	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2915.5	30.72637	4	2371.916494	2371.923247	R	A	37	57
PSM	NSSISGPFGSR	830	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2878.4	29.78477	2	1187.494647	1187.497217	R	S	483	494
PSM	SFAGNLNTYK	831	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2957.2	31.78285	2	1193.506647	1193.511805	R	R	386	396
PSM	NLQYYDISAK	832	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2942.2	31.41015	2	1213.595447	1213.597903	K	S	143	153
PSM	KRPSWFTQN	833	sp|Q9BYC8|RM32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2788.5	27.54937	2	1242.554447	1242.554673	R	-	180	189
PSM	RKSHEAEVLK	834	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2286.2	16.37212	3	1275.632471	1275.633651	R	Q	61	71
PSM	KSIDTGMGLER	835	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2723.4	25.89698	2	1285.569247	1285.573753	K	L	236	247
PSM	RKDSAIQQQVANLQMK	836	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2903.5	30.417	3	1936.950071	1936.955396	R	I	1227	1243
PSM	KSSADTEFSDECTTAER	837	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2607.5	22.9603	3	2012.765171	2012.767046	R	V	1200	1217
PSM	NFSDNQLQEGK	838	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2713.4	25.64517	2	1358.547047	1358.550375	R	N	161	172
PSM	SGSSSSSSGTPASQLYPQSR	839	sp|O15066|KIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2833.5	28.63582	3	2049.859871	2049.864058	K	G	723	743
PSM	DSVFLSCSEDNR	840	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2897.5	30.26632	2	1427.594047	1427.598708	K	I	180	192
PSM	IHRASDPGLPAEEPKEK	841	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2498.2	20.26933	4	1952.936494	1952.935707	R	S	1855	1872
PSM	RKGTEVQVDDIK	842	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2500.2	20.3205	3	1466.714171	1466.713024	K	R	416	428
PSM	SRWNQDTMEQK	843	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2553.5	21.61122	3	1501.596971	1501.602093	R	T	20	31
PSM	ATSISTQLPDDPAK	844	sp|Q9UJW0|DCTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2955.2	31.73193	3	1522.689671	1522.691620	R	T	87	101
PSM	RHNSASVENVSLR	845	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2558.2	21.72962	3	1547.720471	1547.720569	K	K	1171	1184
PSM	RGSIGENQIKDEK	846	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2433.5	18.72322	3	1552.721471	1552.724651	K	I	200	213
PSM	VPSPLEGSEGDGDTD	847	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2956.5	31.7672	2	1553.574447	1553.577043	K	-	413	428
PSM	KRSSTLSQLPGDK	848	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2604.3	22.8767	3	1575.704771	1575.705904	K	S	591	604
PSM	QIRSSTTSMTSVPK	849	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2617.2	23.20247	3	1601.743871	1601.748423	R	P	81	95
PSM	SMSVYCTPNKPSR	850	sp|P16615|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2634.4	23.63555	3	1605.665471	1605.668065	K	T	493	506
PSM	GRLESAQATFQAHR	851	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2713.3	25.64183	3	1650.758771	1650.762768	R	D	256	270
PSM	RKQSSSEISLAVER	852	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2690.2	25.05573	3	1668.816671	1668.819614	R	A	453	467
PSM	RNSNSPPSPSSMNQR	853	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2456.5	19.26707	3	1737.721871	1737.725396	R	R	453	468
PSM	GRSSFYPDGGDQETAK	854	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2596.4	22.67382	3	1793.719871	1793.725773	R	T	317	333
PSM	QQNRPSVITCASAGAR	855	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2613.2	23.10447	3	1794.818471	1794.819631	R	N	158	174
PSM	QLVRGEPNVSYICSR	856	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2936.3	31.2593	3	1856.860571	1856.860433	K	Y	269	284
PSM	RRSSSVVSAEMSGCSSK	857	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2583.5	22.34288	3	1973.767271	1973.773743	R	S	290	307
PSM	SGSTSSLSYSTWTSSHSDK	858	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2963.5	31.94727	3	2083.835171	2083.837174	R	T	197	216
PSM	SRTHSTSSSLGSGESPFSR	859	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2738.2	26.2764	4	2125.849694	2125.846708	R	S	327	346
PSM	RATAESASECLPCDCNGR	860	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.2598.6	22.73203	3	2132.802071	2132.807489	R	S	330	348
PSM	NPSTVCLCPEQPTCSNADSR	861	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2917.6	30.78147	3	2371.915271	2371.923247	R	A	37	57
PSM	QRASQDTEDEESGASGSDSGGSPLR	862	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2532.4	21.08673	3	2602.032371	2602.041641	R	G	7	32
PSM	RVSVCAETYNPDEEEEDTDPRVIHPK	863	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2908.4	30.54262	5	3164.372118	3164.375789	R	T	97	123
PSM	MPSLPSYK	864	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3128.2	36.1219	2	1001.428047	1001.429321	R	V	303	311
PSM	MPSLPSYK	865	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3103.2	35.50012	2	1001.428047	1001.429321	R	V	303	311
PSM	MPSLPSYK	866	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3112.2	35.72078	2	1001.428047	1001.429321	R	V	303	311
PSM	GFSLEELR	867	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3405.3	43.1423	2	1029.455447	1029.453227	R	V	75	83
PSM	SLPGLASSVK	868	sp|Q9NUL7|DDX28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	34.85388	2	1037.514647	1037.515827	R	E	524	534
PSM	HGSLGFLPR	869	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3065.3	34.52445	2	1062.500247	1062.501180	R	K	11	20
PSM	TGSLQLICK	870	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3009.3	33.11887	2	1098.511847	1098.514448	K	S	175	184
PSM	ALLLLCGEDD	871	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3680.2	48.79552	2	1117.532847	1117.532526	K	-	311	321
PSM	SIFEYEPGK	872	sp|O94875|SRBS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3149.2	36.65745	2	1148.478447	1148.479108	R	S	211	220
PSM	GSPESRLSFQHDPETSVLVLR	873	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	41.23143	4	2433.178094	2433.168954	K	K	909	930
PSM	RLGSLVDEFK	874	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3348.3	41.73057	2	1242.601847	1242.600954	K	E	517	527
PSM	RLGSLVDEFK	875	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3339.3	41.50337	2	1242.601847	1242.600954	K	E	517	527
PSM	NLSMPDLENR	876	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	39.44223	2	1267.527847	1267.526803	R	L	256	266
PSM	LNLQNKQSLTMDPVVK	877	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3122.2	35.97362	3	1906.962071	1906.958750	K	S	749	765
PSM	DAGTIAGLNVLR	878	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3631.2	48.17558	2	1278.634647	1278.633317	K	I	160	172
PSM	RLSSVMCDSDESDDSDILVRK	879	sp|Q8N4S0|CCD82_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3351.4	41.80995	4	2586.054094	2586.038016	K	V	184	205
PSM	DMGSVALDAGTAK	880	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	33.2744	2	1314.548847	1314.552683	K	D	298	311
PSM	SSSMSSIDLVSASDDVHR	881	sp|Q9Y5P4|CERT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3167.3	37.10546	3	1971.82627064349	1971.8245009450702	R	F	375	393
PSM	AFSDPFVEAEK	882	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3417.3	43.43548	2	1318.550447	1318.548250	R	S	74	85
PSM	MSLPDVDLDLK	883	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3951.3	52.80738	2	1324.598847	1324.598571	K	G	1067	1078
PSM	KITIADCGQLE	884	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3027.4	33.58028	2	1326.587447	1326.589069	K	-	155	166
PSM	TTSFFLNSPEK	885	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3264.5	39.6036	2	1349.593247	1349.590449	R	E	1276	1287
PSM	AITGASLADIMAK	886	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3568.2	47.01255	2	1356.638847	1356.636019	R	R	81	94
PSM	SFSTALYGESDL	887	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4029.2	53.71321	2	1368.550847	1368.548644	K	-	900	912
PSM	RASSLNVLNVGGK	888	sp|Q07866-4|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3160.5	36.9402	2	1473.671047	1473.674210	K	A	597	610
PSM	SLPVPGALEQVASR	889	sp|O95785-3|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3595.2	47.50335	3	1502.748971	1502.749409	K	L	12	26
PSM	LTFDTTFSPNTGK	890	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	41.08942	2	1507.663647	1507.659591	K	K	108	121
PSM	KNSVPVTVAMVER	891	sp|Q9Y3T9|NOC2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3007.2	33.06358	3	1508.739671	1508.742215	K	W	144	157
PSM	DHQYQFLEDAVR	892	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3196.2	37.84675	3	1519.710671	1519.705556	K	N	239	251
PSM	GREFSFEAWNAK	893	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3274.2	39.84238	3	1520.649671	1520.644944	R	I	718	730
PSM	GYSFSLTTFSPSGK	894	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3817.4	50.98177	2	1557.677647	1557.675241	R	L	5	19
PSM	KYSSLNLFDTYK	895	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3420.4	43.51439	3	1557.711971	1557.711627	K	G	16	28
PSM	GSFSEQGINEFLR	896	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3734.2	49.63075	3	1562.681171	1562.676638	K	E	374	387
PSM	ALSSDSILSPAPDAR	897	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3227.6	38.6574	2	1578.731047	1578.729068	R	A	392	407
PSM	DVTPPPETEVVLIK	898	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3525.2	46.02115	3	1615.814771	1615.811007	K	N	519	533
PSM	SMGGAAIAPPTSLVEK	899	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3189.6	37.67818	2	1623.754047	1623.757926	R	D	169	185
PSM	SSLGSLQTPEAVTTR	900	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3097.5	35.35477	2	1625.764447	1625.766182	R	K	386	401
PSM	QAGSVGGLQWCGEPK	901	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3160.6	36.94353	2	1652.703647	1652.701807	R	R	190	205
PSM	SYSPYDMLESIRK	902	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3673.2	48.69233	3	1667.727971	1667.726625	K	E	234	247
PSM	AKSAIESDVDFWDK	903	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3359.3	42.01152	3	1689.732071	1689.728733	R	L	277	291
PSM	NRPTSISWDGLDSGK	904	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3156.5	36.84165	2	1711.756847	1711.756680	K	L	48	63
PSM	SQGSQAELHPLPQLK	905	sp|Q15172|2A5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3015.2	33.26773	3	1711.824671	1711.829451	R	D	46	61
PSM	RTSSEDNLYLAVLR	906	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3450.2	44.2407	3	1715.825171	1715.824365	K	A	18	32
PSM	DVAEAKPELSLLGDGDH	907	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3255.2	39.36148	3	1764.857471	1764.853008	R	-	232	249
PSM	IRYESLTDPSKLDSGK	908	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3037.4	33.82998	3	1887.900071	1887.897924	K	E	54	70
PSM	RSTQGVTLTDLQEAEK	909	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3178.3	37.38257	3	1934.838971	1934.838769	R	T	694	710
PSM	NASTFEDVTQVSSAYQK	910	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.6	40.80422	3	1953.837971	1953.835718	K	T	320	337
PSM	TSDANETEDHLESLICK	911	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3364.4	42.14385	3	2040.836771	2040.834732	K	V	21	38
PSM	SQEKPREIMDAAEDYAK	912	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3084.2	35.00813	4	2059.906494	2059.892187	K	E	10	27
PSM	KLSLGQYDNDAGGQLPFSK	913	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3421.5	43.54337	3	2116.988771	2116.983051	R	C	774	793
PSM	DNLTLWTSDQQDDDGGEGNN	914	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3468.3	44.68102	3	2192.877371	2192.873028	R	-	228	248
PSM	QNSATESADSIEIYVPEAQTR	915	sp|Q9Y2H0|DLGP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	45.38883	3	2388.054671	2388.048230	R	L	971	992
PSM	DNLTLWTSDTQGDEAEAGEGGEN	916	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3538.4	46.31158	3	2407.989071	2407.988786	R	-	223	246
PSM	TLNDRSSIVMGEPISQSSSNSQ	917	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3090.5	35.17367	3	2416.058771	2416.057749	R	-	762	784
PSM	TSSISGPLSPAYTGQVPYNYNQLEGR	918	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3709.2	49.21055	4	2878.322894	2878.317469	R	F	6	32
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	919	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3121.6	35.9615	4	3221.395294	3221.393230	R	S	38	70
PSM	DDDIAALVVDNGSGMCK	920	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4494.3	58.27467	2	1900.7582	1900.7579	M	A	2	19
PSM	DRSSFYVNGLTLGGQK	921	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3324.4	41.13443	3	1821.846371	1820.845829	K	C	55	71
PSM	ASQSQGIQQLLQAEK	922	sp|O75348|VATG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3909.2	52.25123	3	1749.8335	1749.8293	M	R	2	17
PSM	HQGVMVGMGQKDCYVGDEAQSK	923	sp|Q562R1|ACTBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:35,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2497.5	20.25373	4	2519.045694	2519.028046	R	R	41	63
PSM	AVRASFENNCEIGCFAK	924	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,5-UNIMOD:21,10-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3412.5	43.31953	3	2093.8763	2093.8695	M	L	2	19
PSM	SQDTEVDMKEVELNELEPEK	925	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3602.3	47.69355	3	2483.0680	2483.0657	M	Q	2	22
PSM	NMSYQGFTK	926	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2659.3	24.2702	2	1171.449447	1170.441677	R	D	333	342
PSM	ATSNVFAMFDQSQIQEFK	927	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.4033.3	53.786	3	2185.940771	2185.939137	R	E	17	35
PSM	SSGGSYRDSYDSYATHNE	928	sp|Q14011|CIRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2643.6	23.8693	3	2074.748471	2074.754173	R	-	155	173
PSM	STDTGVSLPSYEEDQGSK	929	sp|Q9Y241|HIG1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3294.4	40.36462	3	2020.8163	2020.8145	M	L	2	20
PSM	SIMSYNGGAVMAMK	930	sp|P49720|PSB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3946.3	52.69333	2	1580.6435	1580.6433	M	G	2	16
PSM	RLSQSDEDVIR	931	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2665.2	24.4226	3	1396.633271	1396.634773	K	L	119	130
PSM	LRSDAGLESDTAMK	932	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2509.5	20.56213	3	1588.678871	1588.680403	K	K	5	19
PSM	KLGDMRNSATFK	933	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.2455.3	19.23437	3	1462.660871	1462.663965	R	S	154	166
PSM	KLSEIMEK	934	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2748.2	26.52687	2	1056.489447	1056.492649	K	G	56	64
PSM	LMELHGEGSSSGK	935	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2596.2	22.66715	3	1410.582671	1410.585046	K	A	228	241
PSM	LSDGVAVLK	936	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2791.2	27.61473	2	900.529847	900.528033	K	V	397	406
PSM	RVSGDAAQDLDR	937	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2513.2	20.65568	3	1381.596071	1381.598722	R	G	558	570
PSM	LGAPALTSR	938	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2762.2	26.88557	2	964.472647	964.474297	R	Q	426	435
PSM	AQALRDNSTMGYMAAKK	939	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2508.3	20.52932	4	1950.864494	1950.869284	K	H	616	633
PSM	RKNSTGSGHSAQELPTIR	940	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2567.4	21.96255	4	2017.965694	2017.969466	K	T	369	387
PSM	MPSLPSYK	941	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2881.2	29.85177	2	1017.420447	1017.424236	R	V	303	311
PSM	MPSLPSYK	942	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2855.2	29.18697	2	1017.422047	1017.424236	R	V	303	311
PSM	MPSLPSYK	943	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2847.2	28.98717	2	1017.422247	1017.424236	R	V	303	311
PSM	MPSLPSYK	944	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2831.3	28.57752	2	1017.422247	1017.424236	R	V	303	311
PSM	MPSLPSYK	945	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2839.2	28.78045	2	1017.422247	1017.424236	R	V	303	311
PSM	MPSLPSYK	946	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2823.3	28.37377	2	1017.422647	1017.424236	R	V	303	311
PSM	KASISYFK	947	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2752.2	26.62718	2	1022.481847	1022.483799	R	N	77	85
PSM	RTSINVVR	948	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2534.2	21.12182	2	1023.518447	1023.522644	R	H	682	690
PSM	KLSEFGIR	949	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2989.3	32.60213	2	1028.503847	1028.505597	K	N	505	513
PSM	NNSVSGLSVK	950	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2665.4	24.42927	2	1083.495447	1083.496155	R	S	498	508
PSM	KGSFSALVGR	951	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2886.2	29.97952	2	1100.534647	1100.537960	R	T	8	18
PSM	TASVPLDAVR	952	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2961.2	31.88577	2	1107.528847	1107.532540	R	A	127	137
PSM	RLSAPLPSSCGDPEK	953	sp|Q96EP0|RNF31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2773.4	27.17793	3	1692.750971	1692.754237	R	Q	464	479
PSM	DYHFKVDNDENEHQLSLR	954	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2938.3	31.31102	4	2258.036094	2258.035223	K	T	28	46
PSM	ENILRASHSAVDITK	955	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2838.4	28.76127	3	1732.845071	1732.850914	K	V	297	312
PSM	RGGSGSHNWGTVKDELTESPK	956	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2869.4	29.55142	4	2321.042494	2321.043754	K	Y	216	237
PSM	ASGNYATVISHNPETK	957	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2774.4	27.20382	3	1767.783371	1767.782894	R	K	129	145
PSM	NPPGGKSSLVLG	958	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2844.2	28.90957	2	1204.583047	1204.585304	R	-	143	155
PSM	AVANTMRTSLGPNGLDK	959	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2867.4	29.49998	3	1823.855171	1823.860099	K	M	43	60
PSM	DRVTDALNATR	960	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2783.4	27.4228	2	1230.629447	1230.631663	K	A	419	430
PSM	DQVANSAFVER	961	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2719.2	25.78905	2	1234.590647	1234.594215	K	L	500	511
PSM	VAEDEAEAAAAAK	962	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	19.0		ms_run[1]:scan=1.1.2506.4	20.48122	2	1244.5782470956601	1244.5884603914	K	F	47	60
PSM	RLSEDYGVLK	963	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2900.4	30.33688	2	1258.594247	1258.595869	R	T	110	120
PSM	RLSEDYGVLK	964	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2891.5	30.1186	2	1258.594247	1258.595869	R	T	110	120
PSM	DNSTMGYMAAK	965	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2766.3	26.99283	2	1267.458447	1267.461425	R	K	621	632
PSM	SMGLPTSDEQK	966	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2747.4	26.50927	2	1271.508047	1271.510484	K	K	298	309
PSM	DNSTMGYMAAK	967	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2538.5	21.23323	2	1283.452847	1283.456340	R	K	621	632
PSM	RKFSMEPGDEDLDCDNDHVSK	968	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2762.4	26.89223	4	2573.016094	2573.019983	K	M	56	77
PSM	EALQDVEDENQ	969	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2730.5	26.08032	2	1288.539847	1288.541905	K	-	245	256
PSM	GRLSKEEIER	970	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2453.4	19.18642	3	1295.624771	1295.623480	K	M	508	518
PSM	QQSEISAAVER	971	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2699.5	25.29782	2	1296.568047	1296.571111	R	A	451	462
PSM	KGSSSSVCSVASSSDISLGSTKTER	972	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2836.4	28.70972	4	2596.166894	2596.168756	R	R	1382	1407
PSM	KRSEGFSMDR	973	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2302.2	16.55878	3	1307.533571	1307.532951	R	K	452	462
PSM	DMGSVALDAGTAK	974	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2642.4	23.83825	2	1330.545847	1330.547598	K	D	298	311
PSM	ELISNASDALDK	975	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2988.6	32.58622	2	1354.597247	1354.601742	R	I	103	115
PSM	GEPNVSYICSR	976	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2813.4	28.12448	2	1360.544847	1360.548267	R	Y	273	284
PSM	RSSPPGHYYQK	977	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2373.3	17.3634	3	1398.609971	1398.608165	R	S	121	132
PSM	SPSASITDEDSNV	978	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2889.4	30.0638	2	1400.530847	1400.534450	R	-	999	1012
PSM	RVSLVGADDLRK	979	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2763.2	26.91165	3	1407.721271	1407.723529	K	M	1376	1388
PSM	KNSVHEQEAINSDPELSNCENFQK	980	sp|Q8IX90|SKA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.2840.5	28.81627	4	2896.229694	2896.233482	K	T	108	132
PSM	SCFESSPDPELK	981	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2886.5	29.98952	2	1474.563647	1474.568728	R	S	871	883
PSM	EKGSFSDTGLGDGK	982	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2612.6	23.0932	2	1476.607647	1476.613369	K	M	374	388
PSM	GASQAGMTGYGMPR	983	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2675.5	24.6886	2	1478.564447	1478.568351	R	Q	183	197
PSM	PCSEETPAISPSK	984	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2561.4	21.8125	2	1481.6059	1481.6104	M	R	2	15
PSM	GASQAGMTGYGMPR	985	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=1.1.2477.5	19.78678	2	1494.562247	1494.563266	R	Q	183	197
PSM	QGSIPSTQEMEAR	986	sp|Q96K21|ANCHR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2781.5	27.3812	2	1512.629647	1512.627974	R	L	211	224
PSM	GAGSIREAGGAFGKR	987	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2609.3	23.00537	3	1512.716771	1512.719840	R	E	36	51
PSM	RGVSCQFGPDVTK	988	sp|P53041|PPP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2753.6	26.66618	2	1529.666047	1529.669779	K	A	400	413
PSM	SQSMDIDGVSCEK	989	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2572.5	22.09037	2	1550.557247	1550.562991	R	S	103	116
PSM	SQSMDIDGVSCEK	990	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2582.6	22.32058	2	1550.558647	1550.562991	R	S	103	116
PSM	NIIHGSDSVESAEK	991	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2626.3	23.43258	3	1564.675271	1564.677032	R	E	115	129
PSM	NGSLDSPGKQDTEEDEEEDEK	992	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2447.5	19.0422	3	2349.953471	2349.956818	K	D	134	155
PSM	SDSRGKSSFFSDR	993	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2739.2	26.30228	3	1634.608271	1634.612732	R	G	76	89
PSM	RSSWRVVSSIEQK	994	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2859.2	29.28865	3	1640.797571	1640.803570	R	T	56	69
PSM	SASSGAEGDVSSEREP	995	sp|Q8TEA8|DTD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2533.5	21.10752	2	1643.628447	1643.631204	R	-	194	210
PSM	SQSRSNSPLPVPPSK	996	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2715.3	25.69223	3	1659.798371	1659.798150	R	A	297	312
PSM	RNSSSPVSPASVPGQR	997	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2599.3	22.74782	3	1704.791471	1704.794462	R	R	655	671
PSM	GTSFDAAATSGGSASSEK	998	sp|P13804|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2601.3	22.79947	3	1709.676971	1709.678155	R	A	170	188
PSM	RVSRSSFSSDPDEK	999	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2442.5	18.91433	3	1755.685271	1755.686625	R	A	123	137
PSM	QLVRGEPNVSYICSR	1000	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2928.2	31.04927	3	1856.860571	1856.860433	K	Y	269	284
PSM	AQALRDNSTMGYMMAK	1001	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2961.4	31.89243	3	1866.784871	1866.782776	K	K	481	497
PSM	RRPSDENTIAPSEVQK	1002	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2498.4	20.276	3	1905.896471	1905.894570	R	W	791	807
PSM	ERHPSWRSEETQER	1003	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2441.3	18.8821	4	1905.812894	1905.811903	R	E	402	416
PSM	TASETRSEGSEYEEIPK	1004	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2744.5	26.43992	3	1991.831471	1991.836112	R	R	1083	1100
PSM	SVSTPSEAGSQDSGDGAVGSR	1005	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2546.6	21.43573	3	2029.821971	2029.822587	K	T	92	113
PSM	EFHLNESGDPSSKSTEIK	1006	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2760.6	26.8472	3	2083.907171	2083.909945	K	W	155	173
PSM	KLSSWDQAETPGHTPSLR	1007	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2955.5	31.74193	3	2088.957371	2088.962984	K	W	214	232
PSM	TSSTCSNESLSVGGTSVTPR	1008	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2908.5	30.54595	3	2105.886071	2105.893644	R	R	749	769
PSM	QKNSGQNLEEDMGQSEQK	1009	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2618.5	23.23668	3	2128.869071	2128.873242	K	A	33	51
PSM	SQSESSDEVTELDLSHGKK	1010	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2764.5	26.94758	3	2154.927671	2154.931803	R	D	657	676
PSM	RTSSTCSNESLSVGGTSVTPR	1011	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2764.6	26.95092	3	2261.989571	2261.994755	K	R	748	769
PSM	SVSVDSGEQREAGTPSLDSEAK	1012	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2743.6	26.41893	3	2328.006071	2328.011844	R	E	116	138
PSM	LVSLIGSK	1013	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3230.2	38.72068	2	895.478647	895.477985	R	T	108	116
PSM	KLSFDFQ	1014	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	42.74253	2	963.412647	963.410300	R	-	465	472
PSM	NVSIGIVGK	1015	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3061.2	34.41755	2	965.496447	965.494698	K	D	209	218
PSM	RLSELLR	1016	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3044.2	33.99332	2	965.505047	965.505931	R	Y	450	457
PSM	RLSELLR	1017	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3035.2	33.77457	2	965.505047	965.505931	R	Y	450	457
PSM	DLTDYLMK	1018	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3479.2	44.94036	2	997.481647	997.479034	R	I	186	194
PSM	MPSLPSYK	1019	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3136.2	36.32442	2	1001.428047	1001.429321	R	V	303	311
PSM	GLTSVINQK	1020	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3034.2	33.75032	2	1038.507847	1038.511076	R	L	300	309
PSM	SISLEPLQK	1021	sp|Q8N0T1|RBIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3180.2	37.431	2	1093.543247	1093.542042	K	E	67	76
PSM	DASLMVTNDGATILK	1022	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3280.3	39.99972	3	1643.748671	1643.747755	R	N	58	73
PSM	NLSTFAVDGK	1023	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3108.3	35.62592	2	1130.500047	1130.500906	K	D	142	152
PSM	GSSIFGLAPSK	1024	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3315.3	40.9013	2	1142.538247	1142.537291	R	A	390	401
PSM	DIVENYFMRDSGSK	1025	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3400.2	43.01458	3	1739.728271	1739.722602	K	A	128	142
PSM	RATISSPLELEGTVSR	1026	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	38.56767	3	1794.891971	1794.887694	R	H	194	210
PSM	SADTLWGIQK	1027	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3296.3	40.413	2	1197.543447	1197.543105	K	E	319	329
PSM	SIYYITGESK	1028	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3024.4	33.50248	2	1239.540847	1239.542436	K	E	258	268
PSM	SYDVPPPPMEPDHPFYSNISK	1029	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3439.2	43.98143	4	2496.076494	2496.070880	R	D	118	139
PSM	SFEAPATINSASLHPEK	1030	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3007.5	33.07358	3	1877.852471	1877.856059	K	E	219	236
PSM	ASGPPVSELITK	1031	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3200.2	37.95378	2	1277.627247	1277.626835	K	A	35	47
PSM	EGLSACQQSGFPAVLSSK	1032	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3346.5	41.68572	3	1944.869171	1944.865244	K	R	183	201
PSM	NQRGSFEAPRYEGSFPAGPPPTR	1033	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3043.2	33.9725	4	2597.184094	2597.181250	R	A	75	98
PSM	SSSGLLEWESK	1034	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3328.3	41.23477	2	1301.555247	1301.554064	R	S	542	553
PSM	NASTFEDVTQVSSAYQK	1035	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.3	41.00165	3	1953.837971	1953.835718	K	T	320	337
PSM	SPSISNMAALSR	1036	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3123.3	36.00222	2	1312.585847	1312.584652	R	A	341	353
PSM	SIQEELQQLR	1037	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3322.2	41.07608	2	1322.623447	1322.623146	R	Q	1554	1564
PSM	SADTLWDIQK	1038	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3581.2	47.2787	2	1335.513447	1335.514915	K	D	320	330
PSM	EFSPFGSITSAK	1039	sp|Q13310|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	45.481	2	1349.591847	1349.590449	K	V	313	325
PSM	DNQHQGSYSEGAQMNGIQPEEIGR	1040	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3066.4	34.55375	4	2724.126094	2724.123537	K	L	711	735
PSM	GNSDGYIIPINK	1041	sp|O95490|AGRL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3244.2	39.08113	2	1369.629047	1369.627897	R	E	1428	1440
PSM	RLDSDAVNTIESQSVSPDHNKEPK	1042	sp|Q9H3H1|MOD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3039.5	33.88235	4	2745.258894	2745.260682	R	E	428	452
PSM	SGSLDSELSVSPK	1043	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3021.5	33.42813	2	1384.619447	1384.612307	K	R	2718	2731
PSM	TMSVSDFNYSR	1044	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3145.4	36.56178	2	1385.532447	1385.532282	R	T	1156	1167
PSM	STGSFVGELMYK	1045	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	47.84087	2	1397.594447	1397.593820	R	N	361	373
PSM	MFGSSVDLGNLGQ	1046	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4370.2	57.36627	2	1403.579247	1403.579232	K	-	392	405
PSM	DMTSEQLDDILK	1047	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3525.5	46.03115	2	1406.660647	1406.659911	K	Y	672	684
PSM	TFVSDLLPPTDK	1048	sp|Q7Z4Q2|HEAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3686.2	48.87247	2	1411.663647	1411.663614	K	E	340	352
PSM	AITGASLADIMAK	1049	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3813.4	50.87468	2	1420.608647	1420.607435	R	R	81	94
PSM	SPSLGSDLTFATR	1050	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	43.88948	2	1430.648047	1430.644276	R	T	393	406
PSM	TKQSTVLAPVIDLK	1051	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	40.81682	3	1591.862171	1591.858625	R	R	45	59
PSM	SMGGAAIAPPTSLVEK	1052	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3334.4	41.39314	2	1607.762647	1607.763011	R	D	169	185
PSM	DPGSVGDTIPSAELVK	1053	sp|Q14997|PSME4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3350.6	41.79135	2	1663.771247	1663.770598	R	R	1743	1759
PSM	QQFSISEDQPLGLK	1054	sp|Q10571|MN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3436.2	43.90493	3	1668.778271	1668.776018	R	G	1165	1179
PSM	YDSRTTIFSPEGR	1055	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3026.2	33.54788	3	1687.665971	1687.664433	R	L	5	18
PSM	IKRDSQGELMVYPYYGEK	1056	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3088.3	35.11526	4	2255.042494	2255.033372	R	S	1579	1597
PSM	MSGGWELELNGTEAK	1057	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3375.2	42.41993	3	1716.709571	1716.706618	K	L	105	120
PSM	AMSEVTSLHEDDWR	1058	sp|Q86X29|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3225.3	38.59638	3	1754.700071	1754.697116	R	S	430	444
PSM	TITLEVEPSDTIENVK	1059	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3302.2	40.55995	3	1786.923971	1786.920025	K	A	12	28
PSM	SRQGSTQGRLDDFFK	1060	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3052.2	34.19013	3	1820.821571	1820.820677	K	V	331	346
PSM	HVPDSGATATAYLCGVK	1061	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3062.4	34.45013	3	1825.805471	1825.807001	K	G	110	127
PSM	HVPDSGATATAYLCGVK	1062	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3083.4	34.98885	3	1825.805471	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	1063	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3355.4	41.91205	3	1830.823871	1830.822317	R	A	107	124
PSM	KFSYDLSQCINQMK	1064	sp|Q8NBJ4|GOLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3370.3	42.2946	3	1840.804571	1840.788908	R	E	151	165
PSM	YQESLGNTVFELENR	1065	sp|O43164|PJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3685.2	48.84677	3	1877.817671	1877.819674	R	E	193	208
PSM	SSSFSSWDDSSDSYWK	1066	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3563.2	46.90668	3	1949.704871	1949.699284	R	K	365	381
PSM	MASNIFGPTEEPQNIPK	1067	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3286.2	40.1514	3	1967.872571	1967.869995	R	R	43	60
PSM	FSVCVLGDQQHCDEAK	1068	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3112.3	35.72412	3	1971.786071	1971.785614	K	A	63	79
PSM	SCGSSTPDEFPTDIPGTK	1069	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3267.5	39.67722	3	1974.793271	1974.791804	R	G	104	122
PSM	SWMEGLTLQDYSEHCK	1070	sp|O00487|PSDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3553.2	46.6529	3	2062.819571	2062.816579	K	H	224	240
PSM	SVSSFPVPQDNVDTHPGSGK	1071	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	33.02198	3	2133.933371	2133.936829	R	E	287	307
PSM	YAALSVDGEDENEGEDYAE	1072	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3296.5	40.423	3	2154.790871	2154.779050	K	-	593	612
PSM	RKTSDFNTFLAQEGCTK	1073	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3117.5	35.85522	3	2161.890971	2161.890487	R	G	197	214
PSM	EAKNSDVLQSPLDSAARDEL	1074	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3398.2	42.96972	3	2237.027171	2237.021287	R	-	603	623
PSM	YHTSQSGDEMTSLSEYVSR	1075	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3252.4	39.29172	3	2255.910371	2255.904208	R	M	457	476
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1076	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3572.3	47.12003	3	2407.989071	2407.988786	R	-	223	246
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1077	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3146.2	36.58083	5	3562.493618	3562.491898	K	V	60	92
PSM	DDDIAALVVDNGSGMCK	1078	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3768.2	50.1439	3	1836.7913	1836.7865	M	A	2	19
PSM	SMPDAMPLPGVGEELK	1079	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4087.2	54.48435	2	1807.7807	1807.7768	M	Q	2	18
PSM	SMPDAMPLPGVGEELK	1080	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4691.2	59.8018	2	1791.7863	1791.7819	M	Q	2	18
PSM	QSRRSTQGVTLTDLQEAEK	1081	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3165.4	37.06385	3	2289.0019	2289.0034	R	T	691	710
PSM	YKCSVCPDYDLCSVCEGK	1082	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3054.5	34.25097	3	2318.873171	2318.871729	R	G	140	158
PSM	SLYPSLEDLK	1083	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4337.2	56.97048	2	1285.5839	1285.5838	M	V	2	12
PSM	KMSNALAIQVDSEGK	1084	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2814.3	28.14598	3	1685.773871	1685.769553	K	I	81	96
PSM	AASIENVLQDSSPEHCGR	1085	sp|O60291|MGRN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3111.3	35.69963	3	2049.855371	2048.862284	R	G	513	531
PSM	RKTLDAEVVEK	1086	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2511.2	20.60372	3	1366.682471	1366.685746	R	P	275	286
PSM	STRESFNPESYELDK	1087	sp|P49903|SPS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3290.2	40.26805	2	1922.7923	1922.7930	M	S	2	17
PSM	SDAAVDTSSEITTK	1088	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=1.1.2823.6	28.38377	2	1465.6742	1465.6779	M	D	2	16
PSM	STDTGVSLPSYEEDQGSK	1089	sp|Q9Y241|HIG1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3278.3	39.94793	3	2020.8163	2020.8145	M	L	2	20
PSM	QKLSECSLTK	1090	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2815.2	28.16792	2	1255.5499	1255.5514	K	G	33	43
PSM	CNSLSTLEK	1091	sp|P13473|LAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3140.2	36.42775	2	1113.4429	1113.4408	R	N	153	162
PSM	RLSESQLSFRR	1092	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2827.2	28.47125	3	1537.678871	1537.680358	R	S	616	627
PSM	DRSSFYVNGLTLGGQK	1093	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3387.3	42.72153	3	1821.835871	1820.845829	K	C	55	71
PSM	DRSSFYVNGLTLGGQK	1094	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3418.3	43.46037	3	1821.833171	1820.845829	K	C	55	71
PSM	GAGSVFR	1095	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2645.2	23.90538	2	772.325447	772.326904	K	A	11	18
PSM	KLSELLR	1096	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2993.2	32.7023	2	937.499447	937.499783	K	Y	458	465
PSM	SKNEEKEEDDAENYR	1097	sp|Q8WVM0|TFB1M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2430.2	18.63598	4	1934.7528	1934.7526	K	L	331	346
PSM	TLRGSFSSTAAQDAQGQR	1098	sp|Q86V85|GP180_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2699.2	25.28782	4	1959.880494	1959.879983	K	I	24	42
PSM	MPSLPSYK	1099	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2863.2	29.39153	2	1017.422047	1017.424236	R	V	303	311
PSM	MPSLPSYK	1100	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2814.2	28.14265	2	1017.422647	1017.424236	R	V	303	311
PSM	RQNPSRCSVSLSNVEAR	1101	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2660.3	24.29628	4	2038.935694	2038.936786	R	R	720	737
PSM	KLSEFGIR	1102	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2997.2	32.80565	2	1028.503847	1028.505597	K	N	505	513
PSM	YLSNAYAR	1103	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2811.2	28.06892	2	1036.438647	1036.437911	R	E	209	217
PSM	AKSIVFHR	1104	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2513.4	20.66235	2	1036.517647	1036.521916	K	K	133	141
PSM	DGYNYTLSK	1105	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2727.3	25.99658	2	1059.484447	1059.487290	K	T	28	37
PSM	SMSTEGLMK	1106	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2869.3	29.54808	2	1062.411047	1062.412684	K	F	451	460
PSM	KKSIPLSIK	1107	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2623.6	23.36535	2	1092.630447	1092.630798	R	N	513	522
PSM	KYSGLIVNK	1108	sp|Q86TI2|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2733.2	26.14682	2	1100.559847	1100.563112	R	A	43	52
PSM	SIGSAVDQGNESIVAK	1109	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2983.2	32.4437	3	1653.759371	1653.761096	R	T	203	219
PSM	SYDLTPVDK	1110	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2902.4	30.38775	2	1116.471447	1116.474022	K	F	316	325
PSM	GMGSLDAMDK	1111	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2614.4	23.1357	2	1119.397047	1119.397763	R	H	413	423
PSM	IHRASDPGLPAEEPK	1112	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2565.3	21.9082	3	1695.795671	1695.798150	R	E	1855	1870
PSM	SLAGSSGPGASSGTSGDHGELVVR	1113	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2812.2	28.0932	4	2264.007294	2264.007034	K	I	60	84
PSM	RTSGHGSRNSQLGIFSSSEK	1114	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2743.3	26.40893	4	2293.981694	2293.984204	K	I	60	80
PSM	RNSNSPPSPSSMNQR	1115	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2447.2	19.02887	3	1737.721871	1737.725396	R	R	453	468
PSM	TPSTVTLNNNSAPANR	1116	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2655.4	24.1699	3	1735.788071	1735.789042	R	A	1679	1695
PSM	ESEDKPEIEDVGSDEEEEKK	1117	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2596.3	22.67048	4	2320.007694	2320.007791	K	D	251	271
PSM	AAMQRGSLPANVPTPR	1118	sp|P33240|CSTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2845.5	28.94538	3	1744.842371	1744.844389	R	G	304	320
PSM	KLSQMILDK	1119	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2685.3	24.93043	2	1170.569647	1170.571963	R	K	364	373
PSM	SIDTGMGLER	1120	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2655.5	24.17323	2	1173.472047	1173.473705	K	L	237	247
PSM	LPSKADTSQEICSPR	1121	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2658.5	24.25097	3	1767.783071	1767.786265	R	L	1016	1031
PSM	SVTPPEEQQEAEEPK	1122	sp|P30305|MPIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2606.3	22.9279	3	1776.743471	1776.745506	R	A	353	368
PSM	RSSDGSLSHEEDLAK	1123	sp|Q13136|LIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2588.3	22.46458	3	1789.689371	1789.692104	K	V	237	252
PSM	NKTSVDAAEDYAEGVR	1124	sp|Q02127|PYRD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2857.3	29.24017	3	1803.751571	1803.767638	K	V	184	200
PSM	GHTDSVQDISFDHSGK	1125	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2697.5	25.2461	3	1808.732171	1808.736672	K	L	148	164
PSM	RSPSKPLPEVTDEYK	1126	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2750.4	26.58293	3	1824.864671	1824.865896	R	N	91	106
PSM	GSFSDTGLGDGK	1127	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2732.3	26.12445	2	1219.483647	1219.475813	K	M	376	388
PSM	AQALRDNSTMGYMAAK	1128	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=1.1.2788.4	27.54603	3	1838.767271	1838.769236	K	K	616	632
PSM	QQSIAGSADSKPIDVSR	1129	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2687.3	24.98185	3	1837.855571	1837.857122	K	L	138	155
PSM	DAELQDQEFGKRDSLGTYSSR	1130	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2946.5	31.51935	4	2481.081694	2481.080927	R	D	859	880
PSM	KFSEDFGQES	1131	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2884.5	29.93762	2	1252.461247	1252.464914	K	-	428	438
PSM	AQALRDNSTMGYMMAK	1132	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2746.2	26.4784	3	1882.776671	1882.777691	K	K	481	497
PSM	AKRSGVAYIAAPSGSAADK	1133	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2615.4	23.16037	3	1898.922371	1898.925142	R	V	551	570
PSM	YKASITALEAK	1134	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2858.5	29.27267	2	1273.625047	1273.631920	K	I	1805	1816
PSM	SKPVFSESLSD	1135	sp|O60220|TIM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2976.3	32.26658	2	1274.541447	1274.543164	K	-	87	98
PSM	KFTYLGSQDR	1136	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2749.5	26.56133	2	1293.572647	1293.575468	R	A	296	306
PSM	SNSFNNPLGNR	1137	sp|O95835|LATS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2937.4	31.28847	2	1298.538647	1298.540479	R	A	462	473
PSM	GRLSKEEIER	1138	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2452.5	19.16362	2	1295.621047	1295.623480	K	M	508	518
PSM	AQTPPGPSLSGSK	1139	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2592.4	22.57073	2	1305.594047	1305.596597	K	S	1001	1014
PSM	RKASQLVGIEK	1140	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2550.3	21.52808	3	1307.694371	1307.696251	K	K	181	192
PSM	RLASTSDIEEK	1141	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2542.4	21.33152	2	1327.600047	1327.602076	R	E	504	515
PSM	TLNMTTSPEEK	1142	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2650.5	24.04412	2	1329.550047	1329.552349	K	R	326	337
PSM	QQENMQRQSRGEPPLPEEDLSK	1143	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2783.6	27.42947	4	2675.201294	2675.201059	R	L	282	304
PSM	YALYDATYETK	1144	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2966.4	32.0209	2	1336.618847	1336.618698	R	E	82	93
PSM	NFSDNQLQEGK	1145	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2704.2	25.41428	2	1358.547047	1358.550375	R	N	161	172
PSM	RCSLLDCDLK	1146	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2910.6	30.60097	2	1358.566447	1358.572373	K	Q	760	770
PSM	KKSCPNPGEIR	1147	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.2374.2	17.37833	3	1364.626571	1364.627186	K	N	160	171
PSM	IRYESLTDPSK	1148	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2863.6	29.40487	2	1387.633447	1387.638462	K	L	54	65
PSM	SDSGGSSSEPFDR	1149	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2607.6	22.96363	2	1406.496847	1406.498733	R	H	759	772
PSM	SLSPQEDALTGSR	1150	sp|Q96EN8|MOCOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2895.6	30.22047	2	1439.624847	1439.629354	R	V	528	541
PSM	SCFESSPDPELK	1151	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2878.5	29.7881	2	1474.563647	1474.568728	R	S	871	883
PSM	NRSAEEGELAESK	1152	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2430.3	18.63932	3	1498.624271	1498.630082	R	S	1664	1677
PSM	RETYTEDFIKK	1153	sp|P82933|RT09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2763.3	26.91498	3	1508.688371	1508.691226	K	Q	66	77
PSM	SSQSSSQQFSGIGR	1154	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2740.5	26.33788	2	1534.635647	1534.641315	R	S	671	685
PSM	FARLSEHATAPTR	1155	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2602.2	22.82178	3	1535.724071	1535.724592	R	G	116	129
PSM	DGYGGSRDSYSSSR	1156	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2397.2	17.9291	3	1572.585371	1572.584194	R	S	318	332
PSM	QRYSYQYTVANK	1157	sp|Q969X5|ERGI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2672.2	24.60223	3	1599.705371	1599.708273	K	E	203	215
PSM	SRSPESQVIGENTK	1158	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2592.2	22.56407	3	1610.727071	1610.730130	R	Q	305	319
PSM	SLTKPLAENEEGEK	1159	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2622.4	23.33258	3	1623.739571	1623.739298	K	Q	343	357
PSM	DGSLANNPYPGDVTK	1160	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2879.4	29.80915	2	1626.689247	1626.692682	R	F	854	869
PSM	SVTEQGAELSNEER	1161	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2657.2	24.21488	3	1627.671071	1627.672675	K	N	28	42
PSM	RMSVTEGGIKYPETTEGGRPK	1162	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2737.3	26.25392	4	2372.11489419132	2372.1195607479494	K	L	33	54
PSM	NTVSQSISGDPEIDKK	1163	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2626.4	23.43592	3	1796.813771	1796.819339	R	I	521	537
PSM	QASTDAGTAGALTPQHVR	1164	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2659.4	24.27353	3	1859.852771	1859.852705	R	A	107	125
PSM	RKLSGLEQPQGALQTR	1165	sp|Q6RFH5|WDR74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2743.4	26.41227	3	1860.945971	1860.957111	K	R	358	374
PSM	VRLSNKVEAIDVEEAK	1166	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2903.4	30.41367	3	1878.939971	1878.945209	K	R	747	763
PSM	RKSEQEFSFDTPADR	1167	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2846.4	28.96793	3	1891.807571	1891.810172	K	S	1125	1140
PSM	KISGGSVVEMQGDEMTR	1168	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2915.6	30.7297	3	1902.820571	1902.821664	K	I	4	21
PSM	NQSTTYPVYTESTDDK	1169	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2833.4	28.63248	3	1927.770371	1927.772449	R	H	1070	1086
PSM	KLESTESRSSFSQHAR	1170	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2398.4	17.95445	4	1928.874494	1928.874169	R	T	420	436
PSM	KRSSITEPEGPNGPNIQK	1171	sp|Q13625|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2565.6	21.9182	3	2030.972471	2030.978634	K	L	734	752
PSM	LARASGNYATVISHNPETK	1172	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2767.5	27.02532	3	2108.001971	2108.005183	K	K	126	145
PSM	TCSMVGNGDTTSQDDCVSK	1173	sp|Q6NYC1|JMJD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,3-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2580.6	22.26905	3	2140.768271	2140.774851	R	E	379	398
PSM	KRPSRSQEEVPPDSDDNK	1174	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2285.2	16.35568	4	2162.9584941913204	2162.9593546250994	K	T	1224	1242
PSM	KLTGIKHELQANCYEEVK	1175	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2931.6	31.13982	4	2239.070894	2239.070820	K	D	127	145
PSM	RFSQGPTPAAAVPEGTAAEGAPR	1176	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2917.5	30.77813	3	2317.078571	2317.085224	R	Q	234	257
PSM	EVEDKESEGEEEDEDEDLSK	1177	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2551.6	21.56342	3	2418.889571	2418.895931	K	Y	147	167
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1178	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2636.6	23.693	3	2512.016471	2512.025203	R	A	19	51
PSM	SGSSPGLRDGSGTPSRHSLSGSSPGMK	1179	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2592.3	22.5674	5	2745.156118	2745.157888	R	D	1441	1468
PSM	STELLIR	1180	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3030.2	33.6513	2	910.451047	910.452499	K	K	58	65
PSM	SFAVGMFK	1181	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3443.2	44.0809	2	965.411047	965.408191	K	G	72	80
PSM	NDSLPVLR	1182	sp|Q9GZY8-5|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	35.08608	2	992.468447	992.469212	R	G	144	152
PSM	SFLDSGYR	1183	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3011.2	33.16735	2	1023.406247	1023.406277	K	I	816	824
PSM	RLTVMSLQESGLK	1184	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3175.2	37.30162	3	1540.768871	1540.768430	R	V	2289	2302
PSM	EIIDLVLDR	1185	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3706.2	49.13448	2	1084.614647	1084.612825	K	I	113	122
PSM	LTFDTTFSPNTGKK	1186	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	35.34477	3	1635.757271	1635.754554	K	S	108	122
PSM	DLSTIEPLK	1187	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	40.79088	2	1094.524447	1094.526058	K	K	102	111
PSM	DQLIYNLLK	1188	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3697.2	49.03792	2	1118.635647	1118.633560	K	E	6	15
PSM	SIDISATIPK	1189	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3288.2	40.20302	2	1123.553647	1123.552607	R	F	92	102
PSM	NMSIIDAFK	1190	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3311.4	40.79755	2	1133.484447	1133.482813	R	S	617	626
PSM	AGPNASIISLK	1191	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3129.3	36.15002	2	1149.577647	1149.579490	K	S	979	990
PSM	DQIYDIFQK	1192	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3443.3	44.08423	2	1168.577247	1168.576440	K	L	194	203
PSM	TQWKLSLLD	1193	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3868.2	51.78057	2	1182.570247	1182.568591	R	-	1324	1333
PSM	SIFAQEIAAR	1194	sp|Q9BWH6|RPAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3203.3	38.0319	2	1184.558647	1184.559089	R	R	150	160
PSM	QISQDVKLEPDILLR	1195	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3626.2	48.11663	3	1845.963071	1845.960130	R	A	166	181
PSM	KLSSKGSFADLGLEPR	1196	sp|Q9NUL7|DDX28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3174.4	37.28262	3	1863.856871	1863.853296	R	V	121	137
PSM	NTSRITELKEEIEVK	1197	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3090.2	35.16367	3	1867.929071	1867.929224	R	K	29	44
PSM	AQALRDNSTMGYMMAK	1198	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3020.3	33.39538	3	1866.780971	1866.782776	K	K	481	497
PSM	SYDVPPPPMEPDHPFYSNISK	1199	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3256.3	39.39058	4	2512.073694	2512.065795	R	D	118	139
PSM	VAPEEHPVLLTEAPLNPK	1200	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3130.4	36.17842	3	1953.054671	1953.057128	R	A	96	114
PSM	SLEDQVEMLR	1201	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3155.4	36.8138	2	1314.552647	1314.552684	K	T	168	178
PSM	GLSASTMDLSSSS	1202	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3269.4	39.72423	2	1321.511847	1321.510878	R	-	607	620
PSM	LLGSVQQDLER	1203	sp|Q96AQ6|PBIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3307.3	40.69095	2	1336.641047	1336.638796	R	S	404	415
PSM	RRGSSGSVDETLFALPAASEPVIR	1204	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3769.3	50.17913	4	2674.255294	2674.251712	K	S	178	202
PSM	NDSWGSFDLR	1205	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3851.2	51.50435	2	1355.458047	1355.458463	R	A	650	660
PSM	SESVEGFLSPSR	1206	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3283.3	40.07723	2	1373.587847	1373.586426	R	C	1311	1323
PSM	TSSVFEDPVISK	1207	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3173.6	37.26337	2	1387.626247	1387.627228	K	F	82	94
PSM	DVIELTDDSFDK	1208	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3360.4	42.0405	2	1395.640847	1395.640556	K	N	161	173
PSM	QRMESALDQLK	1209	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3071.3	34.6799	3	1397.639771	1397.637416	R	Q	9	20
PSM	NLSSPFIFHEK	1210	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3344.2	41.62368	3	1397.642471	1397.638068	R	T	644	655
PSM	NSGSFPSPSISPR	1211	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3018.5	33.35137	2	1411.608247	1411.613310	R	-	1258	1271
PSM	LGGSAVISLEGKPL	1212	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	47.55402	2	1419.738047	1419.737448	K	-	153	167
PSM	AITGASLADIMAK	1213	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3260.5	39.50065	2	1436.602447	1436.602350	R	R	81	94
PSM	QTSGGPVDASSEYQQELER	1214	sp|P18859|ATP5J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3093.6	35.25508	3	2159.902271	2159.900837	R	E	55	74
PSM	TGSYGALAEITASK	1215	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.5	41.00832	2	1447.659447	1447.659591	K	E	443	457
PSM	SIAACHNVGLLAHDGQVNEDGQPDLGK	1216	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3101.5	35.45845	4	2894.303294	2894.301836	K	A	107	134
PSM	SNSLRLSLIGDR	1217	sp|O94915|FRYL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3437.2	43.93037	3	1489.672871	1489.669124	R	R	1939	1951
PSM	SFSEDTLMDGPAR	1218	sp|Q9BRG2|SH23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3271.5	39.7776	2	1504.592647	1504.590525	R	I	123	136
PSM	SNFSLEDFQHSK	1219	sp|P56937|DHB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3159.5	36.9161	2	1517.620847	1517.618789	K	G	177	189
PSM	NRSYIDRDSEYLLQENEPDGTLDQK	1220	sp|Q9H2U1|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3224.5	38.57767	4	3077.367694	3077.361519	R	L	159	184
PSM	DGTSFGEYGGWYK	1221	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3550.3	46.58285	2	1545.580447	1545.581341	K	A	442	455
PSM	FVEWLQNAEEESESEGEEN	1222	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4008.3	53.49462	3	2333.890871	2333.884913	K	-	401	420
PSM	MNSSFSVKPFEK	1223	sp|Q7Z401|MYCPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	38.66952	3	1559.611271	1559.613249	R	T	1149	1161
PSM	DNLTLWTSENQGDEGDAGEGEN	1224	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3522.2	45.95892	3	2349.949271	2349.946922	R	-	225	247
PSM	QVQSLTCEVDALK	1225	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3361.2	42.05978	3	1569.716171	1569.710975	R	G	322	335
PSM	SLTNDWEDHLAVK	1226	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3300.3	40.5121	3	1606.705871	1606.702853	K	H	315	328
PSM	ERYSYVCPDLVK	1227	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3039.3	33.87568	3	1607.709371	1607.705496	K	E	229	241
PSM	GSSFEMTDDDSAIR	1228	sp|Q7L2E3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3045.3	34.02415	2	1609.599247	1609.596733	R	A	224	238
PSM	SKESVPEFPLSPPK	1229	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3194.3	37.79793	3	1620.767771	1620.780041	R	K	28	42
PSM	APKMSLPDVDLDLK	1230	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	46.35615	3	1620.790571	1620.783412	R	G	1064	1078
PSM	QAGSVGGLQWCGEPK	1231	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3151.3	36.71242	3	1652.703071	1652.701807	R	R	190	205
PSM	NLGSINTELQDVQR	1232	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	42.16292	3	1665.775571	1665.772330	R	I	134	148
PSM	VASMAPVTAEGFQER	1233	sp|Q969S3|ZN622_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3192.2	37.74277	3	1671.736871	1671.732773	K	V	36	51
PSM	TLSNAEDYLDDEDSD	1234	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	46.73847	2	1780.620847	1780.620031	R	-	200	215
PSM	SQVFSTAADGQTQVEIK	1235	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3121.3	35.9515	3	1887.862571	1887.861539	K	V	469	486
PSM	SQSSHSYDDSTLPLIDR	1236	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3179.5	37.41525	3	1999.857071	1999.852431	R	N	859	876
PSM	CASCPYLGMPAFKPGEK	1237	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=1.1.3004.3	32.98948	3	2007.830771	2007.829393	R	V	285	302
PSM	INSSGESGDESDEFLQSR	1238	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3021.4	33.4248	3	2035.801571	2035.800789	R	K	180	198
PSM	TSRAPSVATVGSICDLNLK	1239	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3358.5	41.99252	3	2147.970971	2147.968737	R	I	2102	2121
PSM	DNLTLWTSDMQGDGEEQNK	1240	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3214.6	38.32697	3	2195.929571	2195.927707	R	E	226	245
PSM	SDSSSKKDVIELTDDSFDK	1241	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3128.5	36.1319	3	2194.951271	2194.951870	R	N	154	173
PSM	KPTDGASSSNCVTDISHLVR	1242	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3080.6	34.91803	3	2222.999171	2222.999112	R	K	698	718
PSM	GDGTGGKSIYGERFPDENFK	1243	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3038.5	33.85793	4	2252.976094	2252.973943	R	L	110	130
PSM	QQSTSSDRVSQTPESLDFLK	1244	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3536.2	46.26057	4	2412.029294	2412.024732	R	V	1000	1020
PSM	RKNSNVDSSYLESLYQSCPR	1245	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3187.6	37.62593	3	2482.100171	2482.094803	K	G	628	648
PSM	SYDVPPPPMEPDHPFYSNISK	1246	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3439.3	43.99143	3	2496.076571	2496.070880	R	D	118	139
PSM	HNGTGGKSIYGEKFEDENFILK	1247	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3187.3	37.61593	4	2562.183294	2562.179185	R	H	70	92
PSM	HQGVMVGMGQKDSYVGDEAQSK	1248	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2799.2	27.8193	4	2430.033694	2430.034511	R	R	42	64
PSM	TTPSYVAFTDTER	1249	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3024.3	33.49915	3	1486.692671	1486.693989	R	L	37	50
PSM	QQSEISAAVER	1250	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	39.2599	2	1279.5457	1279.5440	R	A	451	462
PSM	SGDEMIFDPTMSK	1251	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3541.4	46.38188	2	1594.5935	1594.5927	M	K	2	15
PSM	SGDEMIFDPTMSK	1252	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3531.4	46.1881	2	1594.5935	1594.5927	M	K	2	15
PSM	QRSLGPSLATDKS	1253	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.2891.6	30.12193	2	1421.6495	1421.6546	R	-	268	281
PSM	SLVIPEK	1254	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3240.2	38.97775	2	906.4473	906.4458	M	F	2	9
PSM	AITGASLADIMAK	1255	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3252.3	39.28838	2	1436.602447	1436.602350	R	R	81	94
PSM	ALSRQEMQEVQSSR	1256	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2653.3	24.11492	3	1727.765471	1727.766198	K	S	187	201
PSM	SSFSESALEK	1257	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3167.2	37.0988	2	1205.4859	1205.4848	M	K	2	12
PSM	PFSAPKPQTSPSPK	1258	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2603.2	22.84772	3	1547.736371	1547.738510	K	R	299	313
PSM	QFSISESMKPK	1259	sp|Q9NRP4|SDHF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3301.6	40.54768	2	1343.5835	1343.5827	R	F	114	125
PSM	SLGSVQAPSYGAR	1260	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2890.5	30.09285	2	1371.613247	1371.618395	R	P	15	28
PSM	NNSFTAPSTVGK	1261	sp|O95453|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2706.3	25.46713	2	1301.563647	1301.565297	R	R	555	567
PSM	RAESMLQQADK	1262	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2626.5	23.43925	2	1355.589247	1355.590466	K	L	336	347
PSM	INSLRKNTILPK	1263	sp|O60783|RT14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2753.2	26.65285	3	1555.787471	1555.788846	R	I	54	66
PSM	RLSYNTASNK	1264	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2426.3	18.54053	2	1232.556647	1232.555067	R	T	10	20
PSM	NGRKTLTTVQGIADDYDK	1265	sp|O60739|EIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	36.4886	3	2074.959371	2073.973214	R	K	39	57
PSM	CGSVLVR	1266	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2611.2	23.05385	2	869.381647	869.383039	R	L	188	195
PSM	SIQSGPLK	1267	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2608.2	22.97592	2	908.432847	908.436849	K	I	103	111
PSM	QVSLPVTK	1268	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2831.2	28.57418	2	950.481047	950.483799	R	S	721	729
PSM	RATRSGAQASSTPLSPTR	1269	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2450.2	19.10717	4	1922.928494	1922.932353	R	I	8	26
PSM	LSDGVAVLK	1270	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2980.2	32.36627	2	980.492847	980.494364	K	V	397	406
PSM	ISLAPTDVK	1271	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2948.2	31.55978	2	1022.502047	1022.504928	K	E	499	508
PSM	AESFFQTK	1272	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2940.2	31.35955	2	1036.424247	1036.426678	K	A	173	181
PSM	INKSESVVYADIR	1273	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2868.3	29.52202	3	1572.751571	1572.754889	K	K	255	268
PSM	SVMTEEYK	1274	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2614.3	23.13237	2	1065.408447	1065.408979	R	V	99	107
PSM	KLSSAMSAAK	1275	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2487.2	20.01048	2	1072.495447	1072.498797	R	A	239	249
PSM	TSLGPNGLDK	1276	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2743.2	26.4056	2	1080.482247	1080.485256	R	M	50	60
PSM	TTIFSPEGR	1277	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2896.2	30.23183	2	1086.470847	1086.474691	R	L	9	18
PSM	KQSEPFFK	1278	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2765.4	26.97037	2	1089.487847	1089.489613	R	A	82	90
PSM	SAAQFHNLR	1279	sp|O75127|PTCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2578.2	22.2059	2	1122.493847	1122.497158	K	F	105	114
PSM	TKPYIQVDIGGGQTK	1280	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2984.2	32.46942	3	1683.819671	1683.823303	K	T	124	139
PSM	DFSETYER	1281	sp|O94992|HEXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2781.2	27.36787	2	1125.402047	1125.401586	R	Y	266	274
PSM	QLSSGVSEIR	1282	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2792.3	27.6438	2	1154.530647	1154.533268	R	H	80	90
PSM	SRVLPHPNR	1283	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2396.2	17.89065	3	1154.571971	1154.570991	R	I	250	259
PSM	QDGPMPKPHSVSLNDTETRK	1284	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2663.4	24.37738	4	2316.051694	2316.056961	K	L	155	175
PSM	QREESETRSESSDFEVVPK	1285	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2751.3	26.6048	4	2318.004494	2318.006365	R	R	1238	1257
PSM	QENGASVILR	1286	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2923.3	30.9264	2	1165.546647	1165.549253	R	D	39	49
PSM	KASSDLDQASVSPSEEENSESSSESEK	1287	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2632.6	23.59052	5	2922.175618	2922.177526	R	T	172	199
PSM	LFSQDECAK	1288	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2882.3	29.88007	2	1176.452247	1176.452241	R	I	94	103
PSM	KSCVEEPEPEPEAAEGDGDKK	1289	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.2494.2	20.16608	4	2379.980094	2379.977767	K	G	106	127
PSM	SFYSSHYAR	1290	sp|Q8NEY8|PPHLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2635.6	23.66763	2	1196.464447	1196.465189	K	E	110	119
PSM	ITLDNAYMEK	1291	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2954.3	31.71028	2	1196.574447	1196.574725	K	C	142	152
PSM	GYSFTTTAER	1292	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2864.4	29.42407	2	1211.481647	1211.485984	R	E	197	207
PSM	VEIIANDQGNR	1293	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2595.6	22.65483	2	1227.616247	1227.620764	R	I	50	61
PSM	HASSGSFLPSANEHLK	1294	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2956.3	31.76053	3	1840.755371	1840.754645	R	E	115	131
PSM	KGTFTDDLHK	1295	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2556.5	21.6884	2	1240.544847	1240.548919	R	L	2243	2253
PSM	KDSLSVNEFK	1296	sp|Q99584|S10AD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2856.6	29.22498	2	1245.561047	1245.564234	R	E	30	40
PSM	DNSTMGYMMAK	1297	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2909.3	30.5651	2	1247.493847	1247.498465	R	K	486	497
PSM	ELISNASDALDK	1298	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2912.2	30.63907	2	1274.631447	1274.635411	R	I	103	115
PSM	SLGSAGPSGTLPR	1299	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2841.4	28.83877	2	1278.594247	1278.596931	R	S	332	345
PSM	RTSYEPFHPGPSPVDHDSLESK	1300	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2892.3	30.13632	4	2561.117294	2561.122398	R	R	86	108
PSM	GGSGSGPTIEEVD	1301	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2895.4	30.2138	2	1283.489447	1283.491857	K	-	629	642
PSM	SRENSVCSDTSESSAAEFDDRR	1302	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2648.4	23.98912	4	2584.011294	2584.013318	R	G	414	436
PSM	ARSEQFINLR	1303	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2939.4	31.34025	2	1312.626847	1312.628900	R	E	472	482
PSM	GILAADESTGSIAK	1304	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2850.4	29.07113	2	1331.688847	1331.693260	K	R	29	43
PSM	SASFNTDPYVR	1305	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2954.4	31.71362	2	1335.544447	1335.549647	R	E	385	396
PSM	TSSFTEQLDEGTPNRENASTHASK	1306	sp|Q13439-5|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2738.5	26.2864	4	2686.150894	2686.150798	R	S	39	63
PSM	NGVIQHTGAAAEEFNDDTD	1307	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2921.4	30.87825	3	2082.812471	2082.816773	R	-	646	665
PSM	GFGYKGSCFHR	1308	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2695.5	25.19425	2	1394.555847	1394.559106	K	I	45	56
PSM	RFASGGCDNLIK	1309	sp|P55735|SEC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2807.2	27.97307	2	1416.622247	1416.622101	K	L	181	193
PSM	TASGSSVTSLDGTR	1310	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2670.6	24.56398	2	1417.604647	1417.608618	R	S	328	342
PSM	EVDEQMLNVQNK	1311	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2835.6	28.69072	2	1445.677647	1445.682044	K	N	325	337
PSM	AHSSMVGVNLPQK	1312	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2633.3	23.60648	3	1462.661771	1462.663965	R	A	172	185
PSM	AMSTTSISSPQPGK	1313	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2679.5	24.78653	2	1470.636047	1470.642561	R	L	267	281
PSM	SASASPLTPCSVTR	1314	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2866.4	29.4748	2	1512.660447	1512.664359	R	S	364	378
PSM	SQGGEPTYNVAVGR	1315	sp|P35080|PROF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2825.6	28.43342	2	1513.660647	1513.656237	K	A	92	106
PSM	YHTSQSGDEMTSLSEYVSR	1316	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2980.6	32.3796	3	2271.898871	2271.899123	R	M	457	476
PSM	GLNSESMTEETLK	1317	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2943.5	31.4447	2	1517.629047	1517.632056	K	R	893	906
PSM	RKSTTPCMIPVK	1318	sp|Q9H4I2|ZHX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2751.2	26.60147	3	1576.689971	1576.690788	K	T	5	17
PSM	SQRYESLKGVDPK	1319	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2577.4	22.1949	2	1585.745647	1585.750138	R	F	26	39
PSM	KLSGCSQDCEDLK	1320	sp|Q07954|LRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.2485.5	19.96937	3	1618.635371	1618.636824	R	I	2948	2961
PSM	ESRRSLTNSHLEK	1321	sp|Q9H2H9|S38A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2383.2	17.60063	4	1635.773694	1635.772998	R	K	48	61
PSM	KSNFSLEDFQHSK	1322	sp|P56937|DHB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2939.3	31.33692	3	1645.716071	1645.713752	R	G	176	189
PSM	GGRGDVGSADIQDLEK	1323	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2871.5	29.60637	3	1695.743771	1695.746509	K	W	250	266
PSM	RNSDSLPHRLSAAK	1324	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2566.4	21.93667	3	1710.757271	1710.760399	K	M	757	771
PSM	ECTRGSAVWCQNVK	1325	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2734.4	26.17918	3	1773.731771	1773.732790	K	T	24	38
PSM	SISNEGLTLNNSHVSK	1326	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2829.2	28.52263	3	1778.814671	1778.820008	R	H	462	478
PSM	LGAGGGSPEKSPSAQELK	1327	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2595.5	22.6515	3	1791.832871	1791.840409	R	E	13	31
PSM	RSSSVVSAEMSGCSSK	1328	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2668.4	24.5062	3	1817.666771	1817.672632	R	S	291	307
PSM	NKTSTTSSMVASAEQPR	1329	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2645.4	23.91205	3	1873.820771	1873.824107	K	R	17	34
PSM	SSRTSVQPTFTASQYR	1330	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2792.6	27.6538	3	1894.855571	1894.857456	K	A	3842	3858
PSM	RSSITEPEGPNGPNIQK	1331	sp|Q13625|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2662.4	24.35122	3	1902.877871	1902.883671	K	L	735	752
PSM	DRQSLDGFYSHGMGAEGR	1332	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2979.5	32.3507	3	2061.834071	2061.836403	R	E	1504	1522
PSM	GQNQDYRGGKNSTWSGESK	1333	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2430.6	18.64932	4	2177.908494	2177.912739	K	T	468	487
PSM	SKSEEAHAEDSVMDHHFR	1334	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2695.6	25.19758	3	2190.879371	2190.878996	K	K	328	346
PSM	AGEEDEGEEDSDSDYEISAK	1335	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2748.4	26.53353	3	2253.792371	2253.795823	R	A	463	483
PSM	KYSDASDCHGEDSQAFCEK	1336	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.2545.4	21.41107	3	2312.829671	2312.835143	R	F	271	290
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	1337	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.2937.6	31.29513	3	2418.911171	2418.911873	R	R	42	68
PSM	SVPTWLK	1338	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3269.2	39.71757	2	909.438247	909.436121	R	L	21	28
PSM	KLSFDFQ	1339	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3397.2	42.94235	2	963.412647	963.410300	R	-	465	472
PSM	SLDFYTR	1340	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3129.2	36.14668	2	980.400447	980.400463	K	V	45	52
PSM	NCSSFLIK	1341	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3053.4	34.22212	2	1047.444447	1047.446034	R	R	12	20
PSM	SCNCLLLK	1342	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3005.3	33.01532	2	1086.457047	1086.460304	K	V	336	344
PSM	ALSRQLSSGVSEIRHTADR	1343	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	35.21582	4	2242.028494	2242.025675	R	W	76	95
PSM	NMSIIDAFK	1344	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	40.58885	2	1133.484447	1133.482813	R	S	617	626
PSM	DGSYAWEIK	1345	sp|Q14696|MESD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	40.9725	2	1147.459247	1147.458706	R	D	163	172
PSM	SGNYFFLDD	1346	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4743.2	60.19847	2	1156.412047	1156.411422	K	-	591	600
PSM	IISIFSGTEK	1347	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3669.2	48.62957	2	1173.569647	1173.568257	K	G	53	63
PSM	SMSAPVIFDR	1348	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3376.2	42.44542	2	1201.520847	1201.520261	K	S	117	127
PSM	SINQPVAFVR	1349	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3154.3	36.7861	2	1209.592847	1209.590724	R	R	15	25
PSM	SVDFDSLTVR	1350	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	43.0919	2	1217.531647	1217.532934	K	T	458	468
PSM	ALSIGFETCR	1351	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3297.2	40.43405	2	1232.526247	1232.526075	K	Y	69	79
PSM	TPSLSPASSLDV	1352	sp|Q32P44|EMAL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	46.99323	2	1252.560247	1252.558815	R	-	885	897
PSM	DGSAVEIVGLSK	1353	sp|P35573|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3254.4	39.34241	2	1253.592047	1253.590449	R	S	1280	1292
PSM	GDNITLLQSVSN	1354	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3376.3	42.44875	2	1259.634447	1259.635745	K	-	81	93
PSM	VKNSLLSLSDT	1355	sp|Q7L2H7|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3210.4	38.21627	2	1255.605847	1255.606099	K	-	364	375
PSM	RQSILFSTEV	1356	sp|P11274|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	42.2276	2	1258.595047	1258.595869	K	-	1262	1272
PSM	NSLGGDVLFVGK	1357	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3464.2	44.56453	2	1284.612647	1284.611519	R	H	677	689
PSM	VLQSFTVDSSK	1358	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3009.5	33.12553	2	1289.589047	1289.590449	R	A	1439	1450
PSM	DSPSVWAAVPGK	1359	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3210.5	38.2196	2	1292.579847	1292.580219	K	T	27	39
PSM	SDSFYFVDNK	1360	sp|A6NIH7|U119B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3265.3	39.62123	2	1300.502847	1300.501300	R	L	227	237
PSM	ENRQSIINPDWNFEK	1361	sp|P46459|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	39.746	3	1968.875471	1968.873106	K	M	203	218
PSM	MSLPDVDLDLK	1362	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3509.2	45.62867	2	1340.581247	1340.593486	K	G	1067	1078
PSM	NSLESYAFNMK	1363	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3551.2	46.60045	2	1382.556247	1382.557769	K	A	540	551
PSM	KSADTLWDIQK	1364	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3074.5	34.76398	2	1383.642247	1383.643547	K	D	319	330
PSM	NSLESYAFNMK	1365	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3272.4	39.79913	2	1398.554247	1398.552684	K	A	540	551
PSM	GNPTVEVDLFTSK	1366	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3303.5	40.59552	2	1405.710447	1405.708910	R	G	16	29
PSM	SNSAWQIYLQR	1367	sp|Q8N4C8|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	45.75718	2	1444.650047	1444.650030	R	R	699	710
PSM	KTSDANETEDHLESLICK	1368	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3188.4	37.65202	3	2168.933171	2168.929695	R	V	20	38
PSM	TDGSISGDRQPVTVADYISR	1369	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3226.4	38.62522	3	2216.013671	2216.011056	R	A	598	618
PSM	KQTIDNSQGAYQEAFDISK	1370	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3141.5	36.46328	3	2221.988171	2221.989258	R	K	139	158
PSM	GVVDSDDLPLNVSR	1371	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3215.4	38.3463	2	1484.744247	1484.747087	K	E	435	449
PSM	VMSDFAINQEQK	1372	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3243.3	39.05855	2	1488.632247	1488.631996	R	E	649	661
PSM	NGESSELDLQGIR	1373	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	37.50857	2	1496.652447	1496.650817	R	I	112	125
PSM	KYSDADIEPFLK	1374	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3291.6	40.29373	2	1504.684647	1504.685078	K	N	1859	1871
PSM	KTSCEFTGDILR	1375	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3051.5	34.17532	2	1505.660047	1505.658546	K	T	109	121
PSM	GGSTTGSQFLEQFK	1376	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3516.3	45.80387	3	1565.680871	1565.676304	K	T	354	368
PSM	TYSLGSALRPSTSR	1377	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3063.2	34.46922	3	1574.745971	1574.745387	R	S	37	51
PSM	DGSLASNPYSGDLTK	1378	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3139.3	36.40533	2	1603.673847	1603.676698	R	F	850	865
PSM	SMGGAAIAPPTSLVEK	1379	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3343.5	41.61178	2	1607.762647	1607.763011	R	D	169	185
PSM	SKESVPEFPLSPPK	1380	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3186.3	37.5899	3	1620.767771	1620.780041	R	K	28	42
PSM	SLGEIPIVESEIKK	1381	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3448.2	44.20847	3	1620.839471	1620.837556	R	E	482	496
PSM	APKISMPDIDLNLK	1382	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3601.3	47.6584	3	1633.816571	1633.815046	K	G	2704	2718
PSM	DIIRQPSEEEIIK	1383	sp|Q15121|PEA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3108.2	35.62258	3	1648.810271	1648.807318	K	L	110	123
PSM	ASSSAGTDPQLLLYR	1384	sp|Q6UVK1|CSPG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3377.3	42.47452	3	1657.774871	1657.771267	R	V	1607	1622
PSM	SMGETESGDAFLDLK	1385	sp|Q9NRA8|4ET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3552.4	46.63823	2	1678.680047	1678.679734	R	K	5	20
PSM	SSMDGAGAEEVLAPLR	1386	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3525.3	46.02448	3	1681.741571	1681.738252	R	L	53	69
PSM	RSSWRVISSIEQK	1387	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3140.3	36.43108	3	1734.784271	1734.785551	R	T	58	71
PSM	DRGLSIPRADTLDEY	1388	sp|O15116|LSM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	43.30953	3	1799.814071	1799.809109	K	-	119	134
PSM	SRQGSTQGRLDDFFK	1389	sp|P39748|FEN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3060.3	34.39553	3	1820.821571	1820.820677	K	V	331	346
PSM	VVVAENFDEIVNNENK	1390	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3313.4	40.84933	3	1831.892471	1831.895208	K	D	380	396
PSM	DESTDSGLSMSSYSVPR	1391	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3259.3	39.46802	3	1896.750971	1896.744854	R	T	395	412
PSM	ECSLQVPEDELVSTLK	1392	sp|P11441|UBL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	50.96843	3	1925.869871	1925.869326	R	Q	12	28
PSM	KLSRADLTEYLSTHYK	1393	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	37.58657	4	2003.978094	2003.971758	R	A	210	226
PSM	DVKDGKYSQVLANGLDNK	1394	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3025.4	33.52843	3	2042.963771	2042.967401	K	L	89	107
PSM	RSSSSGDQSSDSLNSPTLLAL	1395	sp|P15408|FOSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3824.3	51.0659	3	2200.994771	2200.984901	R	-	306	327
PSM	TVGTPIASVPGSTNTGTVPGSEK	1396	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3022.4	33.4507	3	2236.057271	2236.062423	R	D	270	293
PSM	SYDVPPPPMEPDHPFYSNISK	1397	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3447.2	44.19628	3	2496.076571	2496.070880	R	D	118	139
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1398	sp|P31947|1433S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3570.6	47.071	3	2528.095871	2528.093920	R	-	225	249
PSM	KASLVALPEQTASEEETPPPLLTK	1399	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3459.5	44.44558	3	2628.337871	2628.329931	K	E	398	422
PSM	SLLSHEFQDETDTEEETLYSSKH	1400	sp|O75976|CBPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3376.4	42.45208	4	2804.174494	2804.170196	K	-	1358	1381
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	1401	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4103.2	54.64155	3	3099.470171	3099.462419	R	R	174	201
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	1402	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	54.36572	4	3274.368894	3274.357556	R	N	282	311
PSM	IRYESLTD	1403	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2918.2	30.79393	2	1075.4557	1075.4582	K	P	54	62
PSM	HQGVMVGMGQKDSYVGDEAQSK	1404	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2812.5	28.1032	4	2431.022494	2430.034511	R	R	42	64
PSM	ASGVAVSDGVIK	1405	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3246.4	39.13953	2	1223.5800	1223.5794	M	V	2	14
PSM	SGDEMIFDPTMSK	1406	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3715.3	49.32505	2	1594.5927	1594.5927	M	K	2	15
PSM	CSSILLHGK	1407	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3428.2	43.70712	2	1076.4716	1076.4721	R	E	518	527
PSM	KGSEQESVKEFLAK	1408	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2920.2	30.8457	3	1738.754771	1738.757999	K	A	9	23
PSM	SDAAVDTSSEITTK	1409	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.2906.6	30.49758	2	1545.6389	1545.6442	M	D	2	16
PSM	QASVTLQPLK	1410	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3383.2	42.62138	2	1146.5692	1146.5681	R	I	251	261
PSM	SCSLVLEHQPDNIK	1411	sp|Q14318|FKBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2906.3	30.48758	3	1718.768471	1718.769887	R	A	294	308
PSM	CPNLTHLNLSGNK	1412	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2929.2	31.07495	3	1546.695971	1546.696328	K	I	87	100
PSM	SIGVPIK	1413	sp|P62318|SMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3306.3	40.66527	2	834.4259	834.4247	M	V	2	9
PSM	SVAFAAPR	1414	sp|Q15532|SSXT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3150.3	36.6869	2	939.4215	939.4210	M	Q	2	10
PSM	SQEGVELEK	1415	sp|Q9NUL5|SHFL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.2802.4	27.89638	2	1139.4713	1139.4742	M	S	2	11
PSM	TFSATVR	1416	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2671.2	24.57668	2	860.376847	860.379334	R	A	50	57
PSM	QLSLTPR	1417	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2824.2	28.39522	2	893.434847	893.437183	R	T	55	62
PSM	SFSLEEK	1418	sp|Q96BK5|PINX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2871.2	29.59637	2	918.372847	918.373580	K	S	110	117
PSM	RYDSRTTIFSPEGR	1419	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2872.2	29.6224	4	1843.765294	1843.765544	R	L	4	18
PSM	AGIFQSVK	1420	sp|P09669|COX6C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2977.2	32.28907	2	928.440247	928.441934	K	-	68	76
PSM	QVSLPVTK	1421	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2823.2	28.37043	2	950.481047	950.483799	R	S	721	729
PSM	TLGTGSFGR	1422	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2749.2	26.55133	2	974.413847	974.422261	K	V	49	58
PSM	SHEAEVLK	1423	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2420.2	18.38735	2	991.435447	991.437577	K	Q	63	71
PSM	MPSLPSYK	1424	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2871.3	29.5997	2	1017.420447	1017.424236	R	V	303	311
PSM	GMSVYGLGR	1425	sp|Q15417|CNN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2821.2	28.32035	2	1034.421447	1034.425633	K	Q	257	266
PSM	QSLGHPPPEPGPDR	1426	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2591.3	22.54182	3	1562.687471	1562.687872	R	V	57	71
PSM	AFYKSFSK	1427	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2734.2	26.17252	2	1056.466647	1056.468149	K	E	357	365
PSM	SGTSEFLNK	1428	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2753.3	26.65618	2	1061.441647	1061.443056	K	M	169	178
PSM	VCRDNSILPPLDK	1429	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2992.2	32.67652	3	1605.757871	1605.758594	K	E	1675	1688
PSM	GMSSTFSQR	1430	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2764.3	26.94092	2	1079.408447	1079.410710	R	S	84	93
PSM	LGSVDSFER	1431	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2941.2	31.38562	2	1088.451047	1088.453955	R	S	586	595
PSM	CSSILLHGK	1432	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2636.2	23.67967	2	1093.496847	1093.499132	R	E	518	527
PSM	PKFSVCVLGDQQHCDEAK	1433	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,6-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2973.2	32.1859	4	2196.934494	2196.933341	R	A	61	79
PSM	RFSDIQIR	1434	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2915.3	30.7197	2	1113.527447	1113.533209	R	R	488	496
PSM	RQSVSPPYKEPSAYQSSTR	1435	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2644.3	23.88383	4	2247.030894	2247.032126	R	S	272	291
PSM	RSSSDEQGLSYSSLK	1436	sp|Q9NPH3|IL1AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2769.2	27.06732	3	1722.747071	1722.746174	R	N	554	569
PSM	QDGPMPKPHSVSLNDTETRK	1437	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2509.6	20.56547	4	2332.052094	2332.051876	K	L	155	175
PSM	NMSYQGFTK	1438	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2651.6	24.0733	2	1170.440847	1170.441677	R	D	333	342
PSM	RTSLPCIPR	1439	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2858.3	29.266	2	1178.558247	1178.563129	R	E	310	319
PSM	VSSKNSLESYAFNMK	1440	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2947.4	31.54127	3	1799.777171	1799.780118	K	A	536	551
PSM	DHAISLSEPR	1441	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2727.5	26.00325	2	1203.524447	1203.528517	R	M	795	805
PSM	SVLADQGKSFATASHR	1442	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2737.5	26.26058	3	1833.776771	1833.781194	K	N	414	430
PSM	HQGVMVGMGQKDSYVGDEAQSK	1443	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2692.4	25.11368	4	2446.028894	2446.029426	R	R	42	64
PSM	SDSSQPMLLR	1444	sp|P11532|DMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.2799.3	27.8293	2	1228.517447	1228.515904	R	V	3621	3631
PSM	RASSLNFLNK	1445	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2952.2	31.65772	2	1228.594847	1228.596537	K	S	579	589
PSM	KSLDQDPVVR	1446	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2546.5	21.4324	2	1235.589047	1235.591118	K	A	772	782
PSM	GRDSVSDGFVQENQPR	1447	sp|P51957|NEK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2740.4	26.33455	3	1869.802271	1869.800670	K	Y	374	390
PSM	SAYNVYVAER	1448	sp|Q00059|TFAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2899.3	30.30867	2	1250.530647	1250.533268	R	F	160	170
PSM	MKSLEQDALR	1449	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2741.4	26.36053	2	1269.573447	1269.578838	R	A	1506	1516
PSM	EAAENSLVAYK	1450	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2771.4	27.12595	2	1273.559647	1273.559149	K	A	143	154
PSM	RRDSAPYGEYGSWYK	1451	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2972.4	32.16737	3	1913.808371	1913.809778	K	A	425	440
PSM	SFSSPENFQR	1452	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2925.2	30.97375	2	1277.505247	1277.507782	R	Q	134	144
PSM	GGSGSGPTIEEVD	1453	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2904.4	30.43937	2	1283.489447	1283.491857	K	-	629	642
PSM	GGSGSGPTIEEVD	1454	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2924.3	30.952	2	1283.490447	1283.491857	K	-	629	642
PSM	ELISNSSDALDK	1455	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2761.6	26.87322	2	1290.625647	1290.630326	R	I	47	59
PSM	SSPNPFVGSPPK	1456	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2979.2	32.3407	2	1292.577047	1292.580219	K	G	393	405
PSM	DRSVSVDSGEQREAGTPSLDSEAK	1457	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2695.4	25.19092	4	2599.142894	2599.139899	R	E	114	138
PSM	VRQGQGQSEPGEYEQRLSLQDR	1458	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2754.5	26.68863	4	2639.204894	2639.208922	R	G	76	98
PSM	NSNPALNDNLEK	1459	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2612.4	23.08653	2	1327.632447	1327.636808	K	G	120	132
PSM	SIQGEDIPDQR	1460	sp|Q5T5Y3|CAMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2716.3	25.7172	2	1336.564247	1336.566025	K	H	431	442
PSM	NSLTGEEGQLAR	1461	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2787.4	27.52097	2	1353.590247	1353.592574	R	V	111	123
PSM	ASSVISTAEGTTR	1462	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2751.4	26.60813	2	1358.603247	1358.607890	R	R	1805	1818
PSM	KASGPPVSELITK	1463	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2928.4	31.05593	2	1405.719047	1405.721798	R	A	34	47
PSM	GILAADESTGSIAK	1464	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2953.5	31.69218	2	1411.656647	1411.659591	K	R	29	43
PSM	HRGSADYSMEAK	1465	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2177.2	15.6219	3	1446.563471	1446.559894	K	K	214	226
PSM	SSGPYGGGGQYFAK	1466	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2914.5	30.70043	2	1454.581847	1454.586761	R	P	285	299
PSM	KISSDLDGHPVPK	1467	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2560.2	21.78058	3	1471.707071	1471.707210	R	Q	102	115
PSM	SGSMDPSGAHPSVR	1468	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2365.2	17.17135	3	1479.582071	1479.581358	R	Q	18	32
PSM	NKKSYDLTPVDK	1469	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2552.3	21.5788	3	1486.7048	1486.7064	K	F	313	325
PSM	KGSQFGQSCCLR	1470	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2591.6	22.55182	2	1506.609047	1506.610884	K	A	328	340
PSM	RNSLTGEEGQLAR	1471	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2653.6	24.12492	2	1509.690447	1509.693685	R	V	110	123
PSM	SSQSSSQQFSGIGR	1472	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2722.5	25.87478	2	1534.636447	1534.641315	R	S	671	685
PSM	SSTTSMTSVPKPLK	1473	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2789.2	27.56445	3	1542.737471	1542.736461	R	F	84	98
PSM	RAASAATAAPTATPAAQESGTIPK	1474	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2720.5	25.82408	3	2318.122571	2318.126755	R	K	62	86
PSM	RKSNFSNSADDIK	1475	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2444.4	18.96252	3	1560.695471	1560.693351	K	S	90	103
PSM	SSSESYTQSFQSR	1476	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2751.5	26.61147	2	1572.607647	1572.609347	R	K	460	473
PSM	SQRYESLKGVDPK	1477	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2585.4	22.39103	3	1585.745471	1585.750138	R	F	26	39
PSM	NLESARVSMVGQVK	1478	sp|Q9Y570|PPME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2935.2	31.23002	3	1596.766571	1596.769493	R	Q	223	237
PSM	SDSRGKSSFFSDR	1479	sp|O00571|DDX3X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2701.2	25.33928	3	1634.607071	1634.612732	R	G	76	89
PSM	RNSFTPLSSSNTIR	1480	sp|O60825|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2905.3	30.46182	3	1658.769971	1658.777749	R	R	464	478
PSM	KASLEELQSVHSER	1481	sp|Q8WUI4|HDAC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2692.3	25.11035	3	1691.783471	1691.787980	R	H	571	585
PSM	GVSLTNHHFYDESK	1482	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2800.2	27.84027	3	1712.722871	1712.719566	R	P	22	36
PSM	DKPAQIRFSNISAAK	1483	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2946.3	31.51268	3	1724.858171	1724.861085	R	A	28	43
PSM	RALSSDSILSPAPDAR	1484	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2994.3	32.73138	3	1734.832571	1734.830179	R	A	391	407
PSM	NQTAEKEEFEHQQK	1485	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2367.3	17.23178	4	1744.806494	1744.801642	K	E	584	598
PSM	SSLGSLQTPEAVTTRK	1486	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2907.3	30.51348	3	1753.857371	1753.861145	R	G	386	402
PSM	ERAMSTTSISSPQPGK	1487	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2449.5	19.08915	3	1771.779071	1771.781180	K	L	265	281
PSM	HPSHSTTPSGPGDEVAR	1488	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2404.4	18.1063	3	1810.758671	1810.763556	R	G	70	87
PSM	TASFSESRADEVAPAKK	1489	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2565.5	21.91487	3	1872.861071	1872.861873	R	A	453	470
PSM	AQALRDNSTMGYMMAK	1490	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=1.1.2598.3	22.72203	3	1898.767271	1898.772606	K	K	481	497
PSM	SPPREGSQGELTPANSQSR	1491	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2474.6	19.71225	3	2076.920471	2076.922576	K	M	468	487
PSM	SGRESVSTASDQPSHSLER	1492	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2478.2	19.80455	3	2108.909771	2108.912405	R	Q	958	977
PSM	KLEKEEEEGISQESSEEEQ	1493	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2533.4	21.10418	3	2235.978671	2235.986661	K	-	89	108
PSM	QNGQLVRNDSLVTPSPQQAR	1494	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2832.6	28.61352	3	2287.101371	2287.107023	R	V	137	157
PSM	NGSLDSPGKQDTEEDEEEDEK	1495	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2458.6	19.32213	3	2429.920271	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEK	1496	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2494.4	20.17942	3	2429.921171	2429.923149	K	D	134	155
PSM	NLSFEIK	1497	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3254.2	39.33575	2	929.425847	929.425950	R	K	433	440
PSM	NVSIGIVGK	1498	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3053.2	34.21545	2	965.496447	965.494698	K	D	209	218
PSM	MPSLPSYK	1499	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3144.2	36.52943	2	1001.428047	1001.429321	R	V	303	311
PSM	SFSMQDLR	1500	sp|Q9H6H4|REEP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3142.2	36.4786	2	1062.420247	1062.420547	R	S	150	158
PSM	ALLYLCGGDD	1501	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3434.3	43.85392	2	1095.493447	1095.490661	K	-	330	340
PSM	SFSQMISEK	1502	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3050.4	34.14715	2	1135.462047	1135.462077	K	Q	1043	1052
PSM	DKFSFDLGK	1503	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	38.28785	2	1135.495847	1135.495092	K	G	75	84
PSM	GLERNDSWGSFDLR	1504	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3365.3	42.16625	3	1730.744771	1730.741364	R	A	646	660
PSM	TSILAAANPISGHYDR	1505	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	38.46887	3	1764.823271	1764.819614	R	S	497	513
PSM	SDSFENPVLQQHFR	1506	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	39.1069	3	1782.771071	1782.772664	R	N	475	489
PSM	YGSDIVPFSK	1507	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3362.4	42.09212	2	1191.519847	1191.521307	R	V	316	326
PSM	SPSLNLLQNK	1508	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3168.2	37.12327	2	1192.585247	1192.585304	R	S	529	539
PSM	SYELPDGQVITIGNER	1509	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3502.2	45.50331	3	1789.886771	1789.884643	K	F	241	257
PSM	SESVVYADIR	1510	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3001.3	32.91228	2	1217.533847	1217.532934	K	K	258	268
PSM	QRIDEFESM	1511	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3118.3	35.87427	2	1233.477247	1233.473705	K	-	569	578
PSM	KISELDAFLK	1512	sp|Q06323|PSME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3499.3	45.42995	2	1242.628647	1242.626106	K	E	36	46
PSM	SSSSPLVVVSVK	1513	sp|Q96B01|R51A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3201.4	37.98335	2	1267.641247	1267.642485	R	S	315	327
PSM	DSPPKNSVKVDELSLYSVPEGQSK	1514	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3222.4	38.52455	4	2682.282894	2682.278958	K	Y	28	52
PSM	MPSLPSYKVGDK	1515	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3069.3	34.628	3	1400.646671	1400.641104	R	I	303	315
PSM	TLTIVDTGIGMTK	1516	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3351.5	41.81328	2	1444.687447	1444.688449	R	A	28	41
PSM	IKSYDYEAWAK	1517	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3064.2	34.49522	3	1452.632771	1452.632648	R	L	85	96
PSM	NNSGEEFDCAFR	1518	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3113.5	35.75535	2	1524.537647	1524.534073	R	L	591	603
PSM	DTYSDRSGSSSPDSEITELKFPSINHD	1519	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3560.2	46.82712	4	3063.297694	3063.298250	R	-	565	592
PSM	SLYESFVSSSDR	1520	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3469.4	44.7001	2	1535.558847	1535.558237	K	L	131	143
PSM	CTSVSSLDSFESR	1521	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3130.5	36.18175	2	1553.607247	1553.606904	R	S	1387	1400
PSM	TTPSYVAFTDTER	1522	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3103.5	35.51012	2	1566.657447	1566.660320	R	L	37	50
PSM	QGSTQGRLDDFFK	1523	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	39.7209	3	1577.691371	1577.687537	R	V	333	346
PSM	LVSQEEMEFIQR	1524	sp|P82909|RT36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3465.2	44.59044	3	1587.702671	1587.700410	K	G	88	100
PSM	IDFSSIAVPGTSSPR	1525	sp|Q5TDH0|DDI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	47.13823	2	1612.750047	1612.749803	R	Q	94	109
PSM	SMSDVSAEDVQNLR	1526	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3132.6	36.23612	2	1629.665447	1629.670567	K	Q	704	718
PSM	NLSFNELYPSGTLK	1527	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3763.2	50.03565	3	1661.774471	1661.770204	R	L	1539	1553
PSM	DKFSFDLGKGEVIK	1528	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3313.3	40.846	3	1661.807171	1661.806590	K	A	75	89
PSM	EGSGNPTPLINPLAGR	1529	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3505.2	45.57958	3	1671.801371	1671.798150	R	A	240	256
PSM	TTAGSVDWTDQLGLR	1530	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3704.2	49.0892	3	1698.762971	1698.761431	K	N	1154	1169
PSM	SLYESFVSSSDRLR	1531	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	46.16257	3	1804.744571	1804.743412	K	E	131	145
PSM	LVSRSSSVLSLEGSEK	1532	sp|A1L390|PKHG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3067.4	34.57955	3	1836.837071	1836.827141	R	G	634	650
PSM	NRSADFNPDFVFTEK	1533	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3434.4	43.85725	3	1865.803571	1865.798544	K	E	77	92
PSM	DRSSTTSTWELLDQR	1534	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3370.4	42.29793	3	1873.824671	1873.820736	K	T	542	557
PSM	RSSDSWEVWGSASTNR	1535	sp|Q8N6T3|ARFG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3177.5	37.36347	3	1903.789871	1903.785020	R	N	359	375
PSM	IISNASCTTNCLAPLAK	1536	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3177.6	37.3668	3	1912.882871	1912.878786	K	V	146	163
PSM	GTPGPDSSGSLGSGEFTGVK	1537	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3089.4	35.14472	3	1915.823171	1915.820068	R	E	365	385
PSM	QYTSPEEIDAQLQAEK	1538	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3272.3	39.7958	3	1928.846471	1928.840469	R	Q	16	32
PSM	AEDGSVIDYELIDQDAR	1539	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3524.3	46.00883	2	1987.839847	1987.841197	R	D	180	197
PSM	MSMKEVDEQMLNVQNK	1540	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3282.2	40.04815	3	2002.860371	2002.856335	R	N	321	337
PSM	KLSRADLTEYLSTHYK	1541	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3194.2	37.7946	4	2003.978094	2003.971758	R	A	210	226
PSM	GSLESPATDVFGSTEEGEK	1542	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	41.28255	3	2018.847371	2018.835777	K	R	331	350
PSM	RSDSASSEPVGIYQGFEK	1543	sp|Q05655|KPCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3122.3	35.97695	3	2035.889471	2035.888816	R	K	301	319
PSM	AIGSASEGAQSSLQEVYHK	1544	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3027.5	33.58362	3	2040.912971	2040.915365	R	S	169	188
PSM	SQSTTFNPDDMSEPEFK	1545	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3354.4	41.88643	3	2038.790771	2038.786719	R	R	599	616
PSM	QSSMSEDSDSGDDFFIGK	1546	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3319.4	41.00498	3	2046.742571	2046.740163	K	V	272	290
PSM	GWLRDPSASPGDAGEQAIR	1547	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3074.4	34.76065	3	2061.930371	2061.926933	K	Q	282	301
PSM	RKTSDFNTFLAQEGCTK	1548	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3005.2	33.01198	4	2081.924094	2081.924156	R	G	197	214
PSM	NPSTVEAFDLAQSNSEHSR	1549	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3080.5	34.9147	3	2167.917671	2167.917156	R	H	213	232
PSM	DNLTLWTSDQQDDDGGEGNN	1550	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3631.4	48.18892	3	2192.874371	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	1551	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3531.2	46.17477	3	2192.876471	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	1552	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3523.3	45.9737	3	2192.876471	2192.873028	R	-	228	248
PSM	KGSSSSVCSVASSSDISLGSTK	1553	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3013.3	33.22243	3	2289.942371	2289.943704	R	T	1382	1404
PSM	RQMSVPGIFNPHEIPEEMCD	1554	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:35,4-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3519.5	45.88592	3	2481.020471	2481.016419	K	-	1052	1072
PSM	SYDVPPPPMEPDHPFYSNISK	1555	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3431.5	43.78628	3	2496.076571	2496.070880	R	D	118	139
PSM	HQGVMVGMGQKDSYVGDEAQSK	1556	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2702.3	25.36833	4	2447.018494	2446.029426	R	R	42	64
PSM	QASVADYEETVKK	1557	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.2942.4	31.41682	2	1529.6649	1529.6645	R	A	82	95
PSM	MPSLPSYK	1558	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3117.2	35.84521	2	1017.424647	1017.424236	R	V	303	311
PSM	SRSGEGEVSGLMR	1559	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2518.4	20.79167	3	1460.614271	1459.612658	R	K	471	484
PSM	SGDEMIFDPTMSK	1560	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3325.5	41.16373	2	1610.5887	1610.5876	M	K	2	15
PSM	QLSSGVSEIR	1561	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3281.2	40.02223	2	1137.5067	1137.5062	R	H	80	90
PSM	SSIGTGYDLSASTFSPDGR	1562	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.4024.2	53.63522	3	2038.8612	2038.8512	M	V	2	21
PSM	CSVSLSNVEAR	1563	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3316.5	40.93055	2	1283.5237	1283.5212	R	R	726	737
PSM	SGWESYYK	1564	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3527.2	46.07577	2	1140.4187	1140.4160	M	T	2	10
PSM	ASLSLAPVNIFK	1565	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.6052.2	69.2124	2	1380.7087	1380.7049	M	A	2	14
PSM	QAGSVGGLQWCGEPK	1566	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3489.3	45.1798	2	1635.6757	1635.6747	R	R	190	205
PSM	MHRDSCPLDCK	1567	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2466.2	19.51347	3	1555.5593	1555.5614	-	V	1	12
PSM	MHRDSCPLDCK	1568	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2607.2	22.9503	3	1539.5644	1539.5664	-	V	1	12
PSM	SAWQATTQQAGLDCR	1569	sp|Q86UK7|ZN598_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2978.3	32.3183	3	1772.753471	1771.734899	K	V	851	866
PSM	SASSLLEQRPK	1570	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3061.4	34.42422	2	1336.6328	1336.6383	M	G	2	13
PSM	SFLFSSR	1571	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4591.2	59.05063	2	964.4057	964.4050	M	S	2	9
PSM	HQGVMVGMGQKDSYVGDEAQSK	1572	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2563.4	21.86213	4	2463.006094	2462.024341	R	R	42	64
PSM	QAGSLASLSDAPPLK	1573	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3247.2	39.15878	3	1534.734371	1533.743990	K	S	276	291
PSM	RASAILR	1574	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2504.2	20.42323	2	865.449847	865.453502	R	S	113	120
PSM	RRLSSTSLASGHSVR	1575	sp|Q9BZL6|KPCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2551.2	21.55008	4	1772.806094	1772.808412	K	L	194	209
PSM	QLSLTPR	1576	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2816.2	28.19322	2	893.434847	893.437183	R	T	55	62
PSM	NMSVIAHVDHGK	1577	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2673.2	24.62798	3	1386.605171	1386.611536	R	S	21	33
PSM	EIAEAYLGK	1578	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2833.2	28.62582	2	992.513847	992.517862	K	T	129	138
PSM	LVLVGDGGTGK	1579	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2767.2	27.01532	2	1014.569647	1014.570960	K	T	13	24
PSM	CESAFLSK	1580	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2713.2	25.6385	2	1020.397847	1020.398749	K	R	36	44
PSM	SMSTEGLMK	1581	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2830.3	28.5519	2	1062.413847	1062.412684	K	F	451	460
PSM	SRAWVLEK	1582	sp|O43709|BUD23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2810.2	28.04482	2	1067.5156	1067.5160	K	K	248	256
PSM	TSLGPNGLDK	1583	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2735.2	26.19872	2	1080.482247	1080.485256	R	M	50	60
PSM	SCNCLLLK	1584	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2997.3	32.80898	2	1086.457047	1086.460304	K	V	336	344
PSM	SLQSVAEER	1585	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2772.3	27.14857	2	1097.474447	1097.475419	R	A	97	106
PSM	TYQEHKASMHPVTAMLVGK	1586	sp|P09960|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2909.2	30.56177	4	2207.022494	2207.026847	R	D	588	607
PSM	SLSYSPVER	1587	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2809.2	28.02083	2	1116.482847	1116.485256	R	R	2690	2699
PSM	STLTDSLVCK	1588	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:4	ms_run[1]:scan=1.1.2876.2	29.72585	2	1122.554047	1122.559075	K	A	33	43
PSM	NGSLICTASK	1589	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2608.5	22.98592	2	1129.485047	1129.483876	R	D	185	195
PSM	AASAYAVGDVK	1590	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2711.2	25.58807	2	1130.498047	1130.500906	R	C	348	359
PSM	GMGSLDAMDK	1591	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2919.2	30.81993	2	1135.390647	1135.392678	R	H	413	423
PSM	NSSTYWEGK	1592	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2724.3	25.9193	2	1150.432247	1150.433220	K	A	280	289
PSM	SREDLSAQPVQTKFPAYER	1593	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2964.2	31.96295	4	2301.078494	2301.079076	K	V	617	636
PSM	RMQSLSLNK	1594	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2697.3	25.23943	2	1155.544247	1155.547144	K	-	173	182
PSM	RGSDIIIVGR	1595	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2862.2	29.36585	2	1164.598047	1164.601623	K	G	442	452
PSM	KLSQMILDK	1596	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2699.4	25.29448	2	1170.566247	1170.571963	R	K	364	373
PSM	EAAENSLVAYK	1597	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2736.3	26.22792	2	1193.588647	1193.592818	K	A	143	154
PSM	NPPGGKSSLVLG	1598	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2836.2	28.70305	2	1204.583047	1204.585304	R	-	143	155
PSM	NSSWYSSGSR	1599	sp|Q86XZ4|SPAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2644.4	23.88717	2	1209.440847	1209.445182	R	Y	478	488
PSM	DITSDTSGDFR	1600	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2782.2	27.39195	2	1212.527247	1212.525861	K	N	167	178
PSM	SNFAEALAAHK	1601	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2970.3	32.11458	2	1237.545847	1237.549253	K	Y	32	43
PSM	TLSSSSMDLSR	1602	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2888.4	30.03795	2	1262.515647	1262.521383	R	R	606	617
PSM	RSLTNSHLEK	1603	sp|Q9H2H9|S38A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2387.2	17.7046	3	1263.600971	1263.597266	R	K	51	61
PSM	SASAPTLAETEK	1604	sp|Q86W92-2|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2642.3	23.83492	2	1283.561247	1283.564628	R	E	532	544
PSM	DNSTMGYMAAK	1605	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2511.6	20.61705	2	1283.452247	1283.456340	R	K	621	632
PSM	EALQDVEDENQ	1606	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2722.3	25.86812	2	1288.539847	1288.541905	K	-	245	256
PSM	SMGLPTSDEQK	1607	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.2492.4	20.1418	2	1287.501447	1287.505399	K	K	298	309
PSM	SSPNPFVGSPPK	1608	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2987.4	32.55377	2	1292.577047	1292.580219	K	G	393	405
PSM	SNSFNNPLGNR	1609	sp|O95835|LATS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2945.4	31.49093	2	1298.538647	1298.540479	R	A	462	473
PSM	NIALRNDSESSGVLYSR	1610	sp|Q8IUI8|CRLF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2986.4	32.52798	3	1959.902171	1959.905135	R	A	291	308
PSM	KKTLEEEFAR	1611	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2616.3	23.18157	2	1329.629447	1329.632983	R	K	1186	1196
PSM	YRTTSSANNPNLMYQDECDRR	1612	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.2720.3	25.81742	4	2670.092094	2670.095214	R	L	567	588
PSM	AQSLEPYGTGLR	1613	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2991.4	32.65715	2	1370.616647	1370.623146	R	A	354	366
PSM	GFGYKGSCFHR	1614	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2687.5	24.98852	2	1394.555847	1394.559106	K	I	45	56
PSM	SPSASITDEDSNV	1615	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2824.3	28.39855	2	1400.531047	1400.534450	R	-	999	1012
PSM	NMSVIAHVDHGK	1616	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2728.5	26.02907	2	1402.604647	1402.606451	R	S	21	33
PSM	NMSVIAHVDHGK	1617	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2484.2	19.93355	3	1402.607771	1402.606451	R	S	21	33
PSM	KVTAEADSSSPTGILATSESK	1618	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2912.5	30.64907	3	2157.996671	2158.004240	R	S	485	506
PSM	NGVMPSHFSRGSK	1619	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2552.2	21.57547	3	1482.638771	1482.643898	R	S	85	98
PSM	NDSLVTPSPQQAR	1620	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2703.4	25.39622	2	1491.665447	1491.671887	R	V	144	157
PSM	RDSPLQGSGQQNSQAGQRNSTSSIEPR	1621	sp|O95819-2|M4K4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.2577.2	22.18157	4	3044.305694	3044.309849	R	L	606	633
PSM	SAADSISESVPVGPK	1622	sp|P45974|UBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2982.6	32.4312	2	1522.687647	1522.691620	R	V	779	794
PSM	NRESYEVSLTQK	1623	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2703.5	25.39955	2	1532.682647	1532.687203	K	T	206	218
PSM	RRTWDDDYVLK	1624	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2885.2	29.95355	3	1545.695171	1545.697708	R	R	1758	1769
PSM	GSSLSGTDDGAQEVVK	1625	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2716.4	25.72053	2	1628.689447	1628.693076	R	D	275	291
PSM	KDSSSVVEWTQAPK	1626	sp|Q8TC07|TBC15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2933.3	31.18158	3	1640.743871	1640.744718	R	E	68	82
PSM	DVVICPDASLEDAKK	1627	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:4	ms_run[1]:scan=1.1.2948.3	31.56312	3	1658.817371	1658.818537	R	E	49	64
PSM	SQSRSNSPLPVPPSK	1628	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2698.2	25.26182	3	1659.792671	1659.798150	R	A	297	312
PSM	ATAGDTHLGGEDFDNR	1629	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2651.4	24.06663	3	1674.720371	1674.723391	K	L	221	237
PSM	ASSLDAHEETISIEK	1630	sp|Q8TF05|PP4R1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2856.3	29.21498	3	1708.752071	1708.755677	R	R	536	551
PSM	ERAMSTTSISSPQPGK	1631	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2597.3	22.69627	3	1755.782171	1755.786265	K	L	265	281
PSM	KASAHSIVECDPVRK	1632	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2546.3	21.42573	3	1775.836871	1775.838970	R	E	34	49
PSM	SKSYDEGLDDYREDAK	1633	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2703.3	25.39288	3	1969.788971	1969.794247	R	L	879	895
PSM	EALEPSGENVIQNKESTG	1634	sp|O75477|ERLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2880.2	29.82697	3	1980.864071	1980.867746	K	-	331	349
PSM	DDDIEEGDLPEHKRPSAPVDFSK	1635	sp|Q14696|MESD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2989.5	32.6088	4	2675.176094	2675.175221	K	I	73	96
PSM	GGNFGGRSSGPYGGGGQYFAK	1636	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2926.5	31.00888	3	2099.883671	2099.885068	K	P	278	299
PSM	AYSSFGGGRGSRGSAGGHGSR	1637	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2405.6	18.13165	4	2126.842894	2126.843294	R	S	11	32
PSM	SGKQSIAIDDCTFHQCVR	1638	sp|Q96CW1|AP2M1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.2857.2	29.23683	4	2200.938094	2200.939489	K	L	236	254
PSM	FSMPGFK	1639	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3419.2	43.48213	2	892.356847	892.355427	K	A	885	892
PSM	SMTLEIR	1640	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3071.2	34.67657	2	928.409047	928.408919	R	E	346	353
PSM	DLSLDDFK	1641	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3314.3	40.87203	2	951.454847	951.454927	K	G	84	92
PSM	SLLSAALAK	1642	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3271.2	39.7676	2	952.500647	952.499449	K	S	1071	1080
PSM	SFAVGMFK	1643	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3452.2	44.3058	2	965.411047	965.408191	K	G	72	80
PSM	GLTSVINQK	1644	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3070.3	34.65388	2	1038.510247	1038.511076	R	L	300	309
PSM	DVIEEYFK	1645	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3392.4	42.84807	2	1041.503847	1041.501878	K	C	122	130
PSM	SISLEPLQK	1646	sp|Q8N0T1|RBIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3172.3	37.22765	2	1093.543247	1093.542042	K	E	67	76
PSM	ALLYLCGGDD	1647	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3442.2	44.05865	2	1095.493447	1095.490661	K	-	330	340
PSM	AVDSLVPIGR	1648	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	40.58552	2	1105.553847	1105.553276	K	G	195	205
PSM	AVDSLVPIGR	1649	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3311.3	40.79422	2	1105.553847	1105.553276	K	G	195	205
PSM	DKFSFDLGK	1650	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3221.2	38.49327	2	1135.495847	1135.495092	K	G	75	84
PSM	APGSVVELLGK	1651	sp|O95363|SYFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3418.2	43.45704	2	1148.586847	1148.584241	R	S	46	57
PSM	TGSQGQCTQVRVEFMDDTSR	1652	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3118.2	35.87093	4	2380.978094	2380.977725	R	S	21	41
PSM	MSSTIFSTGGK	1653	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3031.2	33.67727	2	1194.495847	1194.499191	R	D	18	29
PSM	SMSAPVIFDR	1654	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3107.2	35.59803	2	1217.515047	1217.515176	K	S	117	127
PSM	VQSYEFLQK	1655	sp|Q9NVU0|RPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3082.3	34.95965	2	1220.547047	1220.547856	R	K	190	199
PSM	QLSILVHPDK	1656	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	35.4225	2	1228.619247	1228.621690	R	N	79	89
PSM	DIDISSPEFK	1657	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3236.2	38.87403	2	1229.522847	1229.521701	K	I	172	182
PSM	QCSFSEYLK	1658	sp|P26374|RAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3245.4	39.11357	2	1240.484247	1240.483541	R	T	319	328
PSM	KDSFFSNISR	1659	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3069.4	34.63133	2	1279.560047	1279.559818	K	S	562	572
PSM	KGSCNLSRVDSTTCLFPVEEK	1660	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,4-UNIMOD:4,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3301.4	40.54102	4	2586.096494	2586.089657	K	A	251	272
PSM	DAGTIAGLNVMR	1661	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3443.4	44.08757	2	1296.589047	1296.589737	K	I	186	198
PSM	SVPTSTVFYPSDGVATEK	1662	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3297.4	40.44072	3	1963.883771	1963.881605	R	A	439	457
PSM	ENRQSIINPDWNFEK	1663	sp|P46459|NSF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3278.2	39.9446	3	1968.875471	1968.873106	K	M	203	218
PSM	FSVCVLGDQQHCDEAK	1664	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3120.5	35.9326	3	1971.786071	1971.785614	K	A	63	79
PSM	KITIADCGQLE	1665	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3013.2	33.2191	2	1326.584647	1326.589069	K	-	155	166
PSM	GGYIGSTYFER	1666	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3286.3	40.15473	2	1328.544847	1328.543833	R	C	170	181
PSM	QSSMSEDSDSGDDFFIGK	1667	sp|Q8NEF9|SRFB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3403.4	43.09523	3	2030.748371	2030.745248	K	V	272	290
PSM	NLSIYDGPEQR	1668	sp|Q16134|ETFD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3007.6	33.07692	2	1370.582447	1370.586761	R	F	549	560
PSM	AVGSISSTAFDIR	1669	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3403.6	43.1019	2	1402.652447	1402.649361	K	F	704	717
PSM	DKPSVEPVEEYDYEDLK	1670	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3217.5	38.40117	3	2133.906371	2133.903129	R	E	46	63
PSM	TLTIVDTGIGMTK	1671	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3570.3	47.061	2	1428.692447	1428.693534	R	A	28	41
PSM	NTGIICTIGPASR	1672	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3074.6	34.76731	2	1438.661647	1438.663965	R	S	44	57
PSM	TLTIVDTGIGMTK	1673	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3317.3	40.94995	2	1444.688247	1444.688449	R	A	28	41
PSM	CLELFSELAEDK	1674	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3746.3	49.8104	2	1452.681847	1452.680647	K	E	412	424
PSM	GALQNIIPASTGAAK	1675	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3215.5	38.34963	2	1490.746447	1490.749409	R	A	201	216
PSM	TTPSVVAFTADGER	1676	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3135.5	36.3087	2	1529.675247	1529.676304	R	L	86	100
PSM	RLSSASTGKPPLSVEDDFEK	1677	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	37.5119	3	2322.024371	2322.018190	R	L	756	776
PSM	LTFDSSFSPNTGKK	1678	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3008.2	33.0895	3	1607.723171	1607.723254	K	N	97	111
PSM	QRSQVEEELFSVR	1679	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3217.2	38.39117	3	1685.778371	1685.777415	R	V	2359	2372
PSM	GYSFTTTAEREIVR	1680	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3267.2	39.66722	3	1708.785971	1708.782166	R	D	197	211
PSM	RSSWRVVSSIEQK	1681	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3006.2	33.0378	3	1720.768571	1720.769901	R	T	56	69
PSM	ASFENNCEIGCFAK	1682	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3188.2	37.63868	3	1725.662771	1725.652809	R	L	5	19
PSM	DSSSLSSCTSGILEER	1683	sp|Q9H3Q1|BORG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3245.3	39.11023	3	1806.735071	1806.734289	R	S	306	322
PSM	QTGKTSIAIDTIINQK	1684	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3238.4	38.93253	3	1809.925271	1809.923745	R	R	215	231
PSM	TLNDRSSIVMGEPISQSSSNSQ	1685	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3097.3	35.3481	4	2416.060894	2416.057749	R	-	762	784
PSM	SSASAPDVDDPEAFPALA	1686	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4083.2	54.42177	2	1838.763447	1838.761156	K	-	391	409
PSM	VSSKNSLESYAFNMK	1687	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,6-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3117.3	35.84855	3	1879.750571	1879.746449	K	A	536	551
PSM	SSTPPGESYFGVSSLQLK	1688	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3764.2	50.05737	3	1962.900371	1962.897590	K	G	1041	1059
PSM	ANAGPNTNGSQFFICTAK	1689	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3227.4	38.65073	3	1976.8491706434902	1976.8451770994302	M	T	101	119
PSM	SDRGSGQGDSLYPVGYLDK	1690	sp|Q5J8M3|EMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3273.3	39.82065	3	2092.917371	2092.910280	R	Q	32	51
PSM	KVTHAVVTVPAYFNDAQR	1691	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3092.4	35.22248	3	2095.024871	2095.025190	K	Q	164	182
PSM	QGTEIDGRSISLYYTGEK	1692	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3249.2	39.20962	3	2095.949171	2095.946331	K	G	450	468
PSM	DNLTLWTSDQQDEEAGEGN	1693	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3496.4	45.35658	3	2120.880671	2120.877051	R	-	228	247
PSM	EGRQSGEAFVELGSEDDVK	1694	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3096.3	35.32253	3	2130.911771	2130.910674	R	M	50	69
PSM	ARSVDALDDLTPPSTAESGSR	1695	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3131.5	36.2071	3	2223.997571	2224.000886	R	S	491	512
PSM	RQMSVPGIFNPHEIPEEMCD	1696	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3731.4	49.5646	3	2465.024471	2465.021504	K	-	1052	1072
PSM	HNGTGGKSIYGEKFEDENFILK	1697	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3203.4	38.03523	4	2562.183294	2562.179185	R	H	70	92
PSM	RKDSSEESDSSEESDIDSEASSALFMAK	1698	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3375.6	42.43327	4	3116.270494	3116.265295	R	K	338	366
PSM	NYAGEEEEEGSGSSEGFDPPATDRQFSGAR	1699	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3025.6	33.5351	4	3255.288894	3255.290204	R	N	191	221
PSM	YKLDEDEDEDDADLSKYNLDASEEEDSNK	1700	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3221.5	38.50327	4	3473.366094	3473.367905	K	K	167	196
PSM	LSELLR	1701	sp|Q92538|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2939.2	31.33358	2	809.405247	809.404820	R	K	173	179
PSM	QIRSSTTSMTSVPK	1702	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2432.4	18.69418	3	1617.738071	1617.743338	R	P	81	95
PSM	ASGVAVSDGVIK	1703	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	38.69498	2	1223.5780	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	1704	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3221.3	38.4966	2	1223.5780	1223.5794	M	V	2	14
PSM	HQGVMVGMGQKDCYVGDEAQSK	1705	sp|Q562R1|ACTBL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2446.2	19.00763	4	2503.049694	2503.033131	R	R	41	63
PSM	QVSLPVTK	1706	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	40.17727	2	933.4583	933.4567	R	S	721	729
PSM	QMSVPGIFNPHEIPEEMCD	1707	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,17-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1.1.3935.2	52.49249	3	2324.917871	2324.915308	R	-	1053	1072
PSM	QMSVPGIFNPHEIPEEMCD	1708	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3908.2	52.22595	3	2324.920271	2324.915308	R	-	1053	1072
PSM	SIPLSIK	1709	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3083.2	34.98218	2	836.4401	836.4403	K	N	515	522
PSM	LYGPSSVSFADDFVRSSK	1710	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3732.2	49.57993	3	2120.889371	2120.885719	R	Q	134	152
PSM	SILKLDGDVLMK	1711	sp|Q9BRT6|LLPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3306.4	40.6686	3	1426.719371	1426.714270	K	D	31	43
PSM	CGSVLVR	1712	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	40.92055	2	852.3566	852.3560	R	L	188	195
PSM	SADAAAGAPLPR	1713	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.2965.4	31.99523	2	1217.5417	1217.5436	M	L	2	14
PSM	SFLFSSRSSK	1714	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4053.2	54.04402	2	1346.5299	1346.5304	M	T	2	12
PSM	ALSTWK	1715	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2822.2	28.34557	2	784.3483	784.3515	R	Q	174	180
PSM	TGSAVPRELLEK	1716	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2971.4	32.14258	2	1378.682047	1378.685746	R	L	527	539
PSM	KQSVEDILK	1717	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2812.3	28.09653	2	1138.562647	1138.563506	R	D	406	415
PSM	SRGSSAGFDR	1718	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2466.5	19.52347	2	1160.4585	1160.4606	M	H	2	12
PSM	RLSESSALK	1719	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2502.2	20.37168	2	1069.515847	1069.516890	R	Q	73	82
PSM	RFSLDER	1720	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2693.2	25.13282	2	1001.431847	1001.433160	K	S	796	803
PSM	LWPRASAVGER	1721	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2915.2	30.71637	3	1320.629471	1320.633986	R	L	502	513
PSM	RASLTLEEK	1722	sp|Q6P3W7|SCYL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2594.3	22.61878	2	1125.541847	1125.543105	K	Q	675	684
PSM	KEAVATLEK	1723	sp|Q9UPV0|CE164_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2810.2	28.04482	2	1067.516047	1067.526392	R	E	760	769
PSM	SMAASGNLGHTPFVDEL	1724	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3810.2	50.80605	3	1824.780971	1824.775366	K	-	437	454
PSM	SFDACVK	1725	sp|Q9Y666|S12A7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2640.2	23.77998	2	905.334047	905.335420	R	A	319	326
PSM	SGPKPFSAPKPQTSPSPK	1726	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2579.2	22.23062	4	1916.95289419132	1916.93972882784	R	R	295	313
PSM	RWNSLPSENHK	1727	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2611.5	23.06385	3	1446.633371	1446.640527	K	E	157	168
PSM	RYYSIDDNQNK	1728	sp|Q8NI08|NCOA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2585.2	22.38437	3	1494.619871	1494.614038	K	T	86	97
PSM	LGTPALTSR	1729	sp|P34896|GLYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2725.2	25.94158	2	994.483647	994.484862	R	G	403	412
PSM	HSVGVVIGR	1730	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2643.2	23.85597	2	1002.497847	1002.501180	R	S	332	341
PSM	DWDDDQND	1731	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2580.3	22.25905	2	1021.324847	1021.326098	K	-	541	549
PSM	GRNSATSADEQPHIGNYR	1732	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2586.2	22.41017	4	2051.880894	2051.881045	R	L	37	55
PSM	SVSTMNLSK	1733	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2673.3	24.63132	2	1045.451047	1045.451513	R	Y	181	190
PSM	SGSVYEPLK	1734	sp|Q93100|KPBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2825.3	28.42342	2	1058.466847	1058.468543	R	S	25	34
PSM	AASPFRSSVQGASSR	1735	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2569.4	22.014	3	1586.721971	1586.720234	R	E	262	277
PSM	RGAPGAEHEPSLSSR	1736	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2467.3	19.5418	3	1629.725171	1629.726048	R	H	95	110
PSM	LGPKSSVLIAQQTDTSDPEK	1737	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2913.2	30.66467	4	2193.053294	2193.056610	R	V	449	469
PSM	GRTASETRSEGSEYEEIPK	1738	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2650.4	24.04078	4	2204.958094	2204.958687	R	R	1081	1100
PSM	RASSDLSIASSEEDK	1739	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2671.4	24.58335	3	1673.709971	1673.714540	K	L	338	353
PSM	GRMSMKEVDEQMLNVQNK	1740	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2885.5	29.96355	4	2231.970494	2231.973825	R	N	319	337
PSM	ASAVALEVQR	1741	sp|O00418|EF2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2787.3	27.51763	2	1122.537447	1122.543439	R	L	499	509
PSM	SNQIPTEVR	1742	sp|Q9BWH2|FUND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2685.2	24.9271	2	1122.506047	1122.507054	K	S	151	160
PSM	DVSLGTYGSR	1743	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2868.4	29.52535	2	1133.472447	1133.475419	R	A	934	944
PSM	KLSQMILDK	1744	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	32.06255	2	1154.573847	1154.577048	R	K	364	373
PSM	NRSLADFEK	1745	sp|O00231|PSD11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2698.3	25.26515	2	1158.510247	1158.507054	K	A	296	305
PSM	RGGSGSHNWGTVKDELTESPK	1746	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2861.4	29.34682	4	2321.040494	2321.043754	K	Y	216	237
PSM	CRNSIASCADEQPHIGNYR	1747	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2760.4	26.84053	4	2326.958494	2326.957264	R	L	39	58
PSM	AQATSRLSTASCPTPK	1748	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2488.3	20.03898	3	1754.796371	1754.802250	R	V	273	289
PSM	SFQQELDAR	1749	sp|Q99598|TSNAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2869.5	29.55475	2	1172.482447	1172.486318	K	H	41	50
PSM	SDTSSPEVRQSHSESPSLQSK	1750	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2469.3	19.57658	4	2352.026494	2352.023078	R	S	1069	1090
PSM	GGNFGGRSSGPYGGGGQYFAKPR	1751	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2858.2	29.26267	4	2353.040894	2353.038943	K	N	330	353
PSM	GGSGSGPTIEEVD	1752	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2765.5	26.9737	2	1203.522847	1203.525526	K	-	629	642
PSM	ALANSLACQGK	1753	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2625.2	23.40348	2	1211.535247	1211.536974	R	Y	332	343
PSM	YESLKGVDPK	1754	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2622.2	23.32592	3	1214.559371	1214.558421	R	F	29	39
PSM	VKPETPPRQSHSGSISPYPK	1755	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2654.5	24.14747	4	2431.037294	2431.037559	K	V	979	999
PSM	SASWGSADQLK	1756	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2903.3	30.41033	2	1228.509447	1228.512533	R	E	221	232
PSM	LGMLSPEGTCK	1757	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2983.5	32.4537	2	1271.528447	1271.529111	R	A	203	214
PSM	DSGSISLQETR	1758	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2701.4	25.34595	2	1271.536447	1271.539476	K	R	776	787
PSM	EKRSVVSFDK	1759	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2509.3	20.55547	3	1273.605071	1273.606768	R	V	598	608
PSM	NFSDNQLQEGK	1760	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2604.5	22.88337	2	1278.580247	1278.584044	R	N	161	172
PSM	SMGLPTSDEQK	1761	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.2753.4	26.65952	2	1287.500847	1287.505399	K	K	298	309
PSM	MKSLEQDALR	1762	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2588.4	22.46792	2	1285.569247	1285.573753	R	A	1506	1516
PSM	LGSYSGPTSVSR	1763	sp|Q9BZ23|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2748.3	26.5302	2	1289.562847	1289.565297	R	Q	187	199
PSM	AQSREQLAALK	1764	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2627.3	23.45678	2	1293.6402470956602	1293.64421553249	R	K	61	72
PSM	GRLSKEEIER	1765	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2450.3	19.11717	2	1295.6206	1295.6230	K	M	508	518
PSM	MGPSGGEGMEPERRDSQDGSSYR	1766	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,9-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=1.1.2394.5	17.85368	4	2595.994894	2595.995560	R	R	131	154
PSM	GVDGSFLARPSK	1767	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2842.4	28.86472	2	1312.616647	1312.617667	R	S	24	36
PSM	KKASSSDSEDSSEEEEEVQGPPAK	1768	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2455.6	19.24437	4	2629.092494	2629.091611	K	K	80	104
PSM	SYVKLPSASAQS	1769	sp|Q5T653|RM02_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2925.4	30.98042	2	1316.596647	1316.601348	K	-	294	306
PSM	QIRSSTTSMTSVPKPLK	1770	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2841.5	28.8421	3	2019.944771	2019.946545	R	F	81	98
PSM	KRDFSLEQLR	1771	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2880.3	29.8303	2	1370.668047	1370.670765	K	Q	100	110
PSM	GSITEYTAAEEK	1772	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2756.3	26.73345	2	1377.565247	1377.570108	K	E	113	125
PSM	NQIHVKSPPREGSQGELTPANSQSR	1773	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2584.5	22.36863	4	2796.325294	2796.330434	R	M	462	487
PSM	VTDSSVSVQLRE	1774	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2866.3	29.47147	2	1398.635247	1398.639190	R	-	264	276
PSM	SMGLPTSDEQKK	1775	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.2408.3	18.18868	3	1415.599871	1415.600362	K	Q	298	310
PSM	QASVADYEETVK	1776	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2813.5	28.12782	2	1418.594847	1418.596657	R	K	82	94
PSM	SLSPQEDALTGSR	1777	sp|Q96EN8|MOCOS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2887.6	30.01868	2	1439.624847	1439.629354	R	V	528	541
PSM	NNSGEEFDCAFR	1778	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:4	ms_run[1]:scan=1.1.2939.6	31.34692	2	1444.566047	1444.567742	R	L	591	603
PSM	SLYASSPGGVYATR	1779	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2968.5	32.07255	2	1507.667447	1507.670825	R	S	51	65
PSM	SRWNQDTMEQK	1780	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2395.3	17.86883	3	1517.595071	1517.597008	R	T	20	31
PSM	ALQRPSAAAPQAENGPAAAPAVAAPAATEAPK	1781	sp|Q15020|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2954.6	31.72028	4	3044.503294	3044.508064	R	M	919	951
PSM	DTASLSTTPSESPR	1782	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2602.6	22.83512	2	1527.642447	1527.645398	R	A	259	273
PSM	IHKNSSTYWEGK	1783	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2506.2	20.47455	3	1528.669271	1528.671159	K	A	277	289
PSM	QASVADYEETVKK	1784	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2677.3	24.73422	2	1546.688047	1546.691620	R	A	82	95
PSM	QLSSSSSYSGDISR	1785	sp|P33527|MRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2717.4	25.74563	2	1552.635847	1552.640647	R	H	913	927
PSM	LAVDEEENADNNTK	1786	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2498.6	20.28267	2	1560.684247	1560.690360	K	A	40	54
PSM	LQSIGTENTEENR	1787	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2589.5	22.497	2	1569.664647	1569.667196	R	R	44	57
PSM	RLAEALPKQSVDGK	1788	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2593.2	22.58993	3	1590.813071	1590.813072	R	A	164	178
PSM	RATGNLSASCGSALR	1789	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2579.3	22.23395	3	1599.723671	1599.718854	R	A	72	87
PSM	ESLKEEDESDDDNM	1790	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2379.3	17.51327	3	1670.612771	1670.610121	K	-	242	256
PSM	IHRASDPGLPAEEPK	1791	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2557.5	21.7139	3	1695.795671	1695.798150	R	E	1855	1870
PSM	QKKESEAVEWQQK	1792	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2502.3	20.37502	3	1696.778171	1696.782166	R	A	436	449
PSM	SSSEAKPTSLGLAGGHK	1793	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2566.3	21.93333	3	1705.801571	1705.803630	K	E	277	294
PSM	RAPDQAAEIGSRGSTK	1794	sp|Q3ZCQ8|TIM50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2400.4	18.00492	3	1722.805571	1722.805027	R	A	32	48
PSM	LQSIGTENTEENRR	1795	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2514.5	20.69155	3	1725.766571	1725.768307	R	F	44	58
PSM	QSRGEPPLPEEDLSK	1796	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2847.5	28.99717	3	1760.793971	1760.798210	R	L	289	304
PSM	SKSVKEDSNLTLQEK	1797	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2536.3	21.175	3	1784.853371	1784.855725	K	K	1441	1456
PSM	FESSYRNSLDSFGGR	1798	sp|Q5BKZ1|ZN326_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2975.4	32.2441	3	1800.751871	1800.746843	R	N	111	126
PSM	FRRQSEDPSCPNER	1799	sp|Q4KMQ2|ANO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2369.2	17.28178	3	1856.760971	1856.762510	K	Y	252	266
PSM	NKTSTTSSMVASAEQPR	1800	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2428.5	18.59443	3	1889.819471	1889.819022	K	R	17	34
PSM	DKGDEEEEGEEKLEEK	1801	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2513.6	20.66902	3	1891.814471	1891.817077	K	Q	536	552
PSM	RKTDFFIGGEEGMAEK	1802	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2983.4	32.45037	3	1893.833771	1893.833215	R	L	38	54
PSM	AQALRDNSTMGYMMAK	1803	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.2963.4	31.94393	3	1898.768171	1898.772606	K	K	481	497
PSM	ALPRRSTSPIIGSPPVR	1804	sp|Q86TB9|PATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2932.3	31.15563	3	1962.978971	1962.980563	R	A	172	189
PSM	SLRINSTATPDQDRDK	1805	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2631.5	23.56157	3	1975.835771	1975.840166	K	I	1089	1105
PSM	RGGHSSVSTESESSSFHSS	1806	sp|P61073|CXCR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2413.5	18.31032	3	2030.800871	2030.796707	K	-	334	353
PSM	QLSILVHPDKNQDDADR	1807	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2989.2	32.5988	4	2042.945694	2042.942249	R	A	79	96
PSM	NGRKTLTTVQGIADDYDK	1808	sp|O60739|EIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2971.5	32.14592	3	2073.968171	2073.973214	R	K	39	57
PSM	SGSRSSSLGSTPHEELER	1809	sp|Q9NRA8|4ET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2630.6	23.5399	3	2074.831271	2074.835809	R	L	347	365
PSM	RKTSDFNTFLAQEGCTK	1810	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2998.5	32.84163	3	2081.922971	2081.924156	R	G	197	214
PSM	LRKGSDALRPPVPQGEDEVPK	1811	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2814.4	28.14932	4	2367.1944941913202	2367.1947742935395	R	A	306	327
PSM	KQSQIQNQQGEDSGSDPEDTY	1812	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2636.5	23.68967	3	2432.952971	2432.960537	R	-	899	920
PSM	GRSSESSCGVDGDYEDAELNPR	1813	sp|P11274|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2855.6	29.2003	3	2478.956471	2478.959492	R	F	233	255
PSM	SCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGK	1814	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2560.6	21.79392	4	3412.334094	3412.340979	K	L	107	139
PSM	LSFSVSR	1815	sp|Q8N983|RM43_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3019.2	33.3665	2	874.391847	874.394984	R	D	29	36
PSM	FASFIDK	1816	sp|P35908|K22E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3293.2	40.33192	2	906.388847	906.388836	K	V	189	196
PSM	GNSLFFR	1817	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3231.2	38.74637	2	919.398247	919.395318	R	K	281	288
PSM	DLAGSIIGK	1818	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3147.2	36.60637	2	952.463447	952.463064	K	G	397	406
PSM	KLSFDFQ	1819	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3316.4	40.92722	2	963.411447	963.410300	R	-	465	472
PSM	KLSFDFQ	1820	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3420.3	43.51105	2	963.411847	963.410300	R	-	465	472
PSM	TSLPCIPR	1821	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3075.2	34.77905	2	1022.462447	1022.462018	R	E	311	319
PSM	KKYSDADIEPFLK	1822	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	34.24097	3	1632.779471	1632.780041	K	N	1858	1871
PSM	MSDGLFLQK	1823	sp|P50213|IDH3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3270.2	39.74267	2	1117.490647	1117.487898	R	C	206	215
PSM	ITIADCGQLE	1824	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3083.3	34.98552	2	1118.524447	1118.527775	K	-	156	166
PSM	SASQSSLDKLDQELK	1825	sp|O60271|JIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3126.3	36.07615	3	1727.796671	1727.797876	R	E	728	743
PSM	ASSLEDLVLK	1826	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3459.2	44.43559	2	1153.565247	1153.563172	R	E	254	264
PSM	FEDENFILK	1827	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3230.3	38.72402	2	1153.565847	1153.565540	K	H	83	92
PSM	GRYSLDVWS	1828	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3385.2	42.66978	2	1161.487447	1161.485590	K	-	669	678
PSM	KQSLPATSIPTPASFK	1829	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3213.3	38.29118	3	1751.886971	1751.885903	R	F	1507	1523
PSM	SADTLWDIQK	1830	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3155.2	36.80713	2	1175.580247	1175.582253	K	D	320	330
PSM	ETELLGSFSK	1831	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3217.3	38.3945	2	1189.525647	1189.526786	K	N	1167	1177
PSM	SRESMIQLF	1832	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3622.3	48.04353	2	1189.522647	1189.520261	K	-	449	458
PSM	DNSILPPLDK	1833	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3256.2	39.38725	2	1190.559247	1190.558421	R	E	1678	1688
PSM	SPSLNLLQNK	1834	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3184.3	37.53792	2	1192.585247	1192.585304	R	S	529	539
PSM	SESAPTLHPYSPLSPK	1835	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3051.4	34.17198	3	1789.827971	1789.828782	R	G	100	116
PSM	SSPSIICMPK	1836	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3078.3	34.85722	2	1198.511647	1198.512733	R	Q	169	179
PSM	SRESMIQLF	1837	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3355.3	41.90872	2	1205.516047	1205.515176	K	-	449	458
PSM	DSPSVWAAVPGK	1838	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3132.4	36.22945	2	1212.611847	1212.613888	K	T	27	39
PSM	SVDFDSLTVR	1839	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3412.3	43.31287	2	1217.531647	1217.532934	K	T	458	468
PSM	IGKGSFGEVFK	1840	sp|Q9Y6E0|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3072.4	34.70935	2	1247.593847	1247.595140	K	G	42	53
PSM	SFSEDAVTDSSGSGTLPR	1841	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3087.5	35.09608	3	1891.786271	1891.783682	K	A	1192	1210
PSM	GSSGVGLTAAVLR	1842	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.5	40.80088	2	1266.634647	1266.633317	R	D	408	421
PSM	SYSSTLTDMGR	1843	sp|O94875|SRBS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3070.5	34.66055	2	1296.504047	1296.505733	R	S	841	852
PSM	HLSSLTDNEQADIFER	1844	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3293.4	40.33858	3	1953.854471	1953.846951	R	V	483	499
PSM	DVLSVAFSSDNR	1845	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3349.5	41.76266	2	1308.632247	1308.630994	K	Q	107	119
PSM	SFEQISANITK	1846	sp|P08237|PFKAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3135.3	36.30203	2	1316.601047	1316.601348	K	F	477	488
PSM	DSPPKNSVKVDELSLYSVPEGQSK	1847	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3231.4	38.75303	4	2682.282894	2682.278958	K	Y	28	52
PSM	ISMPDVDLHLK	1848	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	44.3438	3	1346.634971	1346.630540	K	G	818	829
PSM	ISFSNIISDMK	1849	sp|Q92665|RT31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3542.3	46.40387	2	1349.592047	1349.593820	K	V	199	210
PSM	SMPWNVDTLSK	1850	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3503.2	45.52887	2	1356.579047	1356.578504	K	D	111	122
PSM	KKASLVALPEQTASEEETPPPLLTK	1851	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3269.5	39.72757	4	2756.435694	2756.424894	R	E	397	422
PSM	NSLESYAFNMK	1852	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3378.4	42.50368	2	1382.560447	1382.557769	K	A	540	551
PSM	DFTPVCTTELGR	1853	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3117.4	35.85188	2	1394.649447	1394.650015	R	A	42	54
PSM	ATSVDYSSFADR	1854	sp|Q86YS7-2|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3019.5	33.3765	2	1397.547447	1397.550041	R	C	853	865
PSM	NVGFESDTGGAFK	1855	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3101.3	35.45178	2	1407.570447	1407.570776	R	G	47	60
PSM	YQIDPDACFSAK	1856	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3045.2	34.01748	2	1413.623447	1413.623466	K	V	225	237
PSM	SINKLDSPDPFK	1857	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3068.4	34.60545	2	1439.669247	1439.669762	R	L	790	802
PSM	ESMATGSIPITVR	1858	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3245.6	39.12023	2	1440.669047	1440.668382	K	H	753	766
PSM	SVFGTPTLETANK	1859	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3169.4	37.15465	2	1443.662847	1443.664677	K	N	1140	1153
PSM	KNSRVTFSEDDEIINPEDVDPSVGR	1860	sp|Q12972|PP1R8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3328.4	41.2381	4	2897.316094	2897.308027	R	F	197	222
PSM	SISQSSTDSYSSAASYTDSSDDEVSPR	1861	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3052.6	34.20347	4	2908.144894	2908.140746	R	E	66	93
PSM	DAQPSFSAEDIAK	1862	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3104.3	35.52797	2	1457.606847	1457.607556	K	I	271	284
PSM	STGGAPTFNVTVTK	1863	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3082.5	34.96632	2	1458.675047	1458.675576	K	T	92	106
PSM	SSTDFSELEQPR	1864	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3068.5	34.60878	2	1474.596247	1474.597719	R	S	956	968
PSM	GTSGSLADVFANTR	1865	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	41.332	2	1474.646847	1474.645338	K	I	199	213
PSM	GFSVVADTPELQR	1866	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3444.5	44.11652	2	1497.684847	1497.686475	K	I	97	110
PSM	TSSTDEVLSLEEK	1867	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3125.5	36.0584	2	1516.656047	1516.654566	R	D	528	541
PSM	DTYSDRSGSSSPDSEITELKFPSINHD	1868	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	46.6249	4	3063.297694	3063.298250	R	-	565	592
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1869	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3193.5	37.77855	4	3091.328494	3091.317665	K	T	186	213
PSM	DTSFSGLSLEEYK	1870	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	46.83378	2	1554.646847	1554.649086	R	L	77	90
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	1871	sp|P13807|GYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3142.6	36.49193	4	3185.436894	3185.436140	K	-	708	738
PSM	SMGETESGDAFLDLK	1872	sp|Q9NRA8|4ET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3423.5	43.59723	2	1694.681647	1694.674649	R	K	5	20
PSM	NQLTSNPENTVFDAK	1873	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3203.6	38.0419	2	1756.766647	1756.766910	K	R	82	97
PSM	RSLSRSISQSSTDSYSSAASYTDSSDDEVSPR	1874	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3002.5	32.94477	4	3587.450094	3587.457420	R	E	61	93
PSM	KDSETGENIRQAASSLQQASLK	1875	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3141.3	36.45662	4	2440.1632	2440.1590	R	L	625	647
PSM	ITKPGSIDSNNQLFAPGGR	1876	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3075.6	34.79239	3	2050.984871	2050.983719	K	L	1072	1091
PSM	DNLTLWTSDQQDDDGGEGNN	1877	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3550.2	46.57618	3	2192.871371	2192.873028	R	-	228	248
PSM	RDSSDDWEIPDGQITVGQR	1878	sp|P15056|BRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3373.6	42.38173	3	2252.976671	2252.969920	R	I	444	463
PSM	DSALQDTDDSDDDPVLIPGAR	1879	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3519.4	45.87925	3	2293.964171	2293.958746	R	Y	648	669
PSM	FVEWLQNAEEESESEGEEN	1880	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3892.3	52.085	3	2333.892071	2333.884913	K	-	401	420
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1881	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3019.6	33.37983	3	2559.239171	2559.241253	K	S	97	122
PSM	SCTPSPDQISHRASLEDAPVDDLTR	1882	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	36.35365	4	2846.252094	2846.254217	R	K	271	296
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1883	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3130.6	36.18508	4	3221.395294	3221.393230	R	S	38	70
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	1884	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3525.6	46.03448	4	3456.448894	3456.442334	R	-	207	238
PSM	EFKRETGVDLTK	1885	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2581.4	22.28793	3	1501.715171	1501.717775	K	D	289	301
PSM	QYMRRSTCTINYSK	1886	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,6-UNIMOD:21,7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2847.6	29.0005	3	1949.7556	1949.7561	K	D	515	529
PSM	ISVREPMQTGIK	1887	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2889.5	30.06713	2	1437.699847	1437.705102	R	A	183	195
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1888	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3140.4	36.43442	4	3222.378094	3221.393230	R	S	38	70
PSM	ASGVAVSDGVIK	1889	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3418.4	43.4637	2	1303.5473	1303.5457	M	V	2	14
PSM	CTSVSSLDSFESR	1890	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3764.3	50.06403	2	1536.5847	1536.5798	R	S	1387	1400
PSM	QASTDAGTAGALTPQHVR	1891	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=1.1.2865.2	29.44302	3	1842.8203	1842.8256	R	A	107	125
PSM	FASENDLPEWK	1892	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3377.2	42.47118	3	1415.587271	1414.580613	R	E	58	69
PSM	CESAFLSK	1893	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3309.2	40.73933	2	1003.3715	1003.3717	K	R	36	44
PSM	DASLMVTNDGATILK	1894	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3272.6	39.8058	2	1643.747847	1643.747755	R	N	58	73
PSM	ALSRQEMQEVQSSR	1895	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2661.3	24.32207	3	1807.735871	1807.732529	K	S	187	201
PSM	SIRPGLSPYR	1896	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2779.2	27.32315	2	1224.5991	1224.6011	R	A	52	62
PSM	SVGEVMAIGR	1897	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2757.2	26.75583	2	1113.485647	1113.488961	K	T	794	804
PSM	QMSVPGIFNPHEIPEEMCD	1898	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,2-UNIMOD:35,3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4952.2	61.78988	3	2307.8917	2307.8882	R	-	1053	1072
PSM	MSGGWELELNGTEAK	1899	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	44.46477	3	1717.699871	1716.706618	K	L	105	120
PSM	ASSVTTFTGEPNTCPR	1900	sp|P52943|CRIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	2-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2857.3	29.24017	3	1803.7511	1803.7494	R	C	113	129
PSM	DSSTSPGDYVLSVSENSR	1901	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3434.5	43.86392	3	1978.821971	1978.815711	R	V	39	57
PSM	DRIFSQDSLCSQENYIIDK	1902	sp|Q15032|R3HD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3516.5	45.81053	3	2412.052871	2410.051207	R	R	295	314
PSM	AVADAIRTSLGPK	1903	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2845.2	28.93538	3	1377.702971	1377.701731	K	G	43	56
PSM	SLSHLYR	1904	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3093.2	35.24175	2	996.4412	996.4425	M	D	2	9
PSM	SKAELLLLK	1905	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3115.3	35.79813	2	1093.615247	1093.614813	K	L	147	156
PSM	SIQEIQELDKDDESLRK	1906	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3046.4	34.04842	3	2124.999971	2124.994009	K	Y	34	51
PSM	SAVGHEYQSKLSK	1907	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2430.4	18.64265	3	1512.693671	1512.697374	K	H	98	111
PSM	RISAFR	1908	sp|P11802|CDK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2567.2	21.95588	2	828.396447	828.400738	K	A	283	289
PSM	DKSPVREPIDNLTPEER	1909	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2885.3	29.95688	4	2073.955294	2073.973214	K	D	134	151
PSM	KQSLGELIGTLNAAK	1910	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3413.2	43.3341	3	1622.832371	1621.844038	R	V	56	71
PSM	SIVFHR	1911	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2647.2	23.9567	2	837.386847	837.389839	K	K	135	141
PSM	SMLFKR	1912	sp|O75438|NDUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2712.2	25.61327	2	860.397247	860.397961	K	E	42	48
PSM	RGVSREDIER	1913	sp|P53355|DAPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2444.3	18.95918	3	1295.587571	1295.598328	R	E	54	64
PSM	SRNNSHVNREEVIR	1914	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2385.3	17.65775	4	1788.8303	1788.8375	K	E	202	216
PSM	TIAPALVSK	1915	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2740.2	26.32788	2	898.546247	898.548768	K	K	72	81
PSM	KKSEQLHNVTAFQGK	1916	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2553.2	21.60122	4	1793.880094	1793.882549	K	G	1014	1029
PSM	GRLSLHR	1917	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2451.2	19.13175	2	917.456447	917.459650	K	T	428	435
PSM	SMSGHPEAAQMVR	1918	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2623.5	23.36202	3	1479.602771	1479.599985	R	R	1469	1482
PSM	DGLTDVYNK	1919	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2767.3	27.01865	2	1023.486247	1023.487290	K	I	182	191
PSM	TISETIER	1920	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2761.3	26.86322	2	1027.456647	1027.458706	R	L	700	708
PSM	DEPAGHRLSQEEILGSTR	1921	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2885.3	29.95688	4	2073.9547	2073.9475	R	L	10	28
PSM	RNSTIVLR	1922	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2591.2	22.53848	2	1037.534847	1037.538294	R	T	450	458
PSM	TKEERSSQDHVDEEVFK	1923	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2582.5	22.31725	4	2141.926094	2141.926658	R	R	410	427
PSM	KTSLAPYVK	1924	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2665.5	24.4326	2	1085.549247	1085.552213	K	V	385	394
PSM	TTIFSPEGR	1925	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2888.2	30.03128	2	1086.470847	1086.474691	R	L	9	18
PSM	KLSLDTDAR	1926	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2638.2	23.72977	2	1097.505047	1097.511805	K	F	746	755
PSM	RPSWFTQN	1927	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2996.2	32.77973	2	1114.459047	1114.459709	K	-	181	189
PSM	GRMSMKEVDEQMLNVQNK	1928	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2838.2	28.7546	4	2231.972494	2231.973825	R	N	319	337
PSM	RKTEPSAWSQDTGDANTNGK	1929	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2505.3	20.45223	4	2241.970894	2241.965169	K	D	315	335
PSM	DLEEAEEYK	1930	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2686.3	24.95618	2	1124.486447	1124.487350	K	E	87	96
PSM	RHSSDINHLVTQGR	1931	sp|Q5T0N5|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2591.4	22.54515	3	1698.792671	1698.795131	R	E	486	500
PSM	GFSIPECQK	1932	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2982.2	32.41787	2	1144.459847	1144.462412	R	L	95	104
PSM	EAESSPFVER	1933	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2670.4	24.55732	2	1149.525647	1149.530218	K	L	548	558
PSM	QLSSGVSEIR	1934	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2821.3	28.32368	2	1154.529647	1154.533268	R	H	80	90
PSM	SIYYITGESK	1935	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2877.3	29.75523	2	1159.572647	1159.576105	K	E	258	268
PSM	ALDDISESIK	1936	sp|Q9Y3B8|ORN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2954.2	31.70695	2	1169.522247	1169.521701	R	E	196	206
PSM	CDEPILSNR	1937	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2697.4	25.24277	2	1182.473447	1182.474039	K	S	133	142
PSM	SSSPVTELASR	1938	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2908.3	30.53928	2	1212.536047	1212.538748	R	S	1101	1112
PSM	EFDRHSGSDRSSFSHYSGLK	1939	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2738.4	26.28307	4	2457.973694	2457.974033	R	H	192	212
PSM	SNSHAAIDWGK	1940	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2709.2	25.53803	2	1264.518847	1264.523766	K	M	1666	1677
PSM	ELISNASDALDK	1941	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2909.4	30.56843	2	1274.631447	1274.635411	R	I	103	115
PSM	GRLSKEDIER	1942	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2442.2	18.90433	3	1281.609371	1281.607830	K	M	508	518
PSM	KRSEGFSMDR	1943	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2486.2	19.98505	3	1291.536071	1291.538036	R	K	452	462
PSM	NAGVEGSLIVEK	1944	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2938.6	31.32102	2	1294.614447	1294.616998	K	I	482	494
PSM	STPRPKFSVCVLGDQQHCDEAK	1945	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,10-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.2913.3	30.668	4	2638.160494	2638.166923	K	A	57	79
PSM	SRSSDIVSSVR	1946	sp|Q14C86|GAPD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2687.4	24.98518	2	1351.550047	1351.553426	R	R	900	911
PSM	RKNSTDLDSAPEDPTSPK	1947	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2503.5	20.40747	3	2036.906471	2036.905194	K	R	1394	1412
PSM	RNPPGGKSSLVLG	1948	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2672.5	24.61223	2	1360.682847	1360.686415	R	-	142	155
PSM	SGYGPSDGPSYGR	1949	sp|O95429|BAG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2666.3	24.45192	2	1378.512647	1378.519075	R	Y	7	20
PSM	RRLSYNTASNK	1950	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2373.2	17.3534	3	1388.656871	1388.656178	R	T	9	20
PSM	QLSMSSADSADAK	1951	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2637.3	23.70817	2	1389.545247	1389.548326	R	R	414	427
PSM	SSSSGHYVSWVK	1952	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2875.2	29.69977	3	1402.590371	1402.591846	R	R	430	442
PSM	KASGPPVSELITK	1953	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2954.5	31.71695	2	1405.719047	1405.721798	R	A	34	47
PSM	ASNGDAWVEAHGK	1954	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2629.4	23.50868	2	1420.572647	1420.577259	R	L	147	160
PSM	RDSLTGSSDLYK	1955	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2708.5	25.5231	2	1420.618847	1420.623540	R	R	707	719
PSM	SWRESCDSALR	1956	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2670.2	24.55065	3	1445.569571	1445.575879	K	A	119	130
PSM	GRLSVASTPISQR	1957	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2757.5	26.76583	2	1450.722847	1450.729343	R	R	237	250
PSM	NNSFTAPSTVGKR	1958	sp|O95453|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2604.2	22.87337	3	1457.661971	1457.666408	R	N	555	568
PSM	FGPARNDSVIVADQTPTPTR	1959	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2959.4	31.84098	3	2221.0447	2221.0523	K	F	55	75
PSM	IRDYSLSGAYRK	1960	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2671.3	24.58002	3	1507.716971	1507.718444	K	I	565	577
PSM	QKASIHEAWTDGK	1961	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2609.4	23.0087	3	1549.691771	1549.692623	R	E	401	414
PSM	DFTVSAMHGDMDQK	1962	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2933.2	31.17825	3	1580.660171	1580.659928	R	E	296	310
PSM	RLSTSPDVIQGHQPR	1963	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2654.4	24.14413	3	1769.853071	1769.857397	R	D	264	279
PSM	GGSVLVTCSTSCDQPK	1964	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2741.6	26.3672	2	1774.720647	1774.726702	R	L	41	57
PSM	DKPHVNVGTIGHVDHGK	1965	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2556.3	21.68173	4	1808.926894	1808.928179	R	T	54	71
PSM	DAGDKDKEQELSEEDK	1966	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2391.3	17.77168	3	1834.811171	1834.806846	R	Q	35	51
PSM	FRASSQSAPSPDVGSGVQT	1967	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2829.5	28.53263	3	1956.854171	1956.857850	R	-	124	143
PSM	AQSSPAAPASLSAPEPASQAR	1968	sp|Q8WUI4|HDAC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2872.6	29.63573	3	2072.950271	2072.952813	R	V	484	505
PSM	EFHLNESGDPSSKSTEIK	1969	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2759.3	26.81108	4	2083.910094	2083.909945	K	W	155	173
PSM	SRTHSTSSSLGSGESPFSR	1970	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2736.5	26.23458	3	2125.844171	2125.846708	R	S	327	346
PSM	KQSFDDNDSEELEDKDSK	1971	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2560.4	21.78725	4	2207.866494	2207.874348	K	S	105	123
PSM	RTSSAQVEGGVHSLHSYEK	1972	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.2666.5	24.45858	3	2230.938071	2230.940942	K	R	493	512
PSM	SFDPSAREPPGSTAGLPQEPK	1973	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2976.4	32.26992	3	2247.019271	2247.020893	K	T	1327	1348
PSM	QLSLSSSRSSEGSLGGQNSGIGGR	1974	sp|Q9UGP4|LIMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2999.6	32.87077	3	2480.064071	2480.069390	R	S	231	255
PSM	AKSTCSCPDLQPNGQDLGENSR	1975	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,6-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2739.6	26.31562	3	2513.029571	2513.031217	K	V	56	78
PSM	RNSVERPAEPVAGAATPSLVEQQK	1976	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2857.4	29.2435	4	2613.286494	2613.291195	R	M	1454	1478
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	1977	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2784.6	27.45378	3	2779.092371	2779.094999	K	M	571	596
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1978	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2984.6	32.48275	4	3223.230094	3223.230486	K	-	122	148
PSM	SWSLIK	1979	sp|P79522|PRR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	40.84267	2	812.383847	812.383357	K	N	135	141
PSM	ILSGVVTK	1980	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	36.68357	2	895.478247	895.477985	R	M	72	80
PSM	QTGKTSIAIDTIINQK	1981	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3232.2	38.77208	4	1809.926894	1809.923745	R	R	215	231
PSM	QMSLLLR	1982	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3366.2	42.18862	2	939.461647	939.461289	R	R	323	330
PSM	MPSLPSYK	1983	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3152.2	36.73437	2	1001.428047	1001.429321	R	V	303	311
PSM	DLSLVPER	1984	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3133.2	36.24803	2	1007.467847	1007.468877	R	L	21	29
PSM	DLSLVPER	1985	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.2	36.0241	2	1007.467847	1007.468877	R	L	21	29
PSM	GGSGAPILLR	1986	sp|O95571|ETHE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3082.2	34.95632	2	1019.513447	1019.516496	R	Q	17	27
PSM	DLSLEEIQK	1987	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3063.3	34.47255	2	1073.559047	1073.560455	K	K	44	53
PSM	DFSLEQLR	1988	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3431.2	43.77628	2	1086.476447	1086.474691	R	Q	102	110
PSM	FMSAYEQR	1989	sp|Q15428|SF3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3093.4	35.24842	2	1110.419847	1110.420547	R	I	151	159
PSM	YSVDIPLDK	1990	sp|P61353|RL27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3324.3	41.1311	2	1128.510847	1128.510408	R	T	85	94
PSM	CSVCSEPIMPEPGRDETVR	1991	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,2-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3007.4	33.07025	4	2297.946894	2297.948005	R	V	504	523
PSM	GRYSLDVWS	1992	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3394.3	42.89292	2	1161.487447	1161.485590	K	-	669	678
PSM	SMSAPVIFDR	1993	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	42.06312	2	1201.522047	1201.520261	K	S	117	127
PSM	VEVTEFEDIK	1994	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3129.4	36.15335	2	1207.595847	1207.597235	K	S	133	143
PSM	NFEDVAFDEK	1995	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3080.3	34.90803	2	1212.527247	1212.529883	K	K	376	386
PSM	SLDDEVNAFK	1996	sp|Q14141|SEPT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3234.3	38.82642	2	1216.507047	1216.501300	K	Q	388	398
PSM	RGSRSQSQLLNTLTK	1997	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3003.3	32.96392	3	1847.860571	1847.865592	K	K	4	19
PSM	ALSIGFETCR	1998	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3289.4	40.23545	2	1232.526247	1232.526075	K	Y	69	79
PSM	TLPQLPNEEK	1999	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3003.4	32.96725	2	1247.578447	1247.579884	R	S	644	654
PSM	RVSSGSCFALE	2000	sp|Q9NZJ7|MTCH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3018.3	33.3447	2	1291.524047	1291.526803	R	-	379	390
PSM	SMPWNVDTLSK	2001	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3495.3	45.32784	2	1356.579047	1356.578504	K	D	111	122
PSM	YGSFFCDCGAK	2002	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3216.4	38.37218	2	1390.475647	1390.472325	K	E	1709	1720
PSM	AIPTTGRGSSGVGLTAAVTTDQETGER	2003	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3192.4	37.74943	4	2791.246894	2791.242663	R	R	365	392
PSM	GILAADESTGSIAK	2004	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3002.4	32.94143	2	1411.651047	1411.659591	K	R	29	43
PSM	GSLLLGGLDAEASR	2005	sp|Q6UVK1|CSPG4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3529.4	46.13698	2	1437.685847	1437.686475	R	H	320	334
PSM	SLPSAVYCIEDK	2006	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3350.4	41.78468	2	1460.626647	1460.625849	K	M	667	679
PSM	EINAREESLVEELSPASEK	2007	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3389.3	42.77045	3	2209.017971	2209.015139	K	K	413	432
PSM	RRYSDFEWLK	2008	sp|Q9UMY4|SNX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3174.2	37.27595	3	1478.674271	1478.670765	R	N	70	80
PSM	ELSIHFVPGSCR	2009	sp|Q9NZL9|MAT2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3259.2	39.46468	3	1480.657871	1480.653401	K	L	7	19
PSM	DTCYSPKPSVYLSTPSSASK	2010	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3076.5	34.81375	3	2253.984971	2253.986482	K	A	538	558
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	2011	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3383.3	42.62472	4	3014.197294	3014.188484	K	-	661	690
PSM	LVVPASQCGSLIGK	2012	sp|Q15366|PCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3145.5	36.56512	2	1507.740047	1507.746967	R	G	102	116
PSM	LVVPATQCGSLIGK	2013	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3198.5	37.90873	2	1521.761047	1521.762617	R	G	102	116
PSM	QAGSLASLSDAPPLK	2014	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3263.3	39.57096	2	1533.741847	1533.743990	K	S	276	291
PSM	DLSMSEEDQMMR	2015	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3185.6	37.57388	2	1550.545047	1550.545232	R	A	1366	1378
PSM	CSLPAEEDSVLEK	2016	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3092.5	35.22581	2	1555.646847	1555.647706	K	L	635	648
PSM	APKISIPDVDLDLK	2017	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3647.2	48.37488	3	1602.830471	1602.826991	K	G	4846	4860
PSM	SPSFASEWDEIEK	2018	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3622.5	48.05353	2	1603.646247	1603.644335	K	I	661	674
PSM	NQVAMNPTNTVFDAK	2019	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3047.5	34.07613	2	1648.788647	1648.787906	K	R	57	72
PSM	ALSRQLSSGVSEIR	2020	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3044.6	34.00665	2	1661.7545	1661.7534	R	H	76	90
PSM	SSIHNFMTHPEFR	2021	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3038.4	33.8546	3	1681.707671	1681.707227	R	I	1139	1152
PSM	MSPNETLFLESTNK	2022	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	41.63035	3	1689.739271	1689.732104	K	I	85	99
PSM	MSGGWELELNGTEAK	2023	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	45.18313	2	1700.712447	1700.711703	K	L	105	120
PSM	NRPTSISWDGLDSGK	2024	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	38.9292	3	1791.726971	1791.723011	K	L	48	63
PSM	SLALDIDRDAEDQNR	2025	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3078.4	34.86055	3	1809.789071	1809.789436	K	Y	37	52
PSM	SYDVPPPPMEPDHPFYSNISK	2026	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3423.2	43.5839	4	2496.076494	2496.070880	R	D	118	139
PSM	TSMCSIQSAPPEPATLK	2027	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3079.4	34.88573	3	1896.837071	1896.836252	R	G	410	427
PSM	SRGPATVEDLPSAFEEK	2028	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3260.4	39.49732	3	1911.864671	1911.861539	R	A	247	264
PSM	ETSLAENIWQEQPHSK	2029	sp|O60566|BUB1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3158.6	36.89455	3	1975.866071	1975.867687	R	G	507	523
PSM	MSCFSRPSMSPTPLDR	2030	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,2-UNIMOD:21,3-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3092.3	35.21915	3	2043.767471	2043.765486	R	C	2114	2130
PSM	TSRAPSVATVGSICDLNLK	2031	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3294.5	40.36795	3	2067.996071	2068.002406	R	I	2102	2121
PSM	RKTSDFNTFLAQEGCTK	2032	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3108.4	35.62925	3	2161.890971	2161.890487	R	G	197	214
PSM	QKHSQAVEELAEQLEQTK	2033	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3271.4	39.77427	3	2175.024971	2175.020893	R	R	1192	1210
PSM	CSVCSEPIMPEPGRDETVR	2034	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,2-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3004.6	32.99949	3	2297.942471	2297.948005	R	V	504	523
PSM	HASSSDDFSDFSDDSDFSPSEK	2035	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3236.4	38.8807	3	2487.890471	2487.886369	R	G	129	151
PSM	NTVVPTKKSQIFSTASDNQPTVTIK	2036	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3079.5	34.88906	4	2783.422094	2783.410641	R	V	440	465
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	2037	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3163.5	37.01577	4	3724.469294	3724.469745	R	N	77	111
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	2038	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3286.6	40.16473	3	2988.158471	2988.155727	K	E	144	170
PSM	EITALAPSTMK	2039	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:35	ms_run[1]:scan=1.1.2703.2	25.38955	2	1176.602447	1176.606025	K	I	318	329
PSM	GFSEGLWEIENNPTVK	2040	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4125.2	54.87597	3	1898.8516	1898.8446	K	A	81	97
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	2041	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2625.3	23.40682	5	3566.431618	3565.448950	K	D	124	155
PSM	QASVADYEETVK	2042	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3168.5	37.13327	2	1401.5683	1401.5696	R	K	82	94
PSM	TSDFNTFLAQEGCTK	2043	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3381.2	42.57263	3	1797.733571	1797.728082	K	G	199	214
PSM	SGDEMIFDPTMSK	2044	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3317.4	40.95329	2	1610.5887	1610.5876	M	K	2	15
PSM	RKASGPPVSELITK	2045	sp|P16402|H13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2766.2	26.9895	3	1561.821671	1561.822909	K	A	34	48
PSM	GASQAGMTGYGMPR	2046	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.2958.5	31.81868	2	1478.561247	1478.568351	R	Q	183	197
PSM	SIDTGMGLER	2047	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2663.5	24.38072	2	1173.472047	1173.473705	K	L	237	247
PSM	CESAFLSK	2048	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	40.94662	2	1003.3715	1003.3717	K	R	36	44
PSM	QAGSLASLSDAPPLK	2049	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	49.1754	2	1516.7167	1516.7169	K	S	276	291
PSM	NPSTVCLCPEQPTCSNADSR	2050	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.2909.6	30.5751	3	2371.915271	2371.923247	R	A	37	57
PSM	KASFLR	2051	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2547.2	21.44748	2	800.393447	800.394590	K	A	284	290
PSM	KDDALELQSHAKSPPSPVER	2052	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2907.4	30.51682	4	2364.0832	2363.0552	K	E	1316	1336
PSM	LGLMRDDTIYEDEDVK	2053	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3026.5	33.55788	3	2007.855971	2006.854405	K	E	30	46
PSM	SSFESSCPQQWIK	2054	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3304.3	40.62427	2	1662.676447	1662.674924	R	Y	84	97
PSM	RFSMVVQDGIVK	2055	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3043.3	33.9825	2	1473.702647	1473.705102	K	A	180	192
PSM	ERVPSVAEAPQLRPAGTAAAK	2056	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2867.2	29.49332	4	2198.116094	2198.120882	R	T	536	557
PSM	SRCVSVQTDPTDEIPTK	2057	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.2921.5	30.88158	3	2091.858371	2091.858518	K	K	90	107
PSM	NNESESTLDLEGFQNPTAK	2058	sp|Q5VYS8|TUT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3376.6	42.45875	3	2172.925871	2172.921238	R	E	780	799
PSM	SVVTGGVQSVMGSR	2059	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3131.4	36.20377	2	1442.649447	1442.658880	K	L	167	181
PSM	SFLFSSR	2060	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4621.2	59.27348	2	964.4057	964.4050	M	S	2	9
PSM	GVSINQFCK	2061	sp|Q9Y3B7|RM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2990.3	32.62778	2	1131.475447	1131.478396	R	E	43	52
PSM	STYYWPRPR	2062	sp|Q4V321|GAG13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2957.3	31.78618	2	1304.566247	1304.570323	R	R	7	16
PSM	NHCGIASAASYPTV	2063	sp|P07711|CATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3031.5	33.68727	2	1526.619847	1526.622494	R	-	320	334
PSM	SISQLESLNR	2064	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3094.5	35.27788	2	1225.569047	1225.570382	K	E	574	584
PSM	TLSEAGKSTSIQSFK	2065	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2989.4	32.60546	3	1742.7527	1742.7524	R	D	531	546
PSM	SGGARGSFAPGHGPR	2066	sp|Q9NX00|TM160_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2403.4	18.07412	3	1489.658171	1489.657575	R	A	30	45
PSM	QGRGSDPAIEV	2067	sp|O94766|B3GA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.3109.3	35.65045	2	1190.4980	1190.4964	R	-	325	336
PSM	IDALTEIQKK	2068	sp|Q8N4N8|KIF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3948.2	52.72823	2	1237.634247	1237.631920	K	L	649	659
PSM	SIDSNPYDTDK	2069	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2424.2	18.48807	2	1336.521647	1333.507507	K	M	106	117
PSM	MRSVLISLK	2070	sp|P09496|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2921.3	30.87492	2	1141.589847	1141.593032	R	Q	234	243
PSM	TLDQSPELR	2071	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	40.23212	2	1137.507247	1137.506719	R	S	1162	1171
PSM	SPSTLLPK	2072	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2938.2	31.30768	2	921.457047	921.457250	R	K	825	833
PSM	SPSTLLPK	2073	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2930.2	31.10065	2	921.4565	921.4567	R	K	825	833
PSM	TLQKQSVVYGGK	2074	sp|Q8WWY3|PRP31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2518.2	20.785	3	1386.686471	1386.690832	R	S	427	439
PSM	DISLSDYK	2075	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2911.2	30.61325	2	939.452047	939.454927	K	G	28	36
PSM	GLTSVINQK	2076	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2736.2	26.22458	2	958.543247	958.544745	R	L	300	309
PSM	SSNAETLY	2077	sp|P61289|PSME3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2884.2	29.92762	2	963.356047	963.358658	R	-	247	255
PSM	HELQANCYEEVK	2078	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2583.3	22.33622	3	1518.677771	1518.677293	K	D	133	145
PSM	RSSEMLVK	2079	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2503.2	20.39747	2	1028.4698	1028.4721	R	K	555	563
PSM	SLSAMDVEK	2080	sp|Q6ZV73|FGD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2845.4	28.94205	2	1058.443047	1058.435528	K	C	605	614
PSM	SFSMQDLR	2081	sp|Q9H6H4|REEP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2710.2	25.56297	2	1078.411847	1078.415462	R	S	150	158
PSM	TLSDYNIQK	2082	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2670.3	24.55398	2	1080.544047	1080.545139	R	E	55	64
PSM	VGDYGSLSGR	2083	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2655.3	24.16657	2	1089.446847	1089.449204	R	E	190	200
PSM	SIPHITSDR	2084	sp|Q14194|DPYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2674.2	24.65395	2	1104.492647	1104.496489	K	L	8	17
PSM	GKSSFFSDR	2085	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2681.2	24.8263	2	1109.451847	1109.454290	R	G	80	89
PSM	RPTWAEER	2086	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2546.2	21.4224	2	1123.477847	1123.481173	R	R	382	390
PSM	GYSFTTTAER	2087	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2727.4	25.99992	2	1131.519847	1131.519653	R	E	197	207
PSM	DVNQQEFVR	2088	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2691.3	25.08478	2	1133.543447	1133.546536	K	A	8	17
PSM	GSFSLGEQSR	2089	sp|Q8TEB1|DCA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2795.2	27.71808	2	1146.468447	1146.470668	R	V	146	156
PSM	SDLSSSSGSLSLSHGSSSLEHR	2090	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2841.3	28.83543	4	2295.996894	2295.996863	K	S	1279	1301
PSM	NMSYQGFTK	2091	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2894.2	30.1824	2	1154.443847	1154.446762	R	D	333	342
PSM	EITALAPSTMK	2092	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2896.3	30.23517	2	1160.610647	1160.611110	K	I	318	329
PSM	YLSEVASGDNK	2093	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2535.3	21.14982	2	1181.553847	1181.556432	R	Q	130	141
PSM	TCTTVAFTQVNSEDK	2094	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.2973.4	32.19257	3	1779.738371	1779.738647	K	G	198	213
PSM	GSLPANVPTPR	2095	sp|P33240|CSTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2861.5	29.35015	2	1187.566447	1187.569988	R	G	309	320
PSM	QLEDGRTLSDYNIQK	2096	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2846.3	28.9646	3	1778.880671	1778.879892	K	E	49	64
PSM	NSSISGPFGSR	2097	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2903.2	30.407	2	1187.494647	1187.497217	R	S	483	494
PSM	SLSASPALGSTK	2098	sp|O95544|NADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2734.5	26.18252	2	1197.561847	1197.564234	R	E	46	58
PSM	SSTTSMTSVPK	2099	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2590.2	22.51278	2	1204.500247	1204.504670	R	P	84	95
PSM	NPPGGKSSLVLG	2100	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2852.2	29.11392	2	1204.583047	1204.585304	R	-	143	155
PSM	KGESGQSWPR	2101	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2515.6	20.72073	2	1210.511047	1210.513202	R	L	79	89
PSM	SLVDYENANK	2102	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2761.5	26.86988	2	1231.523047	1231.512199	R	A	316	326
PSM	IGRFSEPHAR	2103	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2539.2	21.24903	3	1248.575771	1248.576471	R	F	136	146
PSM	RRNTLQLHR	2104	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2395.2	17.8655	3	1272.654371	1272.656452	R	Y	194	203
PSM	KNSSIIGDYK	2105	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2771.5	27.12928	2	1283.5168470956603	1283.52000019259	K	Q	929	939
PSM	EDQTEYLEER	2106	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2693.4	25.13948	2	1310.558647	1310.562640	K	R	166	176
PSM	VASETHSEGSEYEELPK	2107	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2782.5	27.40195	3	1970.819471	1970.814648	R	R	1130	1147
PSM	SRMHNIPVYK	2108	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2611.3	23.05718	3	1323.612371	1323.615893	R	D	89	99
PSM	SSVVPCELACR	2109	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2944.3	31.46278	2	1356.556247	1356.556723	K	T	428	439
PSM	KESLPVKPRPK	2110	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2427.2	18.55892	3	1357.74607064349	1357.74828667821	R	K	49	60
PSM	ALSTTASTAAFDK	2111	sp|P57772|SELB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2924.4	30.95533	2	1362.601647	1362.606827	R	Q	26	39
PSM	IIYGGSVTGATCK	2112	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2832.5	28.61018	2	1405.628247	1405.631268	R	E	244	257
PSM	TWGRLSTQSNSNNIEPAR	2113	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2884.6	29.94095	3	2109.954071	2109.959296	K	T	1049	1067
PSM	GGSGSHNWGTVKDELTESPK	2114	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2972.6	32.17403	3	2164.941371	2164.942643	R	Y	217	237
PSM	AHSSMVGVNLPQK	2115	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2823.5	28.38043	2	1446.662047	1446.669050	R	A	172	185
PSM	RLGRGSVSDCSDGTSELEEPLGEDPR	2116	sp|P50548|ERF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2991.5	32.66048	4	2897.248094	2897.249860	R	A	180	206
PSM	VASFSCMCPEGK	2117	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2977.4	32.29573	2	1451.526447	1451.528460	R	A	357	369
PSM	NTNDANSCQIIIPQNQVNR	2118	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2926.6	31.01222	3	2198.046971	2198.049828	K	K	310	329
PSM	SFDPSAREPPGSTAGLPQEPK	2119	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2984.5	32.47942	3	2247.019271	2247.020893	K	T	1327	1348
PSM	DTYSDRSGSSSPDSEITELK	2120	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2993.4	32.70897	3	2252.931371	2252.932197	R	F	565	585
PSM	DLEGLSQRHEEK	2121	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2505.2	20.4489	3	1519.6634	1519.6663	K	V	1393	1405
PSM	SKSSLHLLSHETK	2122	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2563.2	21.85547	3	1545.752471	1545.755223	K	I	213	226
PSM	HRPSEADEEELAR	2123	sp|O14617|AP3D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2476.5	19.76065	3	1617.676871	1617.678429	K	R	655	668
PSM	LSQQRESLLAEQR	2124	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2661.2	24.31873	3	1636.791371	1636.793399	R	G	798	811
PSM	AQSQTDRVDLGTLR	2125	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2900.3	30.33355	3	1638.767771	1638.772664	K	G	93	107
PSM	QEYDESGPSIVHRK	2126	sp|Q9BYX7|ACTBM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2519.2	20.81067	3	1643.786171	1643.790349	K	C	360	374
PSM	RSSRLFTSDSSTTK	2127	sp|P30260|CDC27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2485.6	19.9727	3	1651.755071	1651.756680	R	E	377	391
PSM	ETQKSIYYITGESK	2128	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2838.3	28.75793	3	1725.783971	1725.786248	K	E	478	492
PSM	RATQRDLDNAGELGR	2129	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2566.5	21.94	3	1750.806971	1750.811175	R	S	1371	1386
PSM	HASSGSFLPSANEHLK	2130	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2830.5	28.55857	3	1760.786771	1760.788314	R	E	115	131
PSM	RLQSIGTENTEENRR	2131	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.2433.2	18.71322	4	1801.901694	1801.903087	K	F	43	58
PSM	FCSNSGRLSGPAELR	2132	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	32.5471	3	1809.724871	1809.727050	R	S	1235	1250
PSM	HQGVMVGMGQKDSYVGDEAQSK	2133	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2671.6	24.59002	4	2446.028894	2446.029426	R	R	42	64
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	2134	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2559.4	21.76192	5	3188.309618	3188.312914	K	K	97	126
PSM	SRSRDSGDENEPIQER	2135	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2383.6	17.61397	3	1953.809171	1953.817776	R	F	1116	1132
PSM	SSPSARPPDVPGQQPQAAK	2136	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2606.5	22.93457	3	1996.933571	1996.936769	R	S	82	101
PSM	NYSREQHGVAASCLEDLR	2137	sp|O00273|DFFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2925.5	30.98375	3	2183.938571	2183.941931	R	S	26	44
PSM	SSGGSEHSTEGSVSLGDGQLNR	2138	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2717.3	25.7423	3	2239.931771	2239.934263	R	Y	381	403
PSM	RKPSVPDSASPADDSFVDPGER	2139	sp|P16333|NCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2888.6	30.04462	3	2408.058671	2408.064549	K	L	82	104
PSM	CQRDSSCGTGYELTEDNSCK	2140	sp|P23142|FBLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:4,6-UNIMOD:21,7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.2639.6	23.76807	3	2445.884771	2445.887255	R	D	242	262
PSM	SGSSPGLRDGSGTPSRHSLSGSSPGMK	2141	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2590.4	22.51945	4	2745.156494	2745.157888	R	D	1441	1468
PSM	NFDEILR	2142	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3069.2	34.62467	2	905.462047	905.460681	R	V	156	163
PSM	DIGFIKLD	2143	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3660.2	48.50075	2	919.501647	919.501484	K	-	49	57
PSM	SLSVLSPR	2144	sp|P53814|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3024.2	33.49582	2	937.462847	937.463398	R	Q	299	307
PSM	NSLLSLSDT	2145	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3323.2	41.1018	2	948.477447	948.476391	K	-	366	375
PSM	EAFSLFDK	2146	sp|P27482|CALL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3284.2	40.09968	2	955.465647	955.465098	K	D	15	23
PSM	TVSYLGLE	2147	sp|O00244|ATOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3562.2	46.8813	2	960.417847	960.420530	K	-	61	69
PSM	SLDFYTR	2148	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3137.2	36.35032	2	980.400447	980.400463	K	V	45	52
PSM	SFAVGMFK	2149	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3147.3	36.6097	2	981.405047	981.403106	K	G	72	80
PSM	NLLSVAYK	2150	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	41.15373	2	986.484047	986.483799	R	N	44	52
PSM	NDSLPVLR	2151	sp|Q9GZY8-5|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3079.2	34.87907	2	992.468447	992.469212	R	G	144	152
PSM	QMSFDLTK	2152	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3201.2	37.97668	2	1048.431247	1048.430049	R	L	916	924
PSM	MESALDQLK	2153	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3051.3	34.16865	2	1113.477447	1113.477727	R	Q	11	20
PSM	RPSWFTQN	2154	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3021.2	33.41813	2	1114.457247	1114.459709	K	-	181	189
PSM	RPSWFTQN	2155	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3012.2	33.19325	2	1114.457647	1114.459709	K	-	181	189
PSM	RPSWFTQN	2156	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3004.2	32.98615	2	1114.457647	1114.459709	K	-	181	189
PSM	SADTLWGIQK	2157	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3075.3	34.78238	2	1117.576247	1117.576774	K	E	319	329
PSM	SPSSLLEDAK	2158	sp|P42684|ABL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3057.3	34.3207	2	1125.495247	1125.495486	K	E	631	641
PSM	GSSIFGLAPSK	2159	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3323.4	41.10847	2	1142.538247	1142.537291	R	A	390	401
PSM	SIFDPNTFK	2160	sp|Q8TDM6|DLG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	42.08878	2	1147.497047	1147.495092	K	R	972	981
PSM	GRSDRGSGQGDSLYPVGYLDK	2161	sp|Q5J8M3|EMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3103.3	35.50345	4	2306.033294	2306.032855	R	Q	30	51
PSM	RKTSDANETEDHLESLICK	2162	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3055.5	34.27672	4	2325.0284	2325.0303	R	V	19	38
PSM	ELSLDDPEVEQVSGR	2163	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3320.2	41.02423	3	1751.770271	1751.761490	R	G	172	187
PSM	KQSLPATSIPTPASFK	2164	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3205.4	38.087	3	1751.886971	1751.885903	R	F	1507	1523
PSM	TFSLSPDAPR	2165	sp|Q9UMF0|ICAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3063.6	34.48255	2	1169.512247	1169.511805	R	L	223	233
PSM	DIFQEIYDK	2166	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3542.2	46.40053	2	1169.557447	1169.560455	K	Q	225	234
PSM	SIFAQEIAAR	2167	sp|Q9BWH6|RPAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3211.2	38.23577	2	1184.558647	1184.559089	R	R	150	160
PSM	INPDGSQSVVEVPYAR	2168	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	37.69058	3	1809.831371	1809.829845	R	S	58	74
PSM	RPSNLAVTVDDSAEFK	2169	sp|Q9Y6N7|ROBO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3096.2	35.3192	3	1827.834671	1827.840409	K	C	267	283
PSM	DLFDPIIEDR	2170	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3745.2	49.77827	2	1231.610247	1231.608468	K	H	87	97
PSM	SYGANFSWNK	2171	sp|O43181|NDUS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3173.3	37.25337	2	1252.492447	1252.491404	K	R	159	169
PSM	GPLQSVQVFGR	2172	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	41.8574	2	1266.614047	1266.612187	K	K	5	16
PSM	SYSSPDITQAIQEEEK	2173	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3359.5	42.01818	3	1903.815071	1903.808834	R	R	716	732
PSM	LDIDSPPITAR	2174	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3186.5	37.59657	2	1276.606247	1276.606433	R	N	33	44
PSM	GDNITLLQSVSN	2175	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3488.2	45.15222	2	1339.600847	1339.602076	K	-	81	93
PSM	TSIAIDTIINQK	2176	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3489.2	45.17647	2	1395.701847	1395.701062	K	R	219	231
PSM	SISGPSVGVMEMR	2177	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3302.4	40.56662	2	1428.613647	1428.614238	R	S	53	66
PSM	TLTIVDTGIGMTK	2178	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3325.3	41.15707	2	1444.688247	1444.688449	R	A	28	41
PSM	SVWGSLAVQNSPK	2179	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3282.3	40.05148	2	1451.681447	1451.680995	K	G	343	356
PSM	NGTLPWLRPDSK	2180	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	41.17982	3	1462.698671	1462.696980	R	T	170	182
PSM	NLSEVPQCVWR	2181	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3412.6	43.32287	2	1466.638847	1466.637751	R	I	47	58
PSM	SIDLPIQSSLCR	2182	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3570.4	47.06433	2	1467.677247	1467.679281	K	Q	579	591
PSM	DGQAMLWDLNEGK	2183	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3472.3	44.77202	2	1475.667247	1475.671479	K	H	213	226
PSM	LTFDSSFSPNTGK	2184	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3224.4	38.57433	2	1479.629447	1479.628291	K	K	97	110
PSM	TTPSYVAFTDTER	2185	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3022.3	33.44736	2	1486.693247	1486.693989	R	L	37	50
PSM	SLYYYIQQDTK	2186	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3352.5	41.83877	2	1500.657247	1500.653778	K	G	314	325
PSM	TGTAEMSSILEER	2187	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3223.5	38.5527	2	1502.631847	1502.632390	K	I	46	59
PSM	GISLNPEQWSQLK	2188	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3813.2	50.86802	3	1578.748271	1578.744324	K	E	102	115
PSM	NGSEADIDEGLYSR	2189	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3005.6	33.02532	2	1604.634247	1604.635561	K	Q	44	58
PSM	QLSLEGSGLGVEDLK	2190	sp|Q9UMZ2|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3559.4	46.81515	2	1623.773247	1623.775684	R	D	750	765
PSM	DKWSNFDPTGLER	2191	sp|Q9NVI7|ATD3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3359.2	42.00818	3	1643.703971	1643.698102	K	A	45	58
PSM	SSMDGAGAEEVLAPLR	2192	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,3-UNIMOD:35	ms_run[1]:scan=1.1.3382.4	42.6037	2	1697.730847	1697.733167	R	L	53	69
PSM	DCEECIQLEPTFIK	2193	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.3513.2	45.72535	3	1780.803671	1780.801173	K	G	416	430
PSM	GSFKDDPQLYQEIQER	2194	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3181.3	37.4603	3	2031.892871	2031.893901	K	G	207	223
PSM	DTQSPSTCSEGLLGWSQK	2195	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3500.3	45.45548	3	2059.857971	2059.855802	K	D	709	727
PSM	SSILLDVKPWDDETDMAK	2196	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=1.1.3556.4	46.7318	3	2157.953471	2157.954119	K	L	140	158
PSM	SQSGTLDGESAAWSASGEDSR	2197	sp|P49815|TSC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3052.5	34.20013	3	2176.858871	2176.854615	R	G	1418	1439
PSM	DNLTLWTSDMQGDGEEQNK	2198	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3466.2	44.61632	4	2179.939694	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	2199	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3572.2	47.11003	3	2192.875571	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2200	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3585.2	47.35573	3	2192.875571	2192.873028	R	-	228	248
PSM	SQSTTFNPDDMSEPEFKR	2201	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3148.4	36.63857	3	2194.899671	2194.887830	R	G	599	617
PSM	DNLTLWTSDMQGDGEEQNK	2202	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3206.5	38.11622	3	2195.929571	2195.927707	R	E	226	245
PSM	QMSVPGIFNPHEIPEEMCD	2203	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4325.2	56.83675	3	2308.924271	2308.920393	R	-	1053	1072
PSM	TYSIDGPNASRPQSARPSINEIPER	2204	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3037.5	33.83332	4	2914.306894	2914.301181	R	T	1131	1156
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	2205	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3274.5	39.85238	4	3205.409694	3205.398315	R	S	38	70
PSM	AQALRDNSTMGYMMAK	2206	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.2452.4	19.16028	3	1914.764171	1914.767521	K	K	481	497
PSM	HQGVMVGMGQKDSYVGDEAQSK	2207	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2783.4	27.4228	4	2462.0228	2462.0238	R	R	40	62
PSM	SMGLPTSDEQK	2208	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.2484.5	19.94355	2	1287.501447	1287.505399	K	K	298	309
PSM	QIRSSTTSMTSVPK	2209	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2660.4	24.29962	3	1681.709171	1681.714754	R	P	81	95
PSM	SASSPRLSSSLDNK	2210	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2622.3	23.32925	3	1527.689171	1527.693017	R	E	470	484
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	2211	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3310.4	40.77842	4	3206.385694	3205.398315	R	S	38	70
PSM	ASGVAVSDGVIK	2212	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3164.2	37.02648	2	1223.5708	1223.5794	M	V	2	14
PSM	YAKESLKEEDESDDDNM	2213	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=1.1.2459.3	19.33733	3	2112.768671	2112.771857	K	-	239	256
PSM	CDEPILSNR	2214	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3119.4	35.90343	2	1165.4486	1165.4470	K	S	133	142
PSM	ASGVTVNDEVIK	2215	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3241.3	39.00677	2	1352.6236	1352.6220	M	V	2	14
PSM	NVTLPAVFK	2216	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	47.08204	2	1067.543447	1067.541648	K	A	21	30
PSM	GMSVYGLGR	2217	sp|Q15417|CNN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3171.2	37.1984	2	1018.431447	1018.430718	K	Q	257	266
PSM	PFSAPKPQTSPSPK	2218	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2595.2	22.6415	3	1547.736371	1547.738510	K	R	299	313
PSM	NGVMPSHFSRGSK	2219	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2560.5	21.79058	2	1482.637447	1482.643898	R	S	85	98
PSM	SAGGSSPEGGEDSDREDGNYCPPVKR	2220	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2553.6	21.61455	4	2802.115294	2802.118846	R	E	96	122
PSM	SFLFSSRSSK	2221	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4070.2	54.24547	2	1346.5299	1346.5304	M	T	2	12
PSM	AAAAAAAAAAGAAGGRGSGPGR	2222	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3208.4	38.16467	3	1830.8476	1830.8481	M	R	2	24
PSM	VPLVQRGSANGL	2223	sp|P25098|ARBK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2992.4	32.68318	2	1289.646047	1289.649301	K	-	678	690
PSM	IADPEHDHTGFLTEYVATR	2224	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3226.5	38.62855	3	2330.9606	2330.9605	R	W	190	209
PSM	IKKSTYFSDEEELSD	2225	sp|Q8TBF4|ZCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2958.2	31.80868	3	1869.789971	1869.792122	R	-	203	218
PSM	RISAVSVAER	2226	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2624.5	23.38777	2	1166.578447	1166.580887	R	V	447	457
PSM	LSSIQLGQSEK	2227	sp|Q14679|TTLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2815.3	28.17125	2	1268.600247	1268.601348	R	E	469	480
PSM	RASVFVK	2228	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2520.3	20.83988	2	885.4439	885.4468	K	L	154	161
PSM	RQSNLQEVLER	2229	sp|O75665|OFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2905.5	30.46848	2	1450.689847	1450.692957	R	E	897	908
PSM	KTRYDTSLGLLTK	2230	sp|O00716-2|E2F3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2787.2	27.5143	3	1575.8042	1574.8062	K	K	45	58
PSM	VAGIHKKGDSSAEELK	2231	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2350.2	16.93765	4	1750.848894	1747.850580	R	L	83	99
PSM	ARAHSIQIMK	2232	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2408.2	18.17868	3	1249.597271	1249.600243	R	V	119	129
PSM	RAEQSLQAAIK	2233	sp|Q8IWY4|SCUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2627.3	23.45678	2	1293.640247	1293.644216	K	T	573	584
PSM	RLSSFVTK	2234	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2764.2	26.93758	2	1016.502647	1016.505597	R	G	1404	1412
PSM	DFDGLTDSSAGELSSRR	2235	sp|Q9H1H9|KI13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3065.4	34.52778	3	1891.798871	1891.794916	K	S	1746	1763
PSM	AQALRDNSTMGYMMAK	2236	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3067.5	34.58288	3	1867.768271	1866.782776	K	K	481	497
PSM	SIPITVK	2237	sp|Q8WZ42|TITIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3083.2	34.98218	2	836.440647	836.440872	K	V	25718	25725
PSM	YLIEPCGPGK	2238	sp|Q96QB1|RHG07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3123.2	35.99888	2	1213.539447	1212.525012	R	S	1468	1478
PSM	NSVTPDMMEEMYKK	2239	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3341.3	41.55213	3	1782.694271	1781.707546	K	A	229	243